FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33662

FusionGeneSummary for SH3GLB1_CLCA1

check button Fusion gene summary
Fusion gene informationFusion gene name: SH3GLB1_CLCA1
Fusion gene ID: 33662
HgeneTgene
Gene symbol

SH3GLB1

CLCA1

Gene ID

51100

1179

Gene nameSH3 domain containing GRB2 like, endophilin B1chloride channel accessory 1
SynonymsBif-1|CGI-61|PPP1R70|dJ612B15.2CACC|CACC1|CLCRG1|CaCC-1|GOB5|hCLCA1|hCaCC-1
Cytomap

1p22.3

1p22.3

Type of geneprotein-codingprotein-coding
Descriptionendophilin-B1Bax-interacting factor 1SH3 domain-containing GRB2-like protein B1SH3-containing protein SH3GLB1SH3-domain GRB2 like endophilin B1protein phosphatase 1, regulatory subunit 70testicular tissue protein Li 172calcium-activated chloride channel regulator 1CLCA family member 1, chloride channel regulatorcalcium-activated chloride channel family member 1calcium-activated chloride channel protein 1calcium-dependent chloride channel-1chloride channel regulator
Modification date2018052220180523
UniProtAcc

Q9Y371

A8K7I4

Ensembl transtripts involved in fusion geneENST00000370558, ENST00000535010, 
ENST00000482504, 
ENST00000234701, 
ENST00000394711, 
Fusion gene scores* DoF score3 X 3 X 2=182 X 2 X 2=8
# samples 32
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/8*10)=1.32192809488736
Context

PubMed: SH3GLB1 [Title/Abstract] AND CLCA1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSH3GLB1

GO:0032461

positive regulation of protein oligomerization

19074440

HgeneSH3GLB1

GO:0051259

protein complex oligomerization

19805544


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCESCTCGA-JX-A3PZ-01ASH3GLB1chr1

87181548

+CLCA1chr1

86934704

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000370558ENST00000234701SH3GLB1chr1

87181548

+CLCA1chr1

86934704

+
Frame-shiftENST00000370558ENST00000394711SH3GLB1chr1

87181548

+CLCA1chr1

86934704

+
intron-3CDSENST00000535010ENST00000234701SH3GLB1chr1

87181548

+CLCA1chr1

86934704

+
intron-3CDSENST00000535010ENST00000394711SH3GLB1chr1

87181548

+CLCA1chr1

86934704

+
In-frameENST00000482504ENST00000234701SH3GLB1chr1

87181548

+CLCA1chr1

86934704

+
Frame-shiftENST00000482504ENST00000394711SH3GLB1chr1

87181548

+CLCA1chr1

86934704

+

Top

FusionProtFeatures for SH3GLB1_CLCA1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SH3GLB1

Q9Y371

CLCA1

A8K7I4

May be required for normal outer mitochondrial membranedynamics (PubMed:15452144). Required for coatomer-mediatedretrograde transport in certain cells (By similarity). May recruitother proteins to membranes with high curvature. May promotemembrane fusion (PubMed:11604418). Involved in activation ofcaspase-dependent apoptosis by promoting BAX/BAK1 activation(PubMed:16227588). Isoform 1 acts proapoptotic in fibroblasts (Bysimilarity). Involved in caspase-independent apoptosis duringnutrition starvation and involved in the regulation of autophagy.Activates lipid kinase activity of PIK3C3 during autophagyprobably by associating with the PI3K complex II (PI3KC3-C2)(PubMed:17891140). Associated with PI3KC3-C2 during autophagy mayregulate the trafficking of ATG9A from the Golgi complex to theperipheral cytoplasm for the formation of autophagosomes byinducing Golgi membrane tubulation and fragmentation(PubMed:21068542). Involved in regulation of degradative endocytictrafficking and cytokinesis, probably in the context of PI3KC3-C2(PubMed:20643123). Isoform 2 acts antiapoptotic in neuronal cells;involved in maintenance of mitochondrial morphology and promotesneuronal viability (By similarity). {ECO:0000250|UniProtKB:Q9JK48,ECO:0000269|PubMed:11604418, ECO:0000269|PubMed:15452144,ECO:0000269|PubMed:17891140, ECO:0000269|PubMed:20643123,ECO:0000269|PubMed:21068542}. May be involved in mediating calcium-activated chlorideconductance. May play critical roles in goblet cell metaplasia,mucus hypersecretion, cystic fibrosis and AHR. May be involved inthe regulation of mucus production and/or secretion by gobletcells. Involved in the regulation of tissue inflammation in theinnate immune response. May play a role as a tumor suppressor.Induces MUC5AC. {ECO:0000269|PubMed:11445004,ECO:0000269|PubMed:11842292, ECO:0000269|PubMed:11956057,ECO:0000269|PubMed:23112050, ECO:0000269|PubMed:9828122}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000370558+291_3071366RegionNote=Membrane-binding amphipathic helix
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000370558+291_3771366RegionRequired for membrane binding
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000482504+2111_3071387RegionNote=Membrane-binding amphipathic helix
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000482504+2111_3771387RegionRequired for membrane binding
TgeneCLCA1chr1:87181548chr1:86934704ENST00000234701+015306_475-117915DomainVWFA
TgeneCLCA1chr1:87181548chr1:86934704ENST00000394711+014306_475-43915DomainVWFA
TgeneCLCA1chr1:87181548chr1:86934704ENST00000234701+01546_199-117915RegionMetalloprotease domain
TgeneCLCA1chr1:87181548chr1:86934704ENST00000394711+01446_199-43915RegionMetalloprotease domain

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000370558+29155_19571366Coiled coilOntology_term=ECO:0000255
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000482504+211155_19571387Coiled coilOntology_term=ECO:0000255
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000535010+18155_195-147266Coiled coilOntology_term=ECO:0000255
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000370558+2927_26171366DomainBAR
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000370558+29305_36571366DomainSH3
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000482504+21127_26171387DomainBAR
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000482504+211305_36571387DomainSH3
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000535010+1827_261-147266DomainBAR
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000535010+18305_365-147266DomainSH3
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000535010+181_30-147266RegionNote=Membrane-binding amphipathic helix
HgeneSH3GLB1chr1:87181548chr1:86934704ENST00000535010+181_37-147266RegionRequired for membrane binding


Top

FusionGeneSequence for SH3GLB1_CLCA1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SH3GLB1_ENST00000370558_chr1_87181548_+_CLCA1_ENST00000234701_chr1_86934704_+_1073aa
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPTSGTAEGRWKYLQVRNLRL
RYCYHSPIEDKSNSKTHQVRGLKTCDKPLPISWKRVSIFSYLYIYNGKERHLRNPHFPKREITGRCTAMGPFKSSVFILILHLLEGALSN
SLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQASLYLLEATGKRFYFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPP
GNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDEYNNDEKFYLSNGRIQAVRCSAGITGTNVVKKCQG
GSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFAQHVDSIVEFCTEQNHNKEAPNKQNQKCNLRSTWEVIRDSEDFKKTTPMTTQP
PNPTFSLLQIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQTVELGSWVGMVTFDSAAHVQNELIQINSGSDRDTLAKRLPAAASGG
TSICSGLRSAFTVIRKKYPTDGSEIVLLTDGEDNTISGCFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDAF
GALSSGNGAVSQRSIQLESKGLTLQNSQWMNGTVIVDSTVGKDTLFLITWTMQPPQILLWDPSGQKQGGFVVDKNTKMAYLQIPGIAKVG
TWKYSLQASSQTLTLTVTSRASNATLPPITVTSKTNKDTSKFPSPLVVYANIRQGASPILRASVTALIESVNGKTVTLELLDNGAGADAT
KDDGVYSRYFTTYDTNGRYSVKVRALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDDVQHKQVCFSRTSSGGSFVASDV
PNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAPGDDYDHGTAHKYIIRISTSILDLRDKFNESLQVNTTALIPKEANSEEVFLFKPENI

>In-frame_SH3GLB1_ENST00000482504_chr1_87181548_+_CLCA1_ENST00000234701_chr1_86934704_+_1073aa
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPTSGTAEGRWKYLQVRNLRL
RYCYHSPIEDKSNSKTHQVRGLKTCDKPLPISWKRVSIFSYLYIYNGKERHLRNPHFPKREITGRCTAMGPFKSSVFILILHLLEGALSN
SLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQASLYLLEATGKRFYFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPP
GNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDEYNNDEKFYLSNGRIQAVRCSAGITGTNVVKKCQG
GSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFAQHVDSIVEFCTEQNHNKEAPNKQNQKCNLRSTWEVIRDSEDFKKTTPMTTQP
PNPTFSLLQIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQTVELGSWVGMVTFDSAAHVQNELIQINSGSDRDTLAKRLPAAASGG
TSICSGLRSAFTVIRKKYPTDGSEIVLLTDGEDNTISGCFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDAF
GALSSGNGAVSQRSIQLESKGLTLQNSQWMNGTVIVDSTVGKDTLFLITWTMQPPQILLWDPSGQKQGGFVVDKNTKMAYLQIPGIAKVG
TWKYSLQASSQTLTLTVTSRASNATLPPITVTSKTNKDTSKFPSPLVVYANIRQGASPILRASVTALIESVNGKTVTLELLDNGAGADAT
KDDGVYSRYFTTYDTNGRYSVKVRALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDDVQHKQVCFSRTSSGGSFVASDV
PNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAPGDDYDHGTAHKYIIRISTSILDLRDKFNESLQVNTTALIPKEANSEEVFLFKPENI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SH3GLB1_ENST00000370558_chr1_87181548_+_CLCA1_ENST00000234701_chr1_86934704_+_3219nt
ATGAATATCATGGACTTCAACGTGAAGAAGCTGGCGGCCGACGCAGGCACCTTCCTCAGTCGCGCCGTGCAGTTCACAGAAGAAAAGCTT
GGCCAGGCTGAGAAGACAGAATTGGATGCTCACTTAGAGAACCTCCTTAGCAAAGCTGAATGTACCAAAATATGGACAGAAAAAATAATG
AAACAAACTGAAGTGTTATTGCAGCCAAATCCAACATCTGGCACAGCTGAAGGCAGATGGAAATATTTACAAGTACGCAATTTGAGACTA
AGATATTGTTATCATTCTCCTATTGAAGACAAGAGCAATAGTAAAACACATCAGGTCAGGGGGTTAAAGACCTGTGATAAACCACTTCCG
ATAAGTTGGAAACGTGTGTCTATATTTTCATATCTGTATATATATAATGGTAAAGAAAGACACCTTCGTAACCCGCATTTTCCAAAGAGA
GAAATCACAGGGAGATGTACAGCAATGGGGCCATTTAAGAGTTCTGTGTTCATCTTGATTCTTCACCTTCTAGAAGGGGCCCTGAGTAAT
TCACTCATTCAGCTGAACAACAATGGCTATGAAGGCATTGTCGTTGCAATCGACCCCAATGTGCCAGAAGATGAAACACTCATTCAACAA
ATAAAGGACATGGTGACCCAGGCATCTCTGTATCTGCTTGAAGCTACAGGAAAGCGATTTTATTTCAAAAATGTTGCCATTTTGATTCCT
GAAACATGGAAGACAAAGGCTGACTATGTGAGACCAAAACTTGAGACCTACAAAAATGCTGATGTTCTGGTTGCTGAGTCTACTCCTCCA
GGTAATGATGAACCCTACACTGAGCAGATGGGCAACTGTGGAGAGAAGGGTGAAAGGATCCACCTCACTCCTGATTTCATTGCAGGAAAA
AAGTTAGCTGAATATGGACCACAAGGTAGGGCATTTGTCCATGAGTGGGCTCATCTACGATGGGGAGTATTTGACGAGTACAATAATGAT
GAGAAATTCTACTTATCCAATGGAAGAATACAAGCAGTAAGATGTTCAGCAGGTATTACTGGTACAAATGTAGTAAAGAAGTGTCAGGGA
GGCAGCTGTTACACCAAAAGATGCACATTCAATAAAGTAACAGGACTCTATGAAAAAGGATGTGAGTTTGTTCTCCAATCCCGCCAGACG
GAGAAGGCTTCTATAATGTTTGCACAACATGTTGATTCTATAGTTGAATTCTGTACAGAACAAAACCACAACAAAGAAGCTCCAAACAAG
CAAAATCAAAAATGCAATCTCCGAAGCACATGGGAAGTGATCCGTGATTCTGAGGACTTTAAGAAAACCACTCCTATGACAACACAGCCA
CCAAATCCCACCTTCTCATTGCTGCAGATTGGACAAAGAATTGTGTGTTTAGTCCTTGACAAATCTGGAAGCATGGCGACTGGTAACCGC
CTCAATCGACTGAATCAAGCAGGCCAGCTTTTCCTGCTGCAGACAGTTGAGCTGGGGTCCTGGGTTGGGATGGTGACATTTGACAGTGCT
GCCCATGTACAAAATGAACTCATACAGATAAACAGTGGCAGTGACAGGGACACACTCGCCAAAAGATTACCTGCAGCAGCTTCAGGAGGG
ACGTCCATCTGCAGCGGGCTTCGATCGGCATTTACTGTGATTAGGAAGAAATATCCAACTGATGGATCTGAAATTGTGCTGCTGACGGAT
GGGGAAGACAACACTATAAGTGGGTGCTTTAACGAGGTCAAACAAAGTGGTGCCATCATCCACACAGTCGCTTTGGGGCCCTCTGCAGCT
CAAGAACTAGAGGAGCTGTCCAAAATGACAGGAGGTTTACAGACATATGCTTCAGATCAAGTTCAGAACAATGGCCTCATTGATGCTTTT
GGGGCCCTTTCATCAGGAAATGGAGCTGTCTCTCAGCGCTCCATCCAGCTTGAGAGTAAGGGATTAACCCTCCAGAACAGCCAGTGGATG
AATGGCACAGTGATCGTGGACAGCACCGTGGGAAAGGACACTTTGTTTCTTATCACCTGGACAATGCAGCCTCCCCAAATCCTTCTCTGG
GATCCCAGTGGACAGAAGCAAGGTGGCTTTGTAGTGGACAAAAACACCAAAATGGCCTACCTCCAAATCCCAGGCATTGCTAAGGTTGGC
ACTTGGAAATACAGTCTGCAAGCAAGCTCACAAACCTTGACCCTGACTGTCACGTCCCGTGCGTCCAATGCTACCCTGCCTCCAATTACA
GTGACTTCCAAAACGAACAAGGACACCAGCAAATTCCCCAGCCCTCTGGTAGTTTATGCAAATATTCGCCAAGGAGCCTCCCCAATTCTC
AGGGCCAGTGTCACAGCCCTGATTGAATCAGTGAATGGAAAAACAGTTACCTTGGAACTACTGGATAATGGAGCAGGTGCTGATGCTACT
AAGGATGACGGTGTCTACTCAAGGTATTTCACAACTTATGACACGAATGGTAGATACAGTGTAAAAGTGCGGGCTCTGGGAGGAGTTAAC
GCAGCCAGACGGAGAGTGATACCCCAGCAGAGTGGAGCACTGTACATACCTGGCTGGATTGAGAATGATGAAATACAATGGAATCCACCA
AGACCTGAAATTAATAAGGATGATGTTCAACACAAGCAAGTGTGTTTCAGCAGAACATCCTCGGGAGGCTCATTTGTGGCTTCTGATGTC
CCAAATGCTCCCATACCTGATCTCTTCCCACCTGGCCAAATCACCGACCTGAAGGCGGAAATTCACGGGGGCAGTCTCATTAATCTGACT
TGGACAGCTCCTGGGGATGATTATGACCATGGAACAGCTCACAAGTATATCATTCGAATAAGTACAAGTATTCTTGATCTCAGAGACAAG
TTCAATGAATCTCTTCAAGTGAATACTACTGCTCTCATCCCAAAGGAAGCCAACTCTGAGGAAGTCTTTTTGTTTAAACCAGAAAACATT
ACTTTTGAAAATGGCACAGATCTTTTCATTGCTATTCAGGCTGTTGATAAGGTCGATCTGAAATCAGAAATATCCAACATTGCACGAGTA
TCTTTGTTTATTCCTCCACAGACTCCGCCAGAGACACCTAGTCCTGATGAAACGTCTGCTCCTTGTCCTAATATTCATATCAACAGCACC

>In-frame_SH3GLB1_ENST00000482504_chr1_87181548_+_CLCA1_ENST00000234701_chr1_86934704_+_3219nt
ATGAATATCATGGACTTCAACGTGAAGAAGCTGGCGGCCGACGCAGGCACCTTCCTCAGTCGCGCCGTGCAGTTCACAGAAGAAAAGCTT
GGCCAGGCTGAGAAGACAGAATTGGATGCTCACTTAGAGAACCTCCTTAGCAAAGCTGAATGTACCAAAATATGGACAGAAAAAATAATG
AAACAAACTGAAGTGTTATTGCAGCCAAATCCAACATCTGGCACAGCTGAAGGCAGATGGAAATATTTACAAGTACGCAATTTGAGACTA
AGATATTGTTATCATTCTCCTATTGAAGACAAGAGCAATAGTAAAACACATCAGGTCAGGGGGTTAAAGACCTGTGATAAACCACTTCCG
ATAAGTTGGAAACGTGTGTCTATATTTTCATATCTGTATATATATAATGGTAAAGAAAGACACCTTCGTAACCCGCATTTTCCAAAGAGA
GAAATCACAGGGAGATGTACAGCAATGGGGCCATTTAAGAGTTCTGTGTTCATCTTGATTCTTCACCTTCTAGAAGGGGCCCTGAGTAAT
TCACTCATTCAGCTGAACAACAATGGCTATGAAGGCATTGTCGTTGCAATCGACCCCAATGTGCCAGAAGATGAAACACTCATTCAACAA
ATAAAGGACATGGTGACCCAGGCATCTCTGTATCTGCTTGAAGCTACAGGAAAGCGATTTTATTTCAAAAATGTTGCCATTTTGATTCCT
GAAACATGGAAGACAAAGGCTGACTATGTGAGACCAAAACTTGAGACCTACAAAAATGCTGATGTTCTGGTTGCTGAGTCTACTCCTCCA
GGTAATGATGAACCCTACACTGAGCAGATGGGCAACTGTGGAGAGAAGGGTGAAAGGATCCACCTCACTCCTGATTTCATTGCAGGAAAA
AAGTTAGCTGAATATGGACCACAAGGTAGGGCATTTGTCCATGAGTGGGCTCATCTACGATGGGGAGTATTTGACGAGTACAATAATGAT
GAGAAATTCTACTTATCCAATGGAAGAATACAAGCAGTAAGATGTTCAGCAGGTATTACTGGTACAAATGTAGTAAAGAAGTGTCAGGGA
GGCAGCTGTTACACCAAAAGATGCACATTCAATAAAGTAACAGGACTCTATGAAAAAGGATGTGAGTTTGTTCTCCAATCCCGCCAGACG
GAGAAGGCTTCTATAATGTTTGCACAACATGTTGATTCTATAGTTGAATTCTGTACAGAACAAAACCACAACAAAGAAGCTCCAAACAAG
CAAAATCAAAAATGCAATCTCCGAAGCACATGGGAAGTGATCCGTGATTCTGAGGACTTTAAGAAAACCACTCCTATGACAACACAGCCA
CCAAATCCCACCTTCTCATTGCTGCAGATTGGACAAAGAATTGTGTGTTTAGTCCTTGACAAATCTGGAAGCATGGCGACTGGTAACCGC
CTCAATCGACTGAATCAAGCAGGCCAGCTTTTCCTGCTGCAGACAGTTGAGCTGGGGTCCTGGGTTGGGATGGTGACATTTGACAGTGCT
GCCCATGTACAAAATGAACTCATACAGATAAACAGTGGCAGTGACAGGGACACACTCGCCAAAAGATTACCTGCAGCAGCTTCAGGAGGG
ACGTCCATCTGCAGCGGGCTTCGATCGGCATTTACTGTGATTAGGAAGAAATATCCAACTGATGGATCTGAAATTGTGCTGCTGACGGAT
GGGGAAGACAACACTATAAGTGGGTGCTTTAACGAGGTCAAACAAAGTGGTGCCATCATCCACACAGTCGCTTTGGGGCCCTCTGCAGCT
CAAGAACTAGAGGAGCTGTCCAAAATGACAGGAGGTTTACAGACATATGCTTCAGATCAAGTTCAGAACAATGGCCTCATTGATGCTTTT
GGGGCCCTTTCATCAGGAAATGGAGCTGTCTCTCAGCGCTCCATCCAGCTTGAGAGTAAGGGATTAACCCTCCAGAACAGCCAGTGGATG
AATGGCACAGTGATCGTGGACAGCACCGTGGGAAAGGACACTTTGTTTCTTATCACCTGGACAATGCAGCCTCCCCAAATCCTTCTCTGG
GATCCCAGTGGACAGAAGCAAGGTGGCTTTGTAGTGGACAAAAACACCAAAATGGCCTACCTCCAAATCCCAGGCATTGCTAAGGTTGGC
ACTTGGAAATACAGTCTGCAAGCAAGCTCACAAACCTTGACCCTGACTGTCACGTCCCGTGCGTCCAATGCTACCCTGCCTCCAATTACA
GTGACTTCCAAAACGAACAAGGACACCAGCAAATTCCCCAGCCCTCTGGTAGTTTATGCAAATATTCGCCAAGGAGCCTCCCCAATTCTC
AGGGCCAGTGTCACAGCCCTGATTGAATCAGTGAATGGAAAAACAGTTACCTTGGAACTACTGGATAATGGAGCAGGTGCTGATGCTACT
AAGGATGACGGTGTCTACTCAAGGTATTTCACAACTTATGACACGAATGGTAGATACAGTGTAAAAGTGCGGGCTCTGGGAGGAGTTAAC
GCAGCCAGACGGAGAGTGATACCCCAGCAGAGTGGAGCACTGTACATACCTGGCTGGATTGAGAATGATGAAATACAATGGAATCCACCA
AGACCTGAAATTAATAAGGATGATGTTCAACACAAGCAAGTGTGTTTCAGCAGAACATCCTCGGGAGGCTCATTTGTGGCTTCTGATGTC
CCAAATGCTCCCATACCTGATCTCTTCCCACCTGGCCAAATCACCGACCTGAAGGCGGAAATTCACGGGGGCAGTCTCATTAATCTGACT
TGGACAGCTCCTGGGGATGATTATGACCATGGAACAGCTCACAAGTATATCATTCGAATAAGTACAAGTATTCTTGATCTCAGAGACAAG
TTCAATGAATCTCTTCAAGTGAATACTACTGCTCTCATCCCAAAGGAAGCCAACTCTGAGGAAGTCTTTTTGTTTAAACCAGAAAACATT
ACTTTTGAAAATGGCACAGATCTTTTCATTGCTATTCAGGCTGTTGATAAGGTCGATCTGAAATCAGAAATATCCAACATTGCACGAGTA
TCTTTGTTTATTCCTCCACAGACTCCGCCAGAGACACCTAGTCCTGATGAAACGTCTGCTCCTTGTCCTAATATTCATATCAACAGCACC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SH3GLB1_ENST00000370558_chr1_87181548_+_CLCA1_ENST00000234701_chr1_86934704_+_3447nt
GTTTTTCCCTTGGGACCCGGGTCCACACGGCGGGGTCGCCCGTCCATCTCCGGCTCGCCCGCGGGGCCCATCGTCGACGTTAGCGGCCGT
TCTCCGAGCCGACTGACCCATCCTTGGCGCTGCCGCCGCGCGCTTGTTCTCCTCCCTCGCCCCGCCTTCATCCTCCCCGTTCACGGAAAC
GACAGCTGCGGCTGCGGGGCTGGCGCCGCCTCCCTCCACCTACCACGTCTGCCCTCGCCGCTCTAGCCCTGCGCCCCAGCCCGGCCGCGG
CACCTCCGCCTCGCCGCCGCTAGGTCGGCCGGCTCCGCCCGGCTGCCGCCTAGGATGAATATCATGGACTTCAACGTGAAGAAGCTGGCG
GCCGACGCAGGCACCTTCCTCAGTCGCGCCGTGCAGTTCACAGAAGAAAAGCTTGGCCAGGCTGAGAAGACAGAATTGGATGCTCACTTA
GAGAACCTCCTTAGCAAAGCTGAATGTACCAAAATATGGACAGAAAAAATAATGAAACAAACTGAAGTGTTATTGCAGCCAAATCCAAAG
GGGCCCTGAGTAATTCACTCATTCAGCTGAACAACAATGGCTATGAAGGCATTGTCGTTGCAATCGACCCCAATGTGCCAGAAGATGAAA
CACTCATTCAACAAATAAAGGACATGGTGACCCAGGCATCTCTGTATCTGCTTGAAGCTACAGGAAAGCGATTTTATTTCAAAAATGTTG
CCATTTTGATTCCTGAAACATGGAAGACAAAGGCTGACTATGTGAGACCAAAACTTGAGACCTACAAAAATGCTGATGTTCTGGTTGCTG
AGTCTACTCCTCCAGGTAATGATGAACCCTACACTGAGCAGATGGGCAACTGTGGAGAGAAGGGTGAAAGGATCCACCTCACTCCTGATT
TCATTGCAGGAAAAAAGTTAGCTGAATATGGACCACAAGGTAGGGCATTTGTCCATGAGTGGGCTCATCTACGATGGGGAGTATTTGACG
AGTACAATAATGATGAGAAATTCTACTTATCCAATGGAAGAATACAAGCAGTAAGATGTTCAGCAGGTATTACTGGTACAAATGTAGTAA
AGAAGTGTCAGGGAGGCAGCTGTTACACCAAAAGATGCACATTCAATAAAGTAACAGGACTCTATGAAAAAGGATGTGAGTTTGTTCTCC
AATCCCGCCAGACGGAGAAGGCTTCTATAATGTTTGCACAACATGTTGATTCTATAGTTGAATTCTGTACAGAACAAAACCACAACAAAG
AAGCTCCAAACAAGCAAAATCAAAAATGCAATCTCCGAAGCACATGGGAAGTGATCCGTGATTCTGAGGACTTTAAGAAAACCACTCCTA
TGACAACACAGCCACCAAATCCCACCTTCTCATTGCTGCAGATTGGACAAAGAATTGTGTGTTTAGTCCTTGACAAATCTGGAAGCATGG
CGACTGGTAACCGCCTCAATCGACTGAATCAAGCAGGCCAGCTTTTCCTGCTGCAGACAGTTGAGCTGGGGTCCTGGGTTGGGATGGTGA
CATTTGACAGTGCTGCCCATGTACAAAATGAACTCATACAGATAAACAGTGGCAGTGACAGGGACACACTCGCCAAAAGATTACCTGCAG
CAGCTTCAGGAGGGACGTCCATCTGCAGCGGGCTTCGATCGGCATTTACTGTGATTAGGAAGAAATATCCAACTGATGGATCTGAAATTG
TGCTGCTGACGGATGGGGAAGACAACACTATAAGTGGGTGCTTTAACGAGGTCAAACAAAGTGGTGCCATCATCCACACAGTCGCTTTGG
GGCCCTCTGCAGCTCAAGAACTAGAGGAGCTGTCCAAAATGACAGGAGGTTTACAGACATATGCTTCAGATCAAGTTCAGAACAATGGCC
TCATTGATGCTTTTGGGGCCCTTTCATCAGGAAATGGAGCTGTCTCTCAGCGCTCCATCCAGCTTGAGAGTAAGGGATTAACCCTCCAGA
ACAGCCAGTGGATGAATGGCACAGTGATCGTGGACAGCACCGTGGGAAAGGACACTTTGTTTCTTATCACCTGGACAATGCAGCCTCCCC
AAATCCTTCTCTGGGATCCCAGTGGACAGAAGCAAGGTGGCTTTGTAGTGGACAAAAACACCAAAATGGCCTACCTCCAAATCCCAGGCA
TTGCTAAGGTTGGCACTTGGAAATACAGTCTGCAAGCAAGCTCACAAACCTTGACCCTGACTGTCACGTCCCGTGCGTCCAATGCTACCC
TGCCTCCAATTACAGTGACTTCCAAAACGAACAAGGACACCAGCAAATTCCCCAGCCCTCTGGTAGTTTATGCAAATATTCGCCAAGGAG
CCTCCCCAATTCTCAGGGCCAGTGTCACAGCCCTGATTGAATCAGTGAATGGAAAAACAGTTACCTTGGAACTACTGGATAATGGAGCAG
GTGCTGATGCTACTAAGGATGACGGTGTCTACTCAAGGTATTTCACAACTTATGACACGAATGGTAGATACAGTGTAAAAGTGCGGGCTC
TGGGAGGAGTTAACGCAGCCAGACGGAGAGTGATACCCCAGCAGAGTGGAGCACTGTACATACCTGGCTGGATTGAGAATGATGAAATAC
AATGGAATCCACCAAGACCTGAAATTAATAAGGATGATGTTCAACACAAGCAAGTGTGTTTCAGCAGAACATCCTCGGGAGGCTCATTTG
TGGCTTCTGATGTCCCAAATGCTCCCATACCTGATCTCTTCCCACCTGGCCAAATCACCGACCTGAAGGCGGAAATTCACGGGGGCAGTC
TCATTAATCTGACTTGGACAGCTCCTGGGGATGATTATGACCATGGAACAGCTCACAAGTATATCATTCGAATAAGTACAAGTATTCTTG
ATCTCAGAGACAAGTTCAATGAATCTCTTCAAGTGAATACTACTGCTCTCATCCCAAAGGAAGCCAACTCTGAGGAAGTCTTTTTGTTTA
AACCAGAAAACATTACTTTTGAAAATGGCACAGATCTTTTCATTGCTATTCAGGCTGTTGATAAGGTCGATCTGAAATCAGAAATATCCA
ACATTGCACGAGTATCTTTGTTTATTCCTCCACAGACTCCGCCAGAGACACCTAGTCCTGATGAAACGTCTGCTCCTTGTCCTAATATTC
ATATCAACAGCACCATTCCTGGCATTCACATTTTAAAAATTATGTGGAAGTGGATAGGAGAACTGCAGCTGTCAATAGCCTAGGGCTGAA
TTTTTGTCAGATAAATAAAATAAATCATTCATCCTTTTTTTTGATTATAAAATTTTCTAAAATGTATTTTAGACTTCCTGTAGGGGGCGA
TATACTAAATGTATATAGTACATTTATACTAAATGTATTCCTGTAGGGGGCGATATACTAAATGTATTTTAGACTTCCTGTAGGGGGCGA

>In-frame_SH3GLB1_ENST00000482504_chr1_87181548_+_CLCA1_ENST00000234701_chr1_86934704_+_3128nt
CTAGGATGAATATCATGGACTTCAACGTGAAGAAGCTGGCGGCCGACGCAGGCACCTTCCTCAGTCGCGCCGTGCAGTTCACAGAAGAAA
AGCTTGGCCAGGCTGAGAAGACAGAATTGGATGCTCACTTAGAGAACCTCCTTAGCAAAGCTGAATGTACCAAAATATGGACAGAAAAAA
TAATGAAACAAACTGAAGTGTTATTGCAGCCAAATCCAAAGGGGCCCTGAGTAATTCACTCATTCAGCTGAACAACAATGGCTATGAAGG
CATTGTCGTTGCAATCGACCCCAATGTGCCAGAAGATGAAACACTCATTCAACAAATAAAGGACATGGTGACCCAGGCATCTCTGTATCT
GCTTGAAGCTACAGGAAAGCGATTTTATTTCAAAAATGTTGCCATTTTGATTCCTGAAACATGGAAGACAAAGGCTGACTATGTGAGACC
AAAACTTGAGACCTACAAAAATGCTGATGTTCTGGTTGCTGAGTCTACTCCTCCAGGTAATGATGAACCCTACACTGAGCAGATGGGCAA
CTGTGGAGAGAAGGGTGAAAGGATCCACCTCACTCCTGATTTCATTGCAGGAAAAAAGTTAGCTGAATATGGACCACAAGGTAGGGCATT
TGTCCATGAGTGGGCTCATCTACGATGGGGAGTATTTGACGAGTACAATAATGATGAGAAATTCTACTTATCCAATGGAAGAATACAAGC
AGTAAGATGTTCAGCAGGTATTACTGGTACAAATGTAGTAAAGAAGTGTCAGGGAGGCAGCTGTTACACCAAAAGATGCACATTCAATAA
AGTAACAGGACTCTATGAAAAAGGATGTGAGTTTGTTCTCCAATCCCGCCAGACGGAGAAGGCTTCTATAATGTTTGCACAACATGTTGA
TTCTATAGTTGAATTCTGTACAGAACAAAACCACAACAAAGAAGCTCCAAACAAGCAAAATCAAAAATGCAATCTCCGAAGCACATGGGA
AGTGATCCGTGATTCTGAGGACTTTAAGAAAACCACTCCTATGACAACACAGCCACCAAATCCCACCTTCTCATTGCTGCAGATTGGACA
AAGAATTGTGTGTTTAGTCCTTGACAAATCTGGAAGCATGGCGACTGGTAACCGCCTCAATCGACTGAATCAAGCAGGCCAGCTTTTCCT
GCTGCAGACAGTTGAGCTGGGGTCCTGGGTTGGGATGGTGACATTTGACAGTGCTGCCCATGTACAAAATGAACTCATACAGATAAACAG
TGGCAGTGACAGGGACACACTCGCCAAAAGATTACCTGCAGCAGCTTCAGGAGGGACGTCCATCTGCAGCGGGCTTCGATCGGCATTTAC
TGTGATTAGGAAGAAATATCCAACTGATGGATCTGAAATTGTGCTGCTGACGGATGGGGAAGACAACACTATAAGTGGGTGCTTTAACGA
GGTCAAACAAAGTGGTGCCATCATCCACACAGTCGCTTTGGGGCCCTCTGCAGCTCAAGAACTAGAGGAGCTGTCCAAAATGACAGGAGG
TTTACAGACATATGCTTCAGATCAAGTTCAGAACAATGGCCTCATTGATGCTTTTGGGGCCCTTTCATCAGGAAATGGAGCTGTCTCTCA
GCGCTCCATCCAGCTTGAGAGTAAGGGATTAACCCTCCAGAACAGCCAGTGGATGAATGGCACAGTGATCGTGGACAGCACCGTGGGAAA
GGACACTTTGTTTCTTATCACCTGGACAATGCAGCCTCCCCAAATCCTTCTCTGGGATCCCAGTGGACAGAAGCAAGGTGGCTTTGTAGT
GGACAAAAACACCAAAATGGCCTACCTCCAAATCCCAGGCATTGCTAAGGTTGGCACTTGGAAATACAGTCTGCAAGCAAGCTCACAAAC
CTTGACCCTGACTGTCACGTCCCGTGCGTCCAATGCTACCCTGCCTCCAATTACAGTGACTTCCAAAACGAACAAGGACACCAGCAAATT
CCCCAGCCCTCTGGTAGTTTATGCAAATATTCGCCAAGGAGCCTCCCCAATTCTCAGGGCCAGTGTCACAGCCCTGATTGAATCAGTGAA
TGGAAAAACAGTTACCTTGGAACTACTGGATAATGGAGCAGGTGCTGATGCTACTAAGGATGACGGTGTCTACTCAAGGTATTTCACAAC
TTATGACACGAATGGTAGATACAGTGTAAAAGTGCGGGCTCTGGGAGGAGTTAACGCAGCCAGACGGAGAGTGATACCCCAGCAGAGTGG
AGCACTGTACATACCTGGCTGGATTGAGAATGATGAAATACAATGGAATCCACCAAGACCTGAAATTAATAAGGATGATGTTCAACACAA
GCAAGTGTGTTTCAGCAGAACATCCTCGGGAGGCTCATTTGTGGCTTCTGATGTCCCAAATGCTCCCATACCTGATCTCTTCCCACCTGG
CCAAATCACCGACCTGAAGGCGGAAATTCACGGGGGCAGTCTCATTAATCTGACTTGGACAGCTCCTGGGGATGATTATGACCATGGAAC
AGCTCACAAGTATATCATTCGAATAAGTACAAGTATTCTTGATCTCAGAGACAAGTTCAATGAATCTCTTCAAGTGAATACTACTGCTCT
CATCCCAAAGGAAGCCAACTCTGAGGAAGTCTTTTTGTTTAAACCAGAAAACATTACTTTTGAAAATGGCACAGATCTTTTCATTGCTAT
TCAGGCTGTTGATAAGGTCGATCTGAAATCAGAAATATCCAACATTGCACGAGTATCTTTGTTTATTCCTCCACAGACTCCGCCAGAGAC
ACCTAGTCCTGATGAAACGTCTGCTCCTTGTCCTAATATTCATATCAACAGCACCATTCCTGGCATTCACATTTTAAAAATTATGTGGAA
GTGGATAGGAGAACTGCAGCTGTCAATAGCCTAGGGCTGAATTTTTGTCAGATAAATAAAATAAATCATTCATCCTTTTTTTTGATTATA
AAATTTTCTAAAATGTATTTTAGACTTCCTGTAGGGGGCGATATACTAAATGTATATAGTACATTTATACTAAATGTATTCCTGTAGGGG


Top

FusionGenePPI for SH3GLB1_CLCA1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SH3GLB1SH3KBP1, BAX, SH3GLB2, ARHGAP17, USP7, CUL2, KLHDC10, ITCH, ADAM15, APP, GADD45A, GADD45G, AARSD1, ARPC1A, ARPC4, CALR, KIAA1279, NSUN2, PRKACA, RANGAP1, ACTR2, ACTR3, AGFG1, ARPC2, CALU, HSPBP1, LAP3, P3H1, LPP, NIF3L1, PPP2R5D, RPA2, SH3GL1, THG1L, TPD52L2, TPRKB, PSMA1, TFIP11, SH3GLB1, ZNF576, CMTM5, FUNDC1, SERPINB3, CCDC22, COMMD3, DSCR3, FLAD1, RPRD1A, UBE2I, USP14, WARS, XPO7, CEP128, CDK2AP1, HTATIP2, RAB5A, ACSL4, CDH1, FCGRT, SERPINB13, SCYL2, CDK5, PRCC, SEPT7, DIS3, CHORDC1, SUB1, SARNP, COPZ1, GORASP2, SEPT11, DRG1CLCA1KCNMB1, CFTR


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SH3GLB1_CLCA1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SH3GLB1_CLCA1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource