FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33653

FusionGeneSummary for SH3GL1_MLLT1

check button Fusion gene summary
Fusion gene informationFusion gene name: SH3GL1_MLLT1
Fusion gene ID: 33653
HgeneTgene
Gene symbol

SH3GL1

MLLT1

Gene ID

6455

4298

Gene nameSH3 domain containing GRB2 like 1, endophilin A2MLLT1, super elongation complex subunit
SynonymsCNSA1|EEN|SH3D2B|SH3P8ENL|LTG19|YEATS1
Cytomap

19p13.3

19p13.3

Type of geneprotein-codingprotein-coding
Descriptionendophilin-A2EEN fusion partner of MLLSH3 domain protein 2BSH3 domain-containing GRB2-like protein 1SH3-containing Grb-2-like 1 proteinSH3-domain GRB2-like 1endophilin-2extra 11-19 leukemia fusionextra eleven-nineteen leukemia fusion gene proteinprotein ENLCTC-503J8.6ENL/MLL fusionMLL/ENL fusion proteinMLLT1/MLL fusionYEATS domain-containing protein 1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocated to, 1myeloid/lymphoid or mixed-lineage leukemia (trithorax homol
Modification date2018052220180519
UniProtAcc

Q99961

Q03111

Ensembl transtripts involved in fusion geneENST00000269886, ENST00000598564, 
ENST00000417295, 
ENST00000252674, 
ENST00000585588, 
Fusion gene scores* DoF score12 X 5 X 10=60010 X 20 X 6=1200
# samples 1225
** MAII scorelog2(12/600*10)=-2.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(25/1200*10)=-2.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SH3GL1 [Title/Abstract] AND MLLT1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-95-7039-01ASH3GL1chr19

4400321

-MLLT1chr19

6270770

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000269886ENST00000252674SH3GL1chr19

4400321

-MLLT1chr19

6270770

-
5CDS-intronENST00000269886ENST00000585588SH3GL1chr19

4400321

-MLLT1chr19

6270770

-
In-frameENST00000598564ENST00000252674SH3GL1chr19

4400321

-MLLT1chr19

6270770

-
5CDS-intronENST00000598564ENST00000585588SH3GL1chr19

4400321

-MLLT1chr19

6270770

-
In-frameENST00000417295ENST00000252674SH3GL1chr19

4400321

-MLLT1chr19

6270770

-
5CDS-intronENST00000417295ENST00000585588SH3GL1chr19

4400321

-MLLT1chr19

6270770

-

Top

FusionProtFeatures for SH3GL1_MLLT1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SH3GL1

Q99961

MLLT1

Q03111

Implicated in endocytosis. May recruit other proteins tomembranes with high curvature (By similarity). {ECO:0000250}. Component of the super elongation complex (SEC), acomplex required to increase the catalytic rate of RNA polymeraseII transcription by suppressing transient pausing by thepolymerase at multiple sites along the DNA.{ECO:0000269|PubMed:20159561, ECO:0000269|PubMed:20471948}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMLLT1chr19:4400321chr19:6270770ENST00000252674-012272_2804560Compositional biasNote=Poly-Pro
TgeneMLLT1chr19:4400321chr19:6270770ENST00000252674-012319_3254560Compositional biasNote=Poly-Ser
TgeneMLLT1chr19:4400321chr19:6270770ENST00000252674-012374_3894560Compositional biasNote=Poly-Ser
TgeneMLLT1chr19:4400321chr19:6270770ENST00000252674-012457_4604560Compositional biasNote=Poly-Pro
TgeneMLLT1chr19:4400321chr19:6270770ENST00000252674-012463_4664560Compositional biasNote=Poly-Pro
TgeneMLLT1chr19:4400321chr19:6270770ENST00000252674-0128_1124560DomainYEATS

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000269886-110145_25015369Coiled coilOntology_term=ECO:0000255
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000417295-19145_25015321Coiled coilOntology_term=ECO:0000255
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000598564-110145_25015305Coiled coilOntology_term=ECO:0000255
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000269886-11018_24915369DomainBAR
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000269886-110306_36515369DomainSH3
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000417295-1918_24915321DomainBAR
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000417295-19306_36515321DomainSH3
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000598564-11018_24915305DomainBAR
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000598564-110306_36515305DomainSH3
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000269886-1101_2115369RegionMembrane-binding amphipathic helix
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000269886-11060_8715369RegionRequired for dimerization upon membrane association
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000417295-191_2115321RegionMembrane-binding amphipathic helix
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000417295-1960_8715321RegionRequired for dimerization upon membrane association
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000598564-1101_2115305RegionMembrane-binding amphipathic helix
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000598564-11060_8715305RegionRequired for dimerization upon membrane association


Top

FusionGeneSequence for SH3GL1_MLLT1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SH3GL1_ENST00000269886_chr19_4400321_-_MLLT1_ENST00000252674_chr19_6270770_-_571aa
MSVAGLKKQFYKASQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYA
GFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGADTVSRPSPDYPMLPTIPLSAF
SDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALK
ETKLESTSPKGGPPPPPPPPPRASSKRPATADSPKPSAKKQKKSSSKGSRSAPGTSPRTSSSSSFSDKKPAKDKSSTRGEKVKAESEPRE
AKKALEVEESNSEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQGPLRSMVEDLQSEESDEDDSSSGEEAAGKTNPGRDSRLSF
SDSESDNSADSSLPSREPPPPQKPPPPNSKVSGRRSPESCSKPEKILKKGTYDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFN

>In-frame_SH3GL1_ENST00000598564_chr19_4400321_-_MLLT1_ENST00000252674_chr19_6270770_-_571aa
MSVAGLKKQFYKASQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYA
GFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGADTVSRPSPDYPMLPTIPLSAF
SDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALK
ETKLESTSPKGGPPPPPPPPPRASSKRPATADSPKPSAKKQKKSSSKGSRSAPGTSPRTSSSSSFSDKKPAKDKSSTRGEKVKAESEPRE
AKKALEVEESNSEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQGPLRSMVEDLQSEESDEDDSSSGEEAAGKTNPGRDSRLSF
SDSESDNSADSSLPSREPPPPQKPPPPNSKVSGRRSPESCSKPEKILKKGTYDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFN

>In-frame_SH3GL1_ENST00000417295_chr19_4400321_-_MLLT1_ENST00000252674_chr19_6270770_-_571aa
MSVAGLKKQFYKASQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYA
GFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGADTVSRPSPDYPMLPTIPLSAF
SDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALK
ETKLESTSPKGGPPPPPPPPPRASSKRPATADSPKPSAKKQKKSSSKGSRSAPGTSPRTSSSSSFSDKKPAKDKSSTRGEKVKAESEPRE
AKKALEVEESNSEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQGPLRSMVEDLQSEESDEDDSSSGEEAAGKTNPGRDSRLSF
SDSESDNSADSSLPSREPPPPQKPPPPNSKVSGRRSPESCSKPEKILKKGTYDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SH3GL1_ENST00000269886_chr19_4400321_-_MLLT1_ENST00000252674_chr19_6270770_-_1713nt
ATGTCGGTGGCGGGGCTGAAGAAGCAGTTCTACAAGGCGAGCCAGTGCACCGTCCAGGTGAGGTTAGAGCTGGGGCATCGCGCCCAACTG
CGCAAGAAGCCCACCACGGAGGGGTTCACTCACGACTGGATGGTGTTTGTCCGCGGCCCCGAGCAATGTGACATCCAGCACTTCGTGGAG
AAGGTGGTCTTCTGGCTGCACGACAGCTTCCCCAAGCCCAGACGCGTGTGCAAGGAGCCCCCCTACAAAGTAGAGGAGTCGGGGTACGCT
GGCTTCATCATGCCCATCGAGGTGCACTTCAAAAACAAGGAGGAGCCGAGGAAGGTCTGCTTCACCTACGACCTGTTCCTGAACCTGGAA
GGCAACCCGCCCGTGAACCACCTGCGCTGCGAGAAGCTCACCTTCAACAACCCCACCACGGAGTTCCGGTACAAGCTCCTGCGGGCCGGC
GGGGTGATGGTAATGCCCGAAGGAGCAGACACGGTGTCCAGGCCCAGTCCCGACTACCCCATGTTACCCACAATTCCACTCTCTGCCTTC
TCTGACCCCAAGAAGACCAAACCATCCCACGGCTCCAAGGACGCCAACAAGGAGAGCAGCAAGACCTCCAAGCCACACAAGGTGACCAAG
GAGCACCGGGAGCGGCCCCGCAAAGACTCCGAGAGCAAGAGCTCCTCCAAGGAGCTGGAGCGTGAGCAGGCCAAAAGCTCCAAGGACACC
TCGCGGAAGCTGGGCGAGGGCCGGCTGCCCAAGGAGGAGAAGGCGCCACCGCCCAAGGCTGCCTTCAAGGAACCCAAGATGGCCCTGAAA
GAGACCAAGCTGGAAAGCACGTCCCCCAAGGGTGGGCCCCCACCCCCACCCCCACCCCCACCCCGGGCTTCCAGCAAGCGGCCGGCCACC
GCCGACTCGCCAAAGCCCAGCGCCAAGAAGCAGAAGAAGAGCAGCTCGAAGGGGTCCCGGAGTGCTCCAGGCACCTCGCCCCGCACCTCC
TCCTCCTCCTCCTTCTCGGACAAGAAGCCGGCCAAGGACAAGAGCAGCACCAGAGGGGAGAAGGTGAAGGCCGAGAGTGAGCCCCGGGAG
GCCAAAAAGGCCCTGGAGGTGGAGGAGTCCAACTCAGAGGACGAGGCCTCCTTCAAGTCCGAGTCTGCCCAGTCAAGCCCGTCCAACTCC
AGCTCCAGCTCAGACTCCAGCTCAGACTCAGACTTCGAGCCATCCCAGAACCACAGCCAAGGACCCCTGCGCTCCATGGTGGAGGACCTG
CAGTCCGAGGAGTCCGACGAGGACGACTCTTCGTCAGGCGAGGAGGCTGCCGGCAAGACCAACCCGGGGAGGGACTCCAGGTTGAGCTTC
AGCGACAGCGAGAGTGACAACAGCGCCGACTCCTCCCTGCCCAGCCGTGAGCCCCCACCCCCCCAGAAGCCACCCCCGCCCAACAGCAAG
GTGTCAGGCCGGAGGAGCCCCGAGTCCTGCAGCAAGCCTGAGAAGATCCTCAAGAAGGGCACCTACGACAAGGCCTACACGGATGAGCTG
GTGGAGCTACACCGGAGGCTGATGGCGCTGCGGGAGCGCAACGTGCTGCAGCAGATTGTGAATCTGATCGAGGAGACTGGCCACTTCAAT
GTCACCAACACCACCTTCGACTTCGACCTCTTCTCCCTGGACGAGACCACCGTGCGCAAACTGCAGAGCTGCCTGGAGGCCGTGGCCACA

>In-frame_SH3GL1_ENST00000598564_chr19_4400321_-_MLLT1_ENST00000252674_chr19_6270770_-_1713nt
ATGTCGGTGGCGGGGCTGAAGAAGCAGTTCTACAAGGCGAGCCAGTGCACCGTCCAGGTGAGGTTAGAGCTGGGGCATCGCGCCCAACTG
CGCAAGAAGCCCACCACGGAGGGGTTCACTCACGACTGGATGGTGTTTGTCCGCGGCCCCGAGCAATGTGACATCCAGCACTTCGTGGAG
AAGGTGGTCTTCTGGCTGCACGACAGCTTCCCCAAGCCCAGACGCGTGTGCAAGGAGCCCCCCTACAAAGTAGAGGAGTCGGGGTACGCT
GGCTTCATCATGCCCATCGAGGTGCACTTCAAAAACAAGGAGGAGCCGAGGAAGGTCTGCTTCACCTACGACCTGTTCCTGAACCTGGAA
GGCAACCCGCCCGTGAACCACCTGCGCTGCGAGAAGCTCACCTTCAACAACCCCACCACGGAGTTCCGGTACAAGCTCCTGCGGGCCGGC
GGGGTGATGGTAATGCCCGAAGGAGCAGACACGGTGTCCAGGCCCAGTCCCGACTACCCCATGTTACCCACAATTCCACTCTCTGCCTTC
TCTGACCCCAAGAAGACCAAACCATCCCACGGCTCCAAGGACGCCAACAAGGAGAGCAGCAAGACCTCCAAGCCACACAAGGTGACCAAG
GAGCACCGGGAGCGGCCCCGCAAAGACTCCGAGAGCAAGAGCTCCTCCAAGGAGCTGGAGCGTGAGCAGGCCAAAAGCTCCAAGGACACC
TCGCGGAAGCTGGGCGAGGGCCGGCTGCCCAAGGAGGAGAAGGCGCCACCGCCCAAGGCTGCCTTCAAGGAACCCAAGATGGCCCTGAAA
GAGACCAAGCTGGAAAGCACGTCCCCCAAGGGTGGGCCCCCACCCCCACCCCCACCCCCACCCCGGGCTTCCAGCAAGCGGCCGGCCACC
GCCGACTCGCCAAAGCCCAGCGCCAAGAAGCAGAAGAAGAGCAGCTCGAAGGGGTCCCGGAGTGCTCCAGGCACCTCGCCCCGCACCTCC
TCCTCCTCCTCCTTCTCGGACAAGAAGCCGGCCAAGGACAAGAGCAGCACCAGAGGGGAGAAGGTGAAGGCCGAGAGTGAGCCCCGGGAG
GCCAAAAAGGCCCTGGAGGTGGAGGAGTCCAACTCAGAGGACGAGGCCTCCTTCAAGTCCGAGTCTGCCCAGTCAAGCCCGTCCAACTCC
AGCTCCAGCTCAGACTCCAGCTCAGACTCAGACTTCGAGCCATCCCAGAACCACAGCCAAGGACCCCTGCGCTCCATGGTGGAGGACCTG
CAGTCCGAGGAGTCCGACGAGGACGACTCTTCGTCAGGCGAGGAGGCTGCCGGCAAGACCAACCCGGGGAGGGACTCCAGGTTGAGCTTC
AGCGACAGCGAGAGTGACAACAGCGCCGACTCCTCCCTGCCCAGCCGTGAGCCCCCACCCCCCCAGAAGCCACCCCCGCCCAACAGCAAG
GTGTCAGGCCGGAGGAGCCCCGAGTCCTGCAGCAAGCCTGAGAAGATCCTCAAGAAGGGCACCTACGACAAGGCCTACACGGATGAGCTG
GTGGAGCTACACCGGAGGCTGATGGCGCTGCGGGAGCGCAACGTGCTGCAGCAGATTGTGAATCTGATCGAGGAGACTGGCCACTTCAAT
GTCACCAACACCACCTTCGACTTCGACCTCTTCTCCCTGGACGAGACCACCGTGCGCAAACTGCAGAGCTGCCTGGAGGCCGTGGCCACA

>In-frame_SH3GL1_ENST00000417295_chr19_4400321_-_MLLT1_ENST00000252674_chr19_6270770_-_1713nt
ATGTCGGTGGCGGGGCTGAAGAAGCAGTTCTACAAGGCGAGCCAGTGCACCGTCCAGGTGAGGTTAGAGCTGGGGCATCGCGCCCAACTG
CGCAAGAAGCCCACCACGGAGGGGTTCACTCACGACTGGATGGTGTTTGTCCGCGGCCCCGAGCAATGTGACATCCAGCACTTCGTGGAG
AAGGTGGTCTTCTGGCTGCACGACAGCTTCCCCAAGCCCAGACGCGTGTGCAAGGAGCCCCCCTACAAAGTAGAGGAGTCGGGGTACGCT
GGCTTCATCATGCCCATCGAGGTGCACTTCAAAAACAAGGAGGAGCCGAGGAAGGTCTGCTTCACCTACGACCTGTTCCTGAACCTGGAA
GGCAACCCGCCCGTGAACCACCTGCGCTGCGAGAAGCTCACCTTCAACAACCCCACCACGGAGTTCCGGTACAAGCTCCTGCGGGCCGGC
GGGGTGATGGTAATGCCCGAAGGAGCAGACACGGTGTCCAGGCCCAGTCCCGACTACCCCATGTTACCCACAATTCCACTCTCTGCCTTC
TCTGACCCCAAGAAGACCAAACCATCCCACGGCTCCAAGGACGCCAACAAGGAGAGCAGCAAGACCTCCAAGCCACACAAGGTGACCAAG
GAGCACCGGGAGCGGCCCCGCAAAGACTCCGAGAGCAAGAGCTCCTCCAAGGAGCTGGAGCGTGAGCAGGCCAAAAGCTCCAAGGACACC
TCGCGGAAGCTGGGCGAGGGCCGGCTGCCCAAGGAGGAGAAGGCGCCACCGCCCAAGGCTGCCTTCAAGGAACCCAAGATGGCCCTGAAA
GAGACCAAGCTGGAAAGCACGTCCCCCAAGGGTGGGCCCCCACCCCCACCCCCACCCCCACCCCGGGCTTCCAGCAAGCGGCCGGCCACC
GCCGACTCGCCAAAGCCCAGCGCCAAGAAGCAGAAGAAGAGCAGCTCGAAGGGGTCCCGGAGTGCTCCAGGCACCTCGCCCCGCACCTCC
TCCTCCTCCTCCTTCTCGGACAAGAAGCCGGCCAAGGACAAGAGCAGCACCAGAGGGGAGAAGGTGAAGGCCGAGAGTGAGCCCCGGGAG
GCCAAAAAGGCCCTGGAGGTGGAGGAGTCCAACTCAGAGGACGAGGCCTCCTTCAAGTCCGAGTCTGCCCAGTCAAGCCCGTCCAACTCC
AGCTCCAGCTCAGACTCCAGCTCAGACTCAGACTTCGAGCCATCCCAGAACCACAGCCAAGGACCCCTGCGCTCCATGGTGGAGGACCTG
CAGTCCGAGGAGTCCGACGAGGACGACTCTTCGTCAGGCGAGGAGGCTGCCGGCAAGACCAACCCGGGGAGGGACTCCAGGTTGAGCTTC
AGCGACAGCGAGAGTGACAACAGCGCCGACTCCTCCCTGCCCAGCCGTGAGCCCCCACCCCCCCAGAAGCCACCCCCGCCCAACAGCAAG
GTGTCAGGCCGGAGGAGCCCCGAGTCCTGCAGCAAGCCTGAGAAGATCCTCAAGAAGGGCACCTACGACAAGGCCTACACGGATGAGCTG
GTGGAGCTACACCGGAGGCTGATGGCGCTGCGGGAGCGCAACGTGCTGCAGCAGATTGTGAATCTGATCGAGGAGACTGGCCACTTCAAT
GTCACCAACACCACCTTCGACTTCGACCTCTTCTCCCTGGACGAGACCACCGTGCGCAAACTGCAGAGCTGCCTGGAGGCCGTGGCCACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_SH3GL1_ENST00000269886_chr19_4400321_-_MLLT1_ENST00000252674_chr19_6270770_-_1979nt
AATATCCTGGCCGCGCGGGCGCGCGAGCGGCTGAGGCGGCGCCGGGGCGGGCGCGGAGCTGGCAAGCGGGTGGCGGAGGCGGCGCCGACG
GGGACTGCTGAGGCGCGCAGAGGGTCGGCGGCGCCCGGGAGCCTGTCGCTGGCGCGGTCCGGGCGGGAGGCTCGGCGGCGGGCGGCAGCA
TGTCGGTGGCGGGGCTGAAGAAGCAGTTCTACAAGGCGAGCCAGTGCACCGTCCAGGTGAGGTTAGAGCTGGGGCATCGCGCCCAACTGC
GCAAGAAGCCCACCACGGAGGGGTTCACTCACGACTGGATGGTGTTTGTCCGCGGCCCCGAGCAATGTGACATCCAGCACTTCGTGGAGA
AGGTGGTCTTCTGGCTGCACGACAGCTTCCCCAAGCCCAGACGCGTGTGCAAGGAGCCCCCCTACAAAGTAGAGGAGTCGGGGTACGCTG
GCTTCATCATGCCCATCGAGGTGCACTTCAAAAACAAGGAGGAGCCGAGGAAGGTCTGCTTCACCTACGACCTGTTCCTGAACCTGGAAG
GCAACCCGCCCGTGAACCACCTGCGCTGCGAGAAGCTCACCTTCAACAACCCCACCACGGAGTTCCGGTACAAGCTCCTGCGGGCCGGCG
GGGTGATGGTAATGCCCGAAGGAGCAGACACGGTGTCCAGGCCCAGTCCCGACTACCCCATGTTACCCACAATTCCACTCTCTGCCTTCT
CTGACCCCAAGAAGACCAAACCATCCCACGGCTCCAAGGACGCCAACAAGGAGAGCAGCAAGACCTCCAAGCCACACAAGGTGACCAAGG
AGCACCGGGAGCGGCCCCGCAAAGACTCCGAGAGCAAGAGCTCCTCCAAGGAGCTGGAGCGTGAGCAGGCCAAAAGCTCCAAGGACACCT
CGCGGAAGCTGGGCGAGGGCCGGCTGCCCAAGGAGGAGAAGGCGCCACCGCCCAAGGCTGCCTTCAAGGAACCCAAGATGGCCCTGAAAG
AGACCAAGCTGGAAAGCACGTCCCCCAAGGGTGGGCCCCCACCCCCACCCCCACCCCCACCCCGGGCTTCCAGCAAGCGGCCGGCCACCG
CCGACTCGCCAAAGCCCAGCGCCAAGAAGCAGAAGAAGAGCAGCTCGAAGGGGTCCCGGAGTGCTCCAGGCACCTCGCCCCGCACCTCCT
CCTCCTCCTCCTTCTCGGACAAGAAGCCGGCCAAGGACAAGAGCAGCACCAGAGGGGAGAAGGTGAAGGCCGAGAGTGAGCCCCGGGAGG
CCAAAAAGGCCCTGGAGGTGGAGGAGTCCAACTCAGAGGACGAGGCCTCCTTCAAGTCCGAGTCTGCCCAGTCAAGCCCGTCCAACTCCA
GCTCCAGCTCAGACTCCAGCTCAGACTCAGACTTCGAGCCATCCCAGAACCACAGCCAAGGACCCCTGCGCTCCATGGTGGAGGACCTGC
AGTCCGAGGAGTCCGACGAGGACGACTCTTCGTCAGGCGAGGAGGCTGCCGGCAAGACCAACCCGGGGAGGGACTCCAGGTTGAGCTTCA
GCGACAGCGAGAGTGACAACAGCGCCGACTCCTCCCTGCCCAGCCGTGAGCCCCCACCCCCCCAGAAGCCACCCCCGCCCAACAGCAAGG
TGTCAGGCCGGAGGAGCCCCGAGTCCTGCAGCAAGCCTGAGAAGATCCTCAAGAAGGGCACCTACGACAAGGCCTACACGGATGAGCTGG
TGGAGCTACACCGGAGGCTGATGGCGCTGCGGGAGCGCAACGTGCTGCAGCAGATTGTGAATCTGATCGAGGAGACTGGCCACTTCAATG
TCACCAACACCACCTTCGACTTCGACCTCTTCTCCCTGGACGAGACCACCGTGCGCAAACTGCAGAGCTGCCTGGAGGCCGTGGCCACAT

>In-frame_SH3GL1_ENST00000598564_chr19_4400321_-_MLLT1_ENST00000252674_chr19_6270770_-_1850nt
AGCCTGTCGCTGGCGCGGTCCGGGCGGGAGGCTCGGCGGCGGGCGGCAGCATGTCGGTGGCGGGGCTGAAGAAGCAGTTCTACAAGGCGA
GCCAGTGCACCGTCCAGGTGAGGTTAGAGCTGGGGCATCGCGCCCAACTGCGCAAGAAGCCCACCACGGAGGGGTTCACTCACGACTGGA
TGGTGTTTGTCCGCGGCCCCGAGCAATGTGACATCCAGCACTTCGTGGAGAAGGTGGTCTTCTGGCTGCACGACAGCTTCCCCAAGCCCA
GACGCGTGTGCAAGGAGCCCCCCTACAAAGTAGAGGAGTCGGGGTACGCTGGCTTCATCATGCCCATCGAGGTGCACTTCAAAAACAAGG
AGGAGCCGAGGAAGGTCTGCTTCACCTACGACCTGTTCCTGAACCTGGAAGGCAACCCGCCCGTGAACCACCTGCGCTGCGAGAAGCTCA
CCTTCAACAACCCCACCACGGAGTTCCGGTACAAGCTCCTGCGGGCCGGCGGGGTGATGGTAATGCCCGAAGGAGCAGACACGGTGTCCA
GGCCCAGTCCCGACTACCCCATGTTACCCACAATTCCACTCTCTGCCTTCTCTGACCCCAAGAAGACCAAACCATCCCACGGCTCCAAGG
ACGCCAACAAGGAGAGCAGCAAGACCTCCAAGCCACACAAGGTGACCAAGGAGCACCGGGAGCGGCCCCGCAAAGACTCCGAGAGCAAGA
GCTCCTCCAAGGAGCTGGAGCGTGAGCAGGCCAAAAGCTCCAAGGACACCTCGCGGAAGCTGGGCGAGGGCCGGCTGCCCAAGGAGGAGA
AGGCGCCACCGCCCAAGGCTGCCTTCAAGGAACCCAAGATGGCCCTGAAAGAGACCAAGCTGGAAAGCACGTCCCCCAAGGGTGGGCCCC
CACCCCCACCCCCACCCCCACCCCGGGCTTCCAGCAAGCGGCCGGCCACCGCCGACTCGCCAAAGCCCAGCGCCAAGAAGCAGAAGAAGA
GCAGCTCGAAGGGGTCCCGGAGTGCTCCAGGCACCTCGCCCCGCACCTCCTCCTCCTCCTCCTTCTCGGACAAGAAGCCGGCCAAGGACA
AGAGCAGCACCAGAGGGGAGAAGGTGAAGGCCGAGAGTGAGCCCCGGGAGGCCAAAAAGGCCCTGGAGGTGGAGGAGTCCAACTCAGAGG
ACGAGGCCTCCTTCAAGTCCGAGTCTGCCCAGTCAAGCCCGTCCAACTCCAGCTCCAGCTCAGACTCCAGCTCAGACTCAGACTTCGAGC
CATCCCAGAACCACAGCCAAGGACCCCTGCGCTCCATGGTGGAGGACCTGCAGTCCGAGGAGTCCGACGAGGACGACTCTTCGTCAGGCG
AGGAGGCTGCCGGCAAGACCAACCCGGGGAGGGACTCCAGGTTGAGCTTCAGCGACAGCGAGAGTGACAACAGCGCCGACTCCTCCCTGC
CCAGCCGTGAGCCCCCACCCCCCCAGAAGCCACCCCCGCCCAACAGCAAGGTGTCAGGCCGGAGGAGCCCCGAGTCCTGCAGCAAGCCTG
AGAAGATCCTCAAGAAGGGCACCTACGACAAGGCCTACACGGATGAGCTGGTGGAGCTACACCGGAGGCTGATGGCGCTGCGGGAGCGCA
ACGTGCTGCAGCAGATTGTGAATCTGATCGAGGAGACTGGCCACTTCAATGTCACCAACACCACCTTCGACTTCGACCTCTTCTCCCTGG
ACGAGACCACCGTGCGCAAACTGCAGAGCTGCCTGGAGGCCGTGGCCACATGACCCTGGGCCGCGTGCCGGGCCCCCACCGCCGGGGTCC

>In-frame_SH3GL1_ENST00000417295_chr19_4400321_-_MLLT1_ENST00000252674_chr19_6270770_-_1957nt
GCGAGCGGCTGAGGCGGCGCCGGGGCGGGCGCGGAGCTGGCAAGCGGGTGGCGGAGGCGGCGCCGACGGGGACTGCTGAGGCGCGCAGAG
GGTCGGCGGCGCCCGGGAGCCTGTCGCTGGCGCGGTCCGGGCGGGAGGCTCGGCGGCGGGCGGCAGCATGTCGGTGGCGGGGCTGAAGAA
GCAGTTCTACAAGGCGAGCCAGTGCACCGTCCAGGTGAGGTTAGAGCTGGGGCATCGCGCCCAACTGCGCAAGAAGCCCACCACGGAGGG
GTTCACTCACGACTGGATGGTGTTTGTCCGCGGCCCCGAGCAATGTGACATCCAGCACTTCGTGGAGAAGGTGGTCTTCTGGCTGCACGA
CAGCTTCCCCAAGCCCAGACGCGTGTGCAAGGAGCCCCCCTACAAAGTAGAGGAGTCGGGGTACGCTGGCTTCATCATGCCCATCGAGGT
GCACTTCAAAAACAAGGAGGAGCCGAGGAAGGTCTGCTTCACCTACGACCTGTTCCTGAACCTGGAAGGCAACCCGCCCGTGAACCACCT
GCGCTGCGAGAAGCTCACCTTCAACAACCCCACCACGGAGTTCCGGTACAAGCTCCTGCGGGCCGGCGGGGTGATGGTAATGCCCGAAGG
AGCAGACACGGTGTCCAGGCCCAGTCCCGACTACCCCATGTTACCCACAATTCCACTCTCTGCCTTCTCTGACCCCAAGAAGACCAAACC
ATCCCACGGCTCCAAGGACGCCAACAAGGAGAGCAGCAAGACCTCCAAGCCACACAAGGTGACCAAGGAGCACCGGGAGCGGCCCCGCAA
AGACTCCGAGAGCAAGAGCTCCTCCAAGGAGCTGGAGCGTGAGCAGGCCAAAAGCTCCAAGGACACCTCGCGGAAGCTGGGCGAGGGCCG
GCTGCCCAAGGAGGAGAAGGCGCCACCGCCCAAGGCTGCCTTCAAGGAACCCAAGATGGCCCTGAAAGAGACCAAGCTGGAAAGCACGTC
CCCCAAGGGTGGGCCCCCACCCCCACCCCCACCCCCACCCCGGGCTTCCAGCAAGCGGCCGGCCACCGCCGACTCGCCAAAGCCCAGCGC
CAAGAAGCAGAAGAAGAGCAGCTCGAAGGGGTCCCGGAGTGCTCCAGGCACCTCGCCCCGCACCTCCTCCTCCTCCTCCTTCTCGGACAA
GAAGCCGGCCAAGGACAAGAGCAGCACCAGAGGGGAGAAGGTGAAGGCCGAGAGTGAGCCCCGGGAGGCCAAAAAGGCCCTGGAGGTGGA
GGAGTCCAACTCAGAGGACGAGGCCTCCTTCAAGTCCGAGTCTGCCCAGTCAAGCCCGTCCAACTCCAGCTCCAGCTCAGACTCCAGCTC
AGACTCAGACTTCGAGCCATCCCAGAACCACAGCCAAGGACCCCTGCGCTCCATGGTGGAGGACCTGCAGTCCGAGGAGTCCGACGAGGA
CGACTCTTCGTCAGGCGAGGAGGCTGCCGGCAAGACCAACCCGGGGAGGGACTCCAGGTTGAGCTTCAGCGACAGCGAGAGTGACAACAG
CGCCGACTCCTCCCTGCCCAGCCGTGAGCCCCCACCCCCCCAGAAGCCACCCCCGCCCAACAGCAAGGTGTCAGGCCGGAGGAGCCCCGA
GTCCTGCAGCAAGCCTGAGAAGATCCTCAAGAAGGGCACCTACGACAAGGCCTACACGGATGAGCTGGTGGAGCTACACCGGAGGCTGAT
GGCGCTGCGGGAGCGCAACGTGCTGCAGCAGATTGTGAATCTGATCGAGGAGACTGGCCACTTCAATGTCACCAACACCACCTTCGACTT
CGACCTCTTCTCCCTGGACGAGACCACCGTGCGCAAACTGCAGAGCTGCCTGGAGGCCGTGGCCACATGACCCTGGGCCGCGTGCCGGGC


Top

FusionGenePPI for SH3GL1_MLLT1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SH3GL1SH3GL1, SH2D4A, DPPA4, SH3GL3, DNM1, CREBBP, PRMT1, KHDRBS1, YWHAZ, DPYSL4, SEPT8, SH3GL2, PTPRO, VIM, ITSN2, PDCD6IP, SYNJ1, LRRK2, PML, B3GAT1, AARSD1, ACTR3, ARPC2, FUBP1, RPA1, ACTR2, ANP32B, ARPC1A, ARPC4, ARPC5, ARPC5L, BAG1, CALR, CALU, CRTAP, GTF2E1, GTF2F2, KIAA1279, LAP3, NIF3L1, NSUN2, PFDN1, PFDN5, PRKACA, TRMT10A, SH3GLB2, THG1L, TP53RK, TPRKB, TTC1, SH3GLB1, DNM1L, MTA1, GPKOW, VPS37C, MAL2, FAM102A, AZU1, CCDC101, ARHGAP8, AURKA, EWSR1, NF2, POU5F1, CALM1, CDH1, TPTE2, C8G, GPX7, IMPDH1, FBXO32MLLT1CBX8, AFF1, CDK9, WDR5, DOT1L, MLLT3, RFX5, AFF4, CSNK2A1, BCOR, RFXAP, MLLT10, ACACA, CHD1, ELL, SIRT1, MLLT6, CCNT1, KMT2A, BRD4, ELL2, PAF1, POLR2A, MED26, HIST3H3, HIST1H1B, EAF1, ELL3, RNF2, RPL12, MRPL12, HIST2H2AC, H2AFX, HIST2H2BE, HIST4H4, BMI1, PIP4K2A, EPB41L2, CAMKV, BPIFB1, YAF2, RYBP, DENND2D, ARRB2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000269886-110218_25415369ARC
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000417295-19218_25415321ARC
HgeneSH3GL1chr19:4400321chr19:6270770ENST00000598564-110218_25415305ARC


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SH3GL1_MLLT1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SH3GL1_MLLT1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource