FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33628

FusionGeneSummary for SH3BGRL_JAK1

check button Fusion gene summary
Fusion gene informationFusion gene name: SH3BGRL_JAK1
Fusion gene ID: 33628
HgeneTgene
Gene symbol

SH3BGRL

JAK1

Gene ID

6451

3716

Gene nameSH3 domain binding glutamate rich protein likeJanus kinase 1
SynonymsHEL-S-115|SH3BGRJAK1A|JAK1B|JTK3
Cytomap

Xq21.1

1p31.3

Type of geneprotein-codingprotein-coding
DescriptionSH3 domain-binding glutamic acid-rich-like proteinSH3 domain binding glutamic acid-rich protein likeSH3-binding domain glutamic acid-rich protein likeepididymis secretory protein Li 115tyrosine-protein kinase JAK1
Modification date2018052220180527
UniProtAcc

O75368

P23458

Ensembl transtripts involved in fusion geneENST00000373212, ENST00000481106, 
ENST00000342505, ENST00000465376, 
Fusion gene scores* DoF score2 X 2 X 2=89 X 8 X 4=288
# samples 210
** MAII scorelog2(2/8*10)=1.32192809488736log2(10/288*10)=-1.52606881166759
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SH3BGRL [Title/Abstract] AND JAK1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneJAK1

GO:0038110

interleukin-2-mediated signaling pathway

11909529

TgeneJAK1

GO:0046677

response to antibiotic

16280321


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1BJ990812SH3BGRLchrX

80457745

+JAK1chr1

65335158

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000373212ENST00000342505SH3BGRLchrX

80457745

+JAK1chr1

65335158

-
5CDS-intronENST00000373212ENST00000465376SH3BGRLchrX

80457745

+JAK1chr1

65335158

-
3UTR-3CDSENST00000481106ENST00000342505SH3BGRLchrX

80457745

+JAK1chr1

65335158

-
3UTR-intronENST00000481106ENST00000465376SH3BGRLchrX

80457745

+JAK1chr1

65335158

-

Top

FusionProtFeatures for SH3BGRL_JAK1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SH3BGRL

O75368

JAK1

P23458

Tyrosine kinase of the non-receptor type, involved inthe IFN-alpha/beta/gamma signal pathway (PubMed:7615558). Kinasepartner for the interleukin (IL)-2 receptor (PubMed:11909529).{ECO:0000269|PubMed:11909529, ECO:0000269|PubMed:7615558}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneJAK1chrX:80457745chr1:65335158ENST00000342505-425439_5441611155DomainSH2
TgeneJAK1chrX:80457745chr1:65335158ENST00000342505-425583_8551611155DomainProtein kinase 1
TgeneJAK1chrX:80457745chr1:65335158ENST00000342505-425875_11531611155DomainProtein kinase 2
TgeneJAK1chrX:80457745chr1:65335158ENST00000342505-425881_8891611155Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSH3BGRLchrX:80457745chr1:65335158ENST00000373212+1461_6715115MotifSH3-binding
TgeneJAK1chrX:80457745chr1:65335158ENST00000342505-42534_4201611155DomainFERM


Top

FusionGeneSequence for SH3BGRL_JAK1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SH3BGRL_ENST00000373212_chrX_80457745_+_JAK1_ENST00000342505_chr1_65335158_-_1009aa
MVIRVTIASSSGSTAGQTDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHTAMMKKMQLPELPKDISYKRTIPETLNKSIRQRNLLT
RMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGNLGIQWR
HKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIREEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLT
ADAHHYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKSEQVQGAQKQFKNFQIEVQKGR
YSLHGSDRSFPSLGDLMSHLKKQILRTDNISFMLKRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTH
ITSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLTGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVL
TTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADK
WSFGTTLWEICYNGEIPLKDKTLIEKERFTESRCRPVTPSCKELADLMTRCMNTDPNQRPFFRAIMRDINKLEEQNPDIVSEKKPATEVD
PTHFEKRFLKRIRDLGEGHFGKVELCRTDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLTHENIVKYKGICTEDGGNGIKLIM
EFLPSGSLKETLPKNKNKINLKQQLKTAVQICKGMDTLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKETYTVKDDRDSPVF
WTAPECLMQSKFTIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVTQLMRKCWEFQP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SH3BGRL_ENST00000373212_chrX_80457745_+_JAK1_ENST00000342505_chr1_65335158_-_3027nt
ATGGTGATCCGTGTATATATTGCATCTTCCTCTGGCTCTACAGCGGGACAGTATGATTTGGTGAAATGCCTGGCTCCTATTCGAGACCCC
AAGACCGAGCAGGATGGACATGATATTGAGAACGAGTGTCTAGGGATGGCTGTCCTGGCCATCTCACACTATGCCATGATGAAGAAGATG
CAGTTGCCAGAACTGCCCAAGGACATCAGCTACAAGCGATATATTCCAGAAACATTGAATAAGTCCATCAGACAGAGGAACCTTCTCACC
AGGATGCGGATAAATAATGTTTTCAAGGATTTCCTAAAGGAATTTAACAACAAGACCATTTGTGACAGCAGCGTGTCCACGCATGACCTG
AAGGTGAAATACTTGGCTACCTTGGAAACTTTGACAAAACATTACGGTGCTGAAATATTTGAGACTTCCATGTTACTGATTTCATCAGAA
AATGAGATGAATTGGTTTCATTCGAATGACGGTGGAAACGTTCTCTACTACGAAGTGATGGTGACTGGGAATCTTGGAATCCAGTGGAGG
CATAAACCAAATGTTGTTTCTGTTGAAAAGGAAAAAAATAAACTGAAGCGGAAAAAACTGGAAAATAAACACAAGAAGGATGAGGAGAAA
AACAAGATCCGGGAAGAGTGGAACAATTTTTCTTACTTCCCTGAAATCACTCACATTGTAATAAAGGAGTCTGTGGTCAGCATTAACAAG
CAGGACAACAAGAAAATGGAACTGAAGCTCTCTTCCCACGAGGAGGCCTTGTCCTTTGTGTCCCTGGTAGATGGCTACTTCCGGCTCACA
GCAGATGCCCATCATTACCTCTGCACCGACGTGGCCCCCCCGTTGATCGTCCACAACATACAGAATGGCTGTCATGGTCCAATCTGTACA
GAATACGCCATCAATAAATTGCGGCAAGAAGGAAGCGAGGAGGGGATGTACGTGCTGAGGTGGAGCTGCACCGACTTTGACAACATCCTC
ATGACCGTCACCTGCTTTGAGAAGTCTGAGCAGGTGCAGGGTGCCCAGAAGCAGTTCAAGAACTTTCAGATCGAGGTGCAGAAGGGCCGC
TACAGTCTGCACGGTTCGGACCGCAGCTTCCCCAGCTTGGGAGACCTCATGAGCCACCTCAAGAAGCAGATCCTGCGCACGGATAACATC
AGCTTCATGCTAAAACGCTGCTGCCAGCCCAAGCCCCGAGAAATCTCCAACCTGCTGGTGGCTACTAAGAAAGCCCAGGAGTGGCAGCCC
GTCTACCCCATGAGCCAGCTGAGTTTCGATCGGATCCTCAAGAAGGATCTGGTGCAGGGCGAGCACCTTGGGAGAGGCACGAGAACACAC
ATCTATTCTGGGACCCTGATGGATTACAAGGATGACGAAGGAACTTCTGAAGAGAAGAAGATAAAAGTGATCCTCAAAGTCTTAGACCCC
AGCCACAGGGATATTTCCCTGGCCTTCTTCGAGGCAGCCAGCATGATGAGACAGGTCTCCCACAAACACATCGTGTACCTCTATGGCGTC
TGTGTCCGCGACGTGGAGAATATCATGGTGGAAGAGTTTGTGGAAGGGGGTCCTCTGGATCTCTTCATGCACCGGAAAAGCGATGTCCTT
ACCACACCATGGAAATTCAAAGTTGCCAAACAGCTGGCCAGTGCCCTGAGCTACTTGGAGGATAAAGACCTGGTCCATGGAAATGTGTGT
ACTAAAAACCTCCTCCTGGCCCGTGAGGGCATCGACAGTGAGTGTGGCCCATTCATCAAGCTCAGTGACCCCGGCATCCCCATTACGGTG
CTGTCTAGGCAAGAATGCATTGAACGAATCCCATGGATTGCTCCTGAGTGTGTTGAGGACTCCAAGAACCTGAGTGTGGCTGCTGACAAG
TGGAGCTTTGGAACCACGCTCTGGGAAATCTGCTACAATGGCGAGATCCCCTTGAAAGACAAGACGCTGATTGAGAAAGAGAGATTCTAT
GAAAGCCGGTGCAGGCCAGTGACACCATCATGTAAGGAGCTGGCTGACCTCATGACCCGCTGCATGAACTATGACCCCAATCAGAGGCCT
TTCTTCCGAGCCATCATGAGAGACATTAATAAGCTTGAAGAGCAGAATCCAGATATTGTTTCAGAAAAAAAACCAGCAACTGAAGTGGAC
CCCACACATTTTGAAAAGCGCTTCCTAAAGAGGATCCGTGACTTGGGAGAGGGCCACTTTGGGAAGGTTGAGCTCTGCAGGTATGACCCC
GAAGGGGACAATACAGGGGAGCAGGTGGCTGTTAAATCTCTGAAGCCTGAGAGTGGAGGTAACCACATAGCTGATCTGAAAAAGGAAATC
GAGATCTTAAGGAACCTCTATCATGAGAACATTGTGAAGTACAAAGGAATCTGCACAGAAGACGGAGGAAATGGTATTAAGCTCATCATG
GAATTTCTGCCTTCGGGAAGCCTTAAGGAATATCTTCCAAAGAATAAGAACAAAATAAACCTCAAACAGCAGCTAAAATATGCCGTTCAG
ATTTGTAAGGGGATGGACTATTTGGGTTCTCGGCAATACGTTCACCGGGACTTGGCAGCAAGAAATGTCCTTGTTGAGAGTGAACACCAA
GTGAAAATTGGAGACTTCGGTTTAACCAAAGCAATTGAAACCGATAAGGAGTATTACACCGTCAAGGATGACCGGGACAGCCCTGTGTTT
TGGTATGCTCCAGAATGTTTAATGCAATCTAAATTTTATATTGCCTCTGACGTCTGGTCTTTTGGAGTCACTCTGCATGAGCTGCTGACT
TACTGTGATTCAGATTCTAGTCCCATGGCTTTGTTCCTGAAAATGATAGGCCCAACCCATGGCCAGATGACAGTCACAAGACTTGTGAAT
ACGTTAAAAGAAGGAAAACGCCTGCCGTGCCCACCTAACTGTCCAGATGAGGTTTATCAACTTATGAGGAAATGCTGGGAATTCCAACCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_SH3BGRL_ENST00000373212_chrX_80457745_+_JAK1_ENST00000342505_chr1_65335158_-_4618nt
CGAGATTCCCTATTAAAAAAAAATAGAATTGATGCAAACAGCCTGTTCCTTCCGGGGTTTTGGGCTGGAACTGCAGCGCTTAGAGAGCTC
GGTGGAAGCTGCTAAAGGCGGAGGCGGGGCTCTGGCGAGTTCTCCTTCCACCTTCCCCCACCCTTCTCTGCCAACCGCTGTTTCAGCCCC
TAGCTGGATTCCAGCCATTGCTGCAGCTGCTCCACAGCCCTTTTCAGGACCCAAACAACCGCAGCCGCTGTTCCCAGGATGGTGATCCGT
GTATATATTGCATCTTCCTCTGGCTCTACAGCGGGACAGTATGATTTGGTGAAATGCCTGGCTCCTATTCGAGACCCCAAGACCGAGCAG
GATGGACATGATATTGAGAACGAGTGTCTAGGGATGGCTGTCCTGGCCATCTCACACTATGCCATGATGAAGAAGATGCAGTTGCCAGAA
CTGCCCAAGGACATCAGCTACAAGCGATATATTCCAGAAACATTGAATAAGTCCATCAGACAGAGGAACCTTCTCACCAGGATGCGGATA
AATAATGTTTTCAAGGATTTCCTAAAGGAATTTAACAACAAGACCATTTGTGACAGCAGCGTGTCCACGCATGACCTGAAGGTGAAATAC
TTGGCTACCTTGGAAACTTTGACAAAACATTACGGTGCTGAAATATTTGAGACTTCCATGTTACTGATTTCATCAGAAAATGAGATGAAT
TGGTTTCATTCGAATGACGGTGGAAACGTTCTCTACTACGAAGTGATGGTGACTGGGAATCTTGGAATCCAGTGGAGGCATAAACCAAAT
GTTGTTTCTGTTGAAAAGGAAAAAAATAAACTGAAGCGGAAAAAACTGGAAAATAAACACAAGAAGGATGAGGAGAAAAACAAGATCCGG
GAAGAGTGGAACAATTTTTCTTACTTCCCTGAAATCACTCACATTGTAATAAAGGAGTCTGTGGTCAGCATTAACAAGCAGGACAACAAG
AAAATGGAACTGAAGCTCTCTTCCCACGAGGAGGCCTTGTCCTTTGTGTCCCTGGTAGATGGCTACTTCCGGCTCACAGCAGATGCCCAT
CATTACCTCTGCACCGACGTGGCCCCCCCGTTGATCGTCCACAACATACAGAATGGCTGTCATGGTCCAATCTGTACAGAATACGCCATC
AATAAATTGCGGCAAGAAGGAAGCGAGGAGGGGATGTACGTGCTGAGGTGGAGCTGCACCGACTTTGACAACATCCTCATGACCGTCACC
TGCTTTGAGAAGTCTGAGCAGGTGCAGGGTGCCCAGAAGCAGTTCAAGAACTTTCAGATCGAGGTGCAGAAGGGCCGCTACAGTCTGCAC
GGTTCGGACCGCAGCTTCCCCAGCTTGGGAGACCTCATGAGCCACCTCAAGAAGCAGATCCTGCGCACGGATAACATCAGCTTCATGCTA
AAACGCTGCTGCCAGCCCAAGCCCCGAGAAATCTCCAACCTGCTGGTGGCTACTAAGAAAGCCCAGGAGTGGCAGCCCGTCTACCCCATG
AGCCAGCTGAGTTTCGATCGGATCCTCAAGAAGGATCTGGTGCAGGGCGAGCACCTTGGGAGAGGCACGAGAACACACATCTATTCTGGG
ACCCTGATGGATTACAAGGATGACGAAGGAACTTCTGAAGAGAAGAAGATAAAAGTGATCCTCAAAGTCTTAGACCCCAGCCACAGGGAT
ATTTCCCTGGCCTTCTTCGAGGCAGCCAGCATGATGAGACAGGTCTCCCACAAACACATCGTGTACCTCTATGGCGTCTGTGTCCGCGAC
GTGGAGAATATCATGGTGGAAGAGTTTGTGGAAGGGGGTCCTCTGGATCTCTTCATGCACCGGAAAAGCGATGTCCTTACCACACCATGG
AAATTCAAAGTTGCCAAACAGCTGGCCAGTGCCCTGAGCTACTTGGAGGATAAAGACCTGGTCCATGGAAATGTGTGTACTAAAAACCTC
CTCCTGGCCCGTGAGGGCATCGACAGTGAGTGTGGCCCATTCATCAAGCTCAGTGACCCCGGCATCCCCATTACGGTGCTGTCTAGGCAA
GAATGCATTGAACGAATCCCATGGATTGCTCCTGAGTGTGTTGAGGACTCCAAGAACCTGAGTGTGGCTGCTGACAAGTGGAGCTTTGGA
ACCACGCTCTGGGAAATCTGCTACAATGGCGAGATCCCCTTGAAAGACAAGACGCTGATTGAGAAAGAGAGATTCTATGAAAGCCGGTGC
AGGCCAGTGACACCATCATGTAAGGAGCTGGCTGACCTCATGACCCGCTGCATGAACTATGACCCCAATCAGAGGCCTTTCTTCCGAGCC
ATCATGAGAGACATTAATAAGCTTGAAGAGCAGAATCCAGATATTGTTTCAGAAAAAAAACCAGCAACTGAAGTGGACCCCACACATTTT
GAAAAGCGCTTCCTAAAGAGGATCCGTGACTTGGGAGAGGGCCACTTTGGGAAGGTTGAGCTCTGCAGGTATGACCCCGAAGGGGACAAT
ACAGGGGAGCAGGTGGCTGTTAAATCTCTGAAGCCTGAGAGTGGAGGTAACCACATAGCTGATCTGAAAAAGGAAATCGAGATCTTAAGG
AACCTCTATCATGAGAACATTGTGAAGTACAAAGGAATCTGCACAGAAGACGGAGGAAATGGTATTAAGCTCATCATGGAATTTCTGCCT
TCGGGAAGCCTTAAGGAATATCTTCCAAAGAATAAGAACAAAATAAACCTCAAACAGCAGCTAAAATATGCCGTTCAGATTTGTAAGGGG
ATGGACTATTTGGGTTCTCGGCAATACGTTCACCGGGACTTGGCAGCAAGAAATGTCCTTGTTGAGAGTGAACACCAAGTGAAAATTGGA
GACTTCGGTTTAACCAAAGCAATTGAAACCGATAAGGAGTATTACACCGTCAAGGATGACCGGGACAGCCCTGTGTTTTGGTATGCTCCA
GAATGTTTAATGCAATCTAAATTTTATATTGCCTCTGACGTCTGGTCTTTTGGAGTCACTCTGCATGAGCTGCTGACTTACTGTGATTCA
GATTCTAGTCCCATGGCTTTGTTCCTGAAAATGATAGGCCCAACCCATGGCCAGATGACAGTCACAAGACTTGTGAATACGTTAAAAGAA
GGAAAACGCCTGCCGTGCCCACCTAACTGTCCAGATGAGGTTTATCAACTTATGAGGAAATGCTGGGAATTCCAACCATCCAATCGGACA
AGCTTTCAGAACCTTATTGAAGGATTTGAAGCACTTTTAAAATAAGAAGCATGAATAACATTTAAATTCCACAGATTATCAAGTCCTTCT
CCTGCAACAAATGCCCAAGTCATTTTTTAAAAATTTCTAATGAAAGAAGTTTGTGTTCTGTCCAAAAAGTCACTGAACTCATACTTCAGT
ACATATACATGTATAAGGCACACTGTAGTGCTTAATATGTGTAAGGACTTCCTCTTTAAATTTGGTACCAGTAACTTAGTGACACATAAT
GACAACCAAAATATTTGAAAGCACTTAAGCACTCCTCCTTGTGGAAAGAATATACCACCATTTCATCTGGCTAGTTCACCATCACAACTG
CATTACCAAAAGGGGATTTTTGAAAACGAGGAGTTGACCAAAATAATATCTGAAGATGATTGCTTTTCCCTGCTGCCAGCTGATCTGAAA
TGTTTTGCTGGCACATTAATCATAGATAAAGAAAGATTGATGGACTTAGCCCTCAAATTTCAGTATCTATACAGTACTAGACCATGCATT
CTTAAAATATTAGATACCAGGTAGTATATATTGTTTCTGTACAAAAATGACTGTATTCTCTCACCAGTAGGACTTAAACTTTGTTTCTCC
AGTGGCTTAGCTCCTGTTCCTTTGGGTGATCACTAGCACCCATTTTTGAGAAAGCTGGTTCTACATGGGGGGATAGCTGTGGAATAGATA
ATTTGCTGCATGTTAATTCTCAAGAACTAAGCCTGTGCCAGTGCTTTCCTAAGCAGTATACCTTTAATCAGAACTCATTCCCAGAACCTG
GATGCTATTACACATGCTTTTAAGAAACGTCAATGTATATCCTTTTATAACTCTACCACTTTGGGGCAAGCTATTCCAGCACTGGTTTTG
AATGCTGTATGCAACCAGTCTGAATACCACATACGCTGCACTGTTCTTAGAGGGTTTCCATACTTACCACCGATCTACAAGGGTTGATCC
CTGTTTTTACCATCAATCATCACCCTGTGGTGCAACACTTGAAAGACCCGGCTAGAGGCACTATGGACTTCAGGATCCACTAGACAGTTT
TCAGTTTGCTTGGAGGTAGCTGGGTAATCAAAAATGTTTAGTCATTGATTCAATGTGAACGATTACGGTCTTTATGACCAAGAGTCTGAA
AATCTTTTTGTTATGCTGTTTAGTATTCGTTTGATATTGTTACTTTTCACCTGTTGAGCCCAAATTCAGGATTGGTTCAGTGGCAGCAAT
GAAGTTGCCATTTAAATTTGTTCATAGCCTACATCACCAAGGTCTCTGTGTCAAACCTGTGGCCACTCTATATGCACTTTGTTTACTCTT


Top

FusionGenePPI for SH3BGRL_JAK1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SH3BGRLEGFR, ERBB2, SCAF4, PSMA5, IGBP1, PSMA1, NSFL1C, LXN, SNRPF, SDHAF2, STUB1, CD2BP2, STAT6, COTL1, DAZAP1, TESJAK1ATIC, ARRB1, ELF3, STAT3, ABL1, ABL2, GNB2L1, IL27RA, PRMT5, SHB, IL10RA, PTK2B, TEC, BTK, IRS1, IGF1R, BRCA1, IL2RB, IL6ST, STAM2, PTPN11, TYK2, TNFRSF1A, STAT5B, STAT5A, IRS2, ELP2, IL21R, GRB2, CSF3R, IL5RA, IL9R, PTPN6, PLAUR, IFNAR2, IL4R, IFNGR1, TSHR, GHR, RAF1, AGO4, CSF2RB, TIRAP, HIST3H3, SIRT1, SOCS1, SOCS3, EGFR, TOP1, STAT6, EIF4A3, MAGOH, SMURF1, IL2RG, JAK1, EIF2AK2, HSP90AA1, ERBB2, INSR, STAT1, UBL4A, JAK3, PLCG1, NPM1, PLA2G4A, MDM2, NOC2L, PML, TAGLN, DTX3L, DSP, FLG2, RNF125, TGFBR2, LPAR6, NTRK1, KRAS, CTDSPL2, FAM46A, KIF24, EID1, CFTR, OSMR, LAMP2, LAMP3, IL13RA2, MANSC1, APLNR, MAS1, HAVCR2, SLC15A1, LRRIQ1, CYLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SH3BGRL_JAK1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneJAK1P23458DB08877RuxolitinibTyrosine-protein kinase JAK1small moleculeapproved
TgeneJAK1P23458DB08895TofacitinibTyrosine-protein kinase JAK1small moleculeapproved|investigational

Top

RelatedDiseases for SH3BGRL_JAK1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource