FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33472

FusionGeneSummary for SFI1_EFCAB4B

check button Fusion gene summary
Fusion gene informationFusion gene name: SFI1_EFCAB4B
Fusion gene ID: 33472
HgeneTgene
Gene symbol

SFI1

EFCAB4B

Gene ID

9814

84766

Gene nameSFI1 centrin binding proteincalcium release activated channel regulator 2A
SynonymsPISD|PPP1R139|hSfi1pEFCAB4B
Cytomap

22q12.2

12p13.32

Type of geneprotein-codingprotein-coding
Descriptionprotein SFI1 homologSfi1 homolog, spindle assembly associatedhomolog of yeast Sfi1protein phosphatase 1, regulatory subunit 139EF-hand calcium-binding domain-containing protein 4BCRAC channel regulator 2ACRAC regulator 2ACa2+ release-activated Ca2+ (CRAC) channel regulator 2AEF-hand calcium binding domain 4Bcalcium release-activated calcium channel regulator 2A
Modification date2018051920180519
UniProtAcc

A8K8P3

Ensembl transtripts involved in fusion geneENST00000443326, ENST00000414585, 
ENST00000540643, ENST00000432498, 
ENST00000443011, ENST00000400289, 
ENST00000400288, ENST00000474741, 
ENST00000440314, ENST00000444507, 
ENST00000252322, ENST00000514026, 
Fusion gene scores* DoF score4 X 3 X 4=482 X 2 X 2=8
# samples 42
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: SFI1 [Title/Abstract] AND EFCAB4B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSFI1

GO:0010923

negative regulation of phosphatase activity

19389623


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVTGCTTCGA-VF-A8AD-01ASFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000443326ENST00000440314SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
In-frameENST00000443326ENST00000444507SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000443326ENST00000252322SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000443326ENST00000514026SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
In-frameENST00000414585ENST00000440314SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
In-frameENST00000414585ENST00000444507SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000414585ENST00000252322SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000414585ENST00000514026SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
In-frameENST00000540643ENST00000440314SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
In-frameENST00000540643ENST00000444507SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000540643ENST00000252322SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000540643ENST00000514026SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
In-frameENST00000432498ENST00000440314SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
In-frameENST00000432498ENST00000444507SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000432498ENST00000252322SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000432498ENST00000514026SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
In-frameENST00000443011ENST00000440314SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
In-frameENST00000443011ENST00000444507SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000443011ENST00000252322SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000443011ENST00000514026SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
In-frameENST00000400289ENST00000440314SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
In-frameENST00000400289ENST00000444507SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000400289ENST00000252322SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000400289ENST00000514026SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
In-frameENST00000400288ENST00000440314SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
In-frameENST00000400288ENST00000444507SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000400288ENST00000252322SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
5CDS-intronENST00000400288ENST00000514026SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
intron-3CDSENST00000474741ENST00000440314SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
intron-3CDSENST00000474741ENST00000444507SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
intron-intronENST00000474741ENST00000252322SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-
intron-intronENST00000474741ENST00000514026SFI1chr22

31985563

+EFCAB4Bchr12

3753806

-

Top

FusionProtFeatures for SFI1_EFCAB4B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SFI1

A8K8P3

EFCAB4B

Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSFI1chr22:31985563chr12:3753806ENST00000400288+1533138_1705141243RepeatNote=HAT 1
HgeneSFI1chr22:31985563chr12:3753806ENST00000400288+1533172_2015141243RepeatNote=HAT 2
HgeneSFI1chr22:31985563chr12:3753806ENST00000400288+1533270_3025141243RepeatNote=HAT 3
HgeneSFI1chr22:31985563chr12:3753806ENST00000400288+1533334_3685141243RepeatNote=HAT 4
HgeneSFI1chr22:31985563chr12:3753806ENST00000400288+1533399_4315141243RepeatNote=HAT 5
HgeneSFI1chr22:31985563chr12:3753806ENST00000400289+1331138_1704321161RepeatNote=HAT 1
HgeneSFI1chr22:31985563chr12:3753806ENST00000400289+1331172_2014321161RepeatNote=HAT 2
HgeneSFI1chr22:31985563chr12:3753806ENST00000400289+1331270_3024321161RepeatNote=HAT 3
HgeneSFI1chr22:31985563chr12:3753806ENST00000400289+1331334_3684321161RepeatNote=HAT 4
HgeneSFI1chr22:31985563chr12:3753806ENST00000400289+1331399_4314321161RepeatNote=HAT 5
HgeneSFI1chr22:31985563chr12:3753806ENST00000414585+1129138_170361989RepeatNote=HAT 1
HgeneSFI1chr22:31985563chr12:3753806ENST00000414585+1129172_201361989RepeatNote=HAT 2
HgeneSFI1chr22:31985563chr12:3753806ENST00000414585+1129270_302361989RepeatNote=HAT 3
HgeneSFI1chr22:31985563chr12:3753806ENST00000432498+1432138_1704831212RepeatNote=HAT 1
HgeneSFI1chr22:31985563chr12:3753806ENST00000432498+1432172_2014831212RepeatNote=HAT 2
HgeneSFI1chr22:31985563chr12:3753806ENST00000432498+1432270_3024831212RepeatNote=HAT 3
HgeneSFI1chr22:31985563chr12:3753806ENST00000432498+1432334_3684831212RepeatNote=HAT 4
HgeneSFI1chr22:31985563chr12:3753806ENST00000432498+1432399_4314831212RepeatNote=HAT 5
HgeneSFI1chr22:31985563chr12:3753806ENST00000443326+1331138_1704321161RepeatNote=HAT 1
HgeneSFI1chr22:31985563chr12:3753806ENST00000443326+1331172_2014321161RepeatNote=HAT 2
HgeneSFI1chr22:31985563chr12:3753806ENST00000443326+1331270_3024321161RepeatNote=HAT 3
HgeneSFI1chr22:31985563chr12:3753806ENST00000443326+1331334_3684321161RepeatNote=HAT 4
HgeneSFI1chr22:31985563chr12:3753806ENST00000443326+1331399_4314321161RepeatNote=HAT 5
HgeneSFI1chr22:31985563chr12:3753806ENST00000540643+1331138_1704591188RepeatNote=HAT 1
HgeneSFI1chr22:31985563chr12:3753806ENST00000540643+1331172_2014591188RepeatNote=HAT 2
HgeneSFI1chr22:31985563chr12:3753806ENST00000540643+1331270_3024591188RepeatNote=HAT 3
HgeneSFI1chr22:31985563chr12:3753806ENST00000540643+1331334_3684591188RepeatNote=HAT 4
HgeneSFI1chr22:31985563chr12:3753806ENST00000540643+1331399_4314591188RepeatNote=HAT 5
TgeneEFCAB4Bchr22:31985563chr12:3753806ENST00000252322-01197_108-157396Calcium binding.
TgeneEFCAB4Bchr22:31985563chr12:3753806ENST00000252322-011201_373-157396Coiled coilOntology_term=ECO:0000255
TgeneEFCAB4Bchr22:31985563chr12:3753806ENST00000252322-01154_82-157396DomainEF-hand 1
TgeneEFCAB4Bchr22:31985563chr12:3753806ENST00000252322-01184_119-157396DomainEF-hand 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSFI1chr22:31985563chr12:3753806ENST00000400288+15331148_11805141243RepeatNote=HAT 6
HgeneSFI1chr22:31985563chr12:3753806ENST00000400289+13311148_11804321161RepeatNote=HAT 6
HgeneSFI1chr22:31985563chr12:3753806ENST00000414585+11291148_1180361989RepeatNote=HAT 6
HgeneSFI1chr22:31985563chr12:3753806ENST00000414585+1129334_368361989RepeatNote=HAT 4
HgeneSFI1chr22:31985563chr12:3753806ENST00000414585+1129399_431361989RepeatNote=HAT 5
HgeneSFI1chr22:31985563chr12:3753806ENST00000432498+14321148_11804831212RepeatNote=HAT 6
HgeneSFI1chr22:31985563chr12:3753806ENST00000443326+13311148_11804321161RepeatNote=HAT 6
HgeneSFI1chr22:31985563chr12:3753806ENST00000540643+13311148_11804591188RepeatNote=HAT 6
TgeneEFCAB4Bchr22:31985563chr12:3753806ENST00000440314-102097_108372732Calcium binding.
TgeneEFCAB4Bchr22:31985563chr12:3753806ENST00000440314-1020201_373372732Coiled coilOntology_term=ECO:0000255
TgeneEFCAB4Bchr22:31985563chr12:3753806ENST00000440314-102054_82372732DomainEF-hand 1
TgeneEFCAB4Bchr22:31985563chr12:3753806ENST00000440314-102084_119372732DomainEF-hand 2


Top

FusionGeneSequence for SFI1_EFCAB4B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SFI1_ENST00000443326_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_792aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRFYYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRYYLYNLMFQTWKTYVRQQQEMR
NKYIRAEVHDAKQKMRQAWKSWLIYVVVRRTKLQMQTTALEFRQRIILRVWWSTWRQRLGQVRVSRALHASALKHRALSLQVQAWSQWRE
QLLYVQKEKQKVVSAVKHHQHWQKRRFLKAWLEYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERRESLYAHHAQVEKLARKMAL
RRAFTHWKHYMLLCAEEAAQFEMAEEHHRHSQLYFCFRALKDNVTHAHLQQIRRNLAHQQHGVTLLHRFWNLWRSQIEQKKERELLPLLH
AAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGHFQQRALPAAFHTWNRLWRWRHQENVLSARATRFHRERNKHLRDERDICFQKN
KAAKANTAASRASWKKRSGSVIGKYVDSRGILRSQSEEEEEVFGIPRRSSLGLSGYPLTEEEPGTGEPGPGGPYPRPLRRIISVEEDPLP
QLLDGGFEQPLSKCSEEEEVSDQGVQGQIPEAPPLKLTPTSPRGQPVGKEALCKEESSPSAPDRLFKIVFVGNSAVGKTSFLRRFCEDRF
SPGMAATVGIDYRVKTLNVDNSQVALQLWDTAGQERYRCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLSSVEEAVGDRVPVLLLGNKL

>In-frame_SFI1_ENST00000443326_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_523aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRFYYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRYYLYNLMFQTWKTYVRQQQEMR
NKYIRAEVHDAKQKMRQAWKSWLIYVVVRRTKLQMQTTALEFRQRIILRVWWSTWRQRLGQVRVSRALHASALKHRALSLQVQAWSQWRE
QLLYVQKEKQKVVSAVKHHQHWQKRRFLKAWLEYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERRESLYAHHAQVEKLARKMAL
RRAFTHWKHYMLLCAEEAAQFEMAEEHHRHSQLYFCFRALKDNVTHAHLQQIRRNLAHQQHGVTLLHRFWNLWRSQIEQKKERELLPLLH
AAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGHFQQRALPAAFHTWNRLWRWRHQENVLSARATRFHRERNKHLRDERDICFQKN

>In-frame_SFI1_ENST00000414585_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_721aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRFYYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRVWWSTWRQRLGQVRVSRALHAS
ALKHRALSLQVQAWSQWREQLLYVQKEKQKVVSAVKHHQHWQKRRFLKAWLEYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERR
ESLYAHHAQVEKLARKMALRRAFTHWKHYMLLCAEEAAQFEMAEEHHRHSQLYFCFRALKDNVTHAHLQQIRRNLAHQQHGVTLLHRFWN
LWRSQIEQKKERELLPLLHAAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGHFQQRALPAAFHTWNRLWRWRHQENVLSARATRF
HRERNKHLRDERDICFQKNKAAKANTAASRASWKKRSGSVIGKYVDSRGILRSQSEEEEEVFGIPRRSSLGLSGYPLTEEEPGTGEPGPG
GPYPRPLRRIISVEEDPLPQLLDGGFEQPLSKCSEEEEVSDQGVQGQIPEAPPLKLTPTSPRGQPVGKEALCKEESSPSAPDRLFKIVFV
GNSAVGKTSFLRRFCEDRFSPGMAATVGIDYRVKTLNVDNSQVALQLWDTAGQERYRCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLS
SVEEAVGDRVPVLLLGNKLDNEKEREVPRGLGEQLATENNLIFYECSAYSGHNTKESLLHLARFLKEQEDTVREDTIQVGHPAKKKSCCG

>In-frame_SFI1_ENST00000414585_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_452aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRFYYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRVWWSTWRQRLGQVRVSRALHAS
ALKHRALSLQVQAWSQWREQLLYVQKEKQKVVSAVKHHQHWQKRRFLKAWLEYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERR
ESLYAHHAQVEKLARKMALRRAFTHWKHYMLLCAEEAAQFEMAEEHHRHSQLYFCFRALKDNVTHAHLQQIRRNLAHQQHGVTLLHRFWN
LWRSQIEQKKERELLPLLHAAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGHFQQRALPAAFHTWNRLWRWRHQENVLSARATRF
HRERNKHLRDERDICFQKNKAAKANTAASRASWKKRSGSVIGKYVDSRGILRRWPQRDRGIPTLQYQTQRDLEDCKHEMKKICKAEVTLE

>In-frame_SFI1_ENST00000540643_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_819aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRYFKDGAVKKPYSAKTLSNKKSSASFGIRRELPSTSHLVQYRGTHTCTRQGRLRELRIRF
YYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRYYLYNLMFQTWKTYVRQQQEMRNKYIRAEVHDAKQKMRQAWKSWLIYVVVRRTK
LQMQTTALEFRQRIILRVWWSTWRQRLGQVRVSRALHASALKHRALSLQVQAWSQWREQLLYVQKEKQKVVSAVKHHQHWQKRRFLKAWL
EYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERRESLYAHHAQVEKLARKMALRRAFTHWKHYMLLCAEEAAQFEMAEEHHRHSQ
LLLHRFWNLWRSQIEQKKERELLPLLHAAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGHFQQRALPAAFHTWNRLWRWRHQENV
LSARATRFHRERNKHLRDERDICFQKNKAAKANTAASRASWKKRSGSVIGKYVDSRGILRSQSEEEEEVFGIPRRSSLGLSGYPLTEEEP
GTGEPGPGGPYPRPLRRIISVEEDPLPQLLDGGFEQPLSKCSEEEEVSDQGVQGQIPEAPPLKLTPTSPRGQPVGKEALCKEESSPSAPD
RLFKIVFVGNSAVGKTSFLRRFCEDRFSPGMAATVGIDYRVKTLNVDNSQVALQLWDTAGQERYRCITQQFFRKADGVIVMYDLTDKQSF
LSVRRWLSSVEEAVGDRVPVLLLGNKLDNEKEREVPRGLGEQLATENNLIFYECSAYSGHNTKESLLHLARFLKEQEDTVREDTIQVGHP

>In-frame_SFI1_ENST00000540643_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_550aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRYFKDGAVKKPYSAKTLSNKKSSASFGIRRELPSTSHLVQYRGTHTCTRQGRLRELRIRF
YYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRYYLYNLMFQTWKTYVRQQQEMRNKYIRAEVHDAKQKMRQAWKSWLIYVVVRRTK
LQMQTTALEFRQRIILRVWWSTWRQRLGQVRVSRALHASALKHRALSLQVQAWSQWREQLLYVQKEKQKVVSAVKHHQHWQKRRFLKAWL
EYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERRESLYAHHAQVEKLARKMALRRAFTHWKHYMLLCAEEAAQFEMAEEHHRHSQ
LLLHRFWNLWRSQIEQKKERELLPLLHAAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGHFQQRALPAAFHTWNRLWRWRHQENV
LSARATRFHRERNKHLRDERDICFQKNKAAKANTAASRASWKKRSGSVIGKYVDSRGILRRWPQRDRGIPTLQYQTQRDLEDCKHEMKKI

>In-frame_SFI1_ENST00000432498_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_843aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRYFKDGAVKKPYSAKTLSNKKSSASFGIRRELPSTSHLVQYRGTHTCTRQGRLRELRIRC
VARKFLYLWIRMTFGRVFPSKARFYYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRYYLYNLMFQTWKTYVRQQQEMRNKYIRAEV
HDAKQKMRQAWKSWLIYVVVRRTKLQMQTTALEFRQRIILRVWWSTWRQRLGQVRVSRALHASALKHRALSLQVQAWSQWREQLLYVQKE
KQKVVSAVKHHQHWQKRRFLKAWLEYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERRESLYAHHAQVEKLARKMALRRAFTHWK
HYMLLCAEEAAQFEMAEEHHRHSQLLLHRFWNLWRSQIEQKKERELLPLLHAAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGHF
QQRALPAAFHTWNRLWRWRHQENVLSARATRFHRERNKHLRDERDICFQKNKAAKANTAASRASWKKRSGSVIGKYVDSRGILRSQSEEE
EEVFGIPRRSSLGLSGYPLTEEEPGTGEPGPGGPYPRPLRRIISVEEDPLPQLLDGGFEQPLSKCSEEEEVSDQGVQGQIPEAPPLKLTP
TSPRGQPVGKEALCKEESSPSAPDRLFKIVFVGNSAVGKTSFLRRFCEDRFSPGMAATVGIDYRVKTLNVDNSQVALQLWDTAGQERYRC
ITQQFFRKADGVIVMYDLTDKQSFLSVRRWLSSVEEAVGDRVPVLLLGNKLDNEKEREVPRGLGEQLATENNLIFYECSAYSGHNTKESL

>In-frame_SFI1_ENST00000432498_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_574aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRYFKDGAVKKPYSAKTLSNKKSSASFGIRRELPSTSHLVQYRGTHTCTRQGRLRELRIRC
VARKFLYLWIRMTFGRVFPSKARFYYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRYYLYNLMFQTWKTYVRQQQEMRNKYIRAEV
HDAKQKMRQAWKSWLIYVVVRRTKLQMQTTALEFRQRIILRVWWSTWRQRLGQVRVSRALHASALKHRALSLQVQAWSQWREQLLYVQKE
KQKVVSAVKHHQHWQKRRFLKAWLEYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERRESLYAHHAQVEKLARKMALRRAFTHWK
HYMLLCAEEAAQFEMAEEHHRHSQLLLHRFWNLWRSQIEQKKERELLPLLHAAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGHF
QQRALPAAFHTWNRLWRWRHQENVLSARATRFHRERNKHLRDERDICFQKNKAAKANTAASRASWKKRSGSVIGKYVDSRGILRRWPQRD

>In-frame_SFI1_ENST00000443011_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_721aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRFYYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRVWWSTWRQRLGQVRVSRALHAS
ALKHRALSLQVQAWSQWREQLLYVQKEKQKVVSAVKHHQHWQKRRFLKAWLEYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERR
ESLYAHHAQVEKLARKMALRRAFTHWKHYMLLCAEEAAQFEMAEEHHRHSQLYFCFRALKDNVTHAHLQQIRRNLAHQQHGVTLLHRFWN
LWRSQIEQKKERELLPLLHAAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGHFQQRALPAAFHTWNRLWRWRHQENVLSARATRF
HRERNKHLRDERDICFQKNKAAKANTAASRASWKKRSGSVIGKYVDSRGILRSQSEEEEEVFGIPRRSSLGLSGYPLTEEEPGTGEPGPG
GPYPRPLRRIISVEEDPLPQLLDGGFEQPLSKCSEEEEVSDQGVQGQIPEAPPLKLTPTSPRGQPVGKEALCKEESSPSAPDRLFKIVFV
GNSAVGKTSFLRRFCEDRFSPGMAATVGIDYRVKTLNVDNSQVALQLWDTAGQERYRCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLS
SVEEAVGDRVPVLLLGNKLDNEKEREVPRGLGEQLATENNLIFYECSAYSGHNTKESLLHLARFLKEQEDTVREDTIQVGHPAKKKSCCG

>In-frame_SFI1_ENST00000443011_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_452aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRFYYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRVWWSTWRQRLGQVRVSRALHAS
ALKHRALSLQVQAWSQWREQLLYVQKEKQKVVSAVKHHQHWQKRRFLKAWLEYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERR
ESLYAHHAQVEKLARKMALRRAFTHWKHYMLLCAEEAAQFEMAEEHHRHSQLYFCFRALKDNVTHAHLQQIRRNLAHQQHGVTLLHRFWN
LWRSQIEQKKERELLPLLHAAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGHFQQRALPAAFHTWNRLWRWRHQENVLSARATRF
HRERNKHLRDERDICFQKNKAAKANTAASRASWKKRSGSVIGKYVDSRGILRRWPQRDRGIPTLQYQTQRDLEDCKHEMKKICKAEVTLE

>In-frame_SFI1_ENST00000400289_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_792aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRFYYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRYYLYNLMFQTWKTYVRQQQEMR
NKYIRAEVHDAKQKMRQAWKSWLIYVVVRRTKLQMQTTALEFRQRIILRVWWSTWRQRLGQVRVSRALHASALKHRALSLQVQAWSQWRE
QLLYVQKEKQKVVSAVKHHQHWQKRRFLKAWLEYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERRESLYAHHAQVEKLARKMAL
RRAFTHWKHYMLLCAEEAAQFEMAEEHHRHSQLYFCFRALKDNVTHAHLQQIRRNLAHQQHGVTLLHRFWNLWRSQIEQKKERELLPLLH
AAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGHFQQRALPAAFHTWNRLWRWRHQENVLSARATRFHRERNKHLRDERDICFQKN
KAAKANTAASRASWKKRSGSVIGKYVDSRGILRSQSEEEEEVFGIPRRSSLGLSGYPLTEEEPGTGEPGPGGPYPRPLRRIISVEEDPLP
QLLDGGFEQPLSKCSEEEEVSDQGVQGQIPEAPPLKLTPTSPRGQPVGKEALCKEESSPSAPDRLFKIVFVGNSAVGKTSFLRRFCEDRF
SPGMAATVGIDYRVKTLNVDNSQVALQLWDTAGQERYRCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLSSVEEAVGDRVPVLLLGNKL

>In-frame_SFI1_ENST00000400289_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_523aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRFYYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRYYLYNLMFQTWKTYVRQQQEMR
NKYIRAEVHDAKQKMRQAWKSWLIYVVVRRTKLQMQTTALEFRQRIILRVWWSTWRQRLGQVRVSRALHASALKHRALSLQVQAWSQWRE
QLLYVQKEKQKVVSAVKHHQHWQKRRFLKAWLEYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERRESLYAHHAQVEKLARKMAL
RRAFTHWKHYMLLCAEEAAQFEMAEEHHRHSQLYFCFRALKDNVTHAHLQQIRRNLAHQQHGVTLLHRFWNLWRSQIEQKKERELLPLLH
AAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGHFQQRALPAAFHTWNRLWRWRHQENVLSARATRFHRERNKHLRDERDICFQKN

>In-frame_SFI1_ENST00000400288_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_874aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRYFKDGAVKKPYSAKTLSNKKSSASFGIRRELPSTSHLVQYRGTHTCTRQGRLRELRIRC
VARKFLYLWIRMTFGRVFPSKARFYYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRYYLYNLMFQTWKTYVRQQQEMRNKYIRAEV
HDAKQKMRQAWKSWLIYVVVRRTKLQMQTTALEFRQRIILRVWWSTWRQRLGQVRVSRALHASALKHRALSLQVQAWSQWREQLLYVQKE
KQKVVSAVKHHQHWQKRRFLKAWLEYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERRESLYAHHAQVEKLARKMALRRAFTHWK
HYMLLCAEEAAQFEMAEEHHRHSQLYFCFRALKDNVTHAHLQQIRRNLAHQQHGVTLLHRFWNLWRSQIEQKKERELLPLLHAAWDHYRI
ALLCKCIELWLQYTQKRRYKQLLQARADGHFQQRALPAAFHTWNRLWRWRHQENVLSARATRFHRERNKHLRDERDICFQKNKAAKANTA
ASRASWKKRSGSVIGKYVDSRGILRSQSEEEEEVFGIPRRSSLGLSGYPLTEEEPGTGEPGPGGPYPRPLRRIISVEEDPLPQLLDGGFE
QPLSKCSEEEEVSDQGVQGQIPEAPPLKLTPTSPRGQPVGKEALCKEESSPSAPDRLFKIVFVGNSAVGKTSFLRRFCEDRFSPGMAATV
GIDYRVKTLNVDNSQVALQLWDTAGQERYRCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLSSVEEAVGDRVPVLLLGNKLDNEKEREV

>In-frame_SFI1_ENST00000400288_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_605aa
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRYFKDGAVKKPYSAKTLSNKKSSASFGIRRELPSTSHLVQYRGTHTCTRQGRLRELRIRC
VARKFLYLWIRMTFGRVFPSKARFYYEQRLLRKVFEEWKEEWWVFQHEWKLCVRADCHYRYYLYNLMFQTWKTYVRQQQEMRNKYIRAEV
HDAKQKMRQAWKSWLIYVVVRRTKLQMQTTALEFRQRIILRVWWSTWRQRLGQVRVSRALHASALKHRALSLQVQAWSQWREQLLYVQKE
KQKVVSAVKHHQHWQKRRFLKAWLEYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERRESLYAHHAQVEKLARKMALRRAFTHWK
HYMLLCAEEAAQFEMAEEHHRHSQLYFCFRALKDNVTHAHLQQIRRNLAHQQHGVTLLHRFWNLWRSQIEQKKERELLPLLHAAWDHYRI
ALLCKCIELWLQYTQKRRYKQLLQARADGHFQQRALPAAFHTWNRLWRWRHQENVLSARATRFHRERNKHLRDERDICFQKNKAAKANTA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SFI1_ENST00000443326_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2376nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGT
GTTCGAGCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGG
AACAAGTACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGG
ACCAAACTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGA
CAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAA
CAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCC
TGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATAC
TTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTG
CGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCAC
AGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAAGACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAG
CATGGTGTCACGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCAT
GCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTG
CTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAG
GAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAAT
AAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGG
ATTCTTAGGAGCCAGTCAGAGGAGGAGGAGGAGGTGTTTGGCATCCCAAGGAGAAGCTCCCTGGGCCTGAGTGGATATCCCCTAACAGAA
GAGGAGCCAGGAACCGGGGAGCCAGGGCCTGGGGGTCCGTACCCCCGGCCGCTCCGCAGAATCATCTCCGTTGAAGAAGACCCCCTGCCC
CAGCTCCTGGATGGTGGCTTTGAGCAACCCCTGAGCAAATGCTCAGAAGAGGAAGAGGTCTCTGACCAGGGGGTACAGGGACAAATCCCG
GAGGCCCCACCCTTGAAACTCACCCCCACATCCCCCCGAGGGCAGCCTGTTGGAAAAGAAGCCCTGTGTAAGGAGGAAAGCTCTCCCTCT
GCCCCTGACCGGCTCTTCAAGATTGTGTTCGTGGGCAATTCCGCGGTGGGGAAGACATCCTTCCTGAGGAGATTCTGTGAGGACCGGTTC
TCCCCAGGCATGGCGGCCACTGTGGGCATTGATTACCGTGTGAAGACGTTGAATGTGGACAACTCTCAGGTGGCCCTGCAGCTGTGGGAC
ACGGCTGGGCAGGAGAGGTACCGGTGCATCACCCAGCAGTTCTTCAGAAAGGCAGATGGTGTCATCGTCATGTACGATCTCACAGACAAG
CAGTCGTTCCTGTCGGTCCGGCGGTGGCTGAGCAGCGTGGAGGAAGCTGTGGGAGACCGGGTGCCTGTTCTTCTGCTGGGTAATAAGCTT
GACAACGAGAAGGAGCGGGAAGTCCCCCGGGGCCTCGGAGAGCAGCTTGCCACGGAGAACAATCTGATCTTCTATGAATGCAGCGCCTAC
TCTGGTCACAACACCAAAGAGTCCCTGCTCCATCTGGCCAGGTTCCTCAAGGAGCAAGAAGACACAGTGAGAGAGGACACCATTCAGGTC

>In-frame_SFI1_ENST00000443326_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_1569nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGT
GTTCGAGCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGG
AACAAGTACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGG
ACCAAACTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGA
CAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAA
CAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCC
TGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATAC
TTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTG
CGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCAC
AGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAAGACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAG
CATGGTGTCACGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCAT
GCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTG
CTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAG
GAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAAT
AAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGG
ATTCTTAGGAGATGGCCACAGAGAGATAGAGGCATCCCGACTCTTCAGTATCAGACCCAGAGAGACCTTGAAGACTGCAAGCATGAAATG

>In-frame_SFI1_ENST00000414585_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2163nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGT
GTTCGAGCTGACTGTCACTACAGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCT
GCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAGAAACAAAAG
GTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGCAGAGTGAAG
AGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGG
GAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAACACTACATG
CTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAA
GACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTCACGCTGCTGCACAGGTTCTGGAAC
CTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATAGCACTGCTG
TGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCATTTCCAGCAG
AGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCAACACGTTTC
CACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCTGCTTCCAGG
GCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGCCAGTCAGAGGAGGAGGAGGAG
GTGTTTGGCATCCCAAGGAGAAGCTCCCTGGGCCTGAGTGGATATCCCCTAACAGAAGAGGAGCCAGGAACCGGGGAGCCAGGGCCTGGG
GGTCCGTACCCCCGGCCGCTCCGCAGAATCATCTCCGTTGAAGAAGACCCCCTGCCCCAGCTCCTGGATGGTGGCTTTGAGCAACCCCTG
AGCAAATGCTCAGAAGAGGAAGAGGTCTCTGACCAGGGGGTACAGGGACAAATCCCGGAGGCCCCACCCTTGAAACTCACCCCCACATCC
CCCCGAGGGCAGCCTGTTGGAAAAGAAGCCCTGTGTAAGGAGGAAAGCTCTCCCTCTGCCCCTGACCGGCTCTTCAAGATTGTGTTCGTG
GGCAATTCCGCGGTGGGGAAGACATCCTTCCTGAGGAGATTCTGTGAGGACCGGTTCTCCCCAGGCATGGCGGCCACTGTGGGCATTGAT
TACCGTGTGAAGACGTTGAATGTGGACAACTCTCAGGTGGCCCTGCAGCTGTGGGACACGGCTGGGCAGGAGAGGTACCGGTGCATCACC
CAGCAGTTCTTCAGAAAGGCAGATGGTGTCATCGTCATGTACGATCTCACAGACAAGCAGTCGTTCCTGTCGGTCCGGCGGTGGCTGAGC
AGCGTGGAGGAAGCTGTGGGAGACCGGGTGCCTGTTCTTCTGCTGGGTAATAAGCTTGACAACGAGAAGGAGCGGGAAGTCCCCCGGGGC
CTCGGAGAGCAGCTTGCCACGGAGAACAATCTGATCTTCTATGAATGCAGCGCCTACTCTGGTCACAACACCAAAGAGTCCCTGCTCCAT
CTGGCCAGGTTCCTCAAGGAGCAAGAAGACACAGTGAGAGAGGACACCATTCAGGTCGGCCACCCTGCTAAGAAGAAATCCTGCTGTGGC

>In-frame_SFI1_ENST00000414585_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_1356nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGT
GTTCGAGCTGACTGTCACTACAGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCT
GCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAGAAACAAAAG
GTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGCAGAGTGAAG
AGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGG
GAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAACACTACATG
CTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAA
GACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTCACGCTGCTGCACAGGTTCTGGAAC
CTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATAGCACTGCTG
TGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCATTTCCAGCAG
AGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCAACACGTTTC
CACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCTGCTTCCAGG
GCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGATGGCCACAGAGAGATAGAGGC
ATCCCGACTCTTCAGTATCAGACCCAGAGAGACCTTGAAGACTGCAAGCATGAAATGAAAAAGATATGCAAAGCGGAAGTGACTCTGGAG

>In-frame_SFI1_ENST00000540643_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2457nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGGTATTTTAAGGATGGTGCAGTTAAGAAACCTTATTCTGCAAAGACACTGTCCAACAAGAAGTCTTCTGCATCCTTTGGGATCCGGAGG
GAGTTACCTAGTACCAGTCATCTAGTGCAGTATCGTGGCACACATACTTGTACCCGACAGGGCCGGTTAAGAGAACTGCGCATCAGATTT
TACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGA
GCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGGAACAAG
TACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGGACCAAA
CTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTC
CGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTC
CTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTT
GAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGT
GACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGC
GCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAG
CTGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGG
GACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCC
AGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTC
CTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCC
AAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGG
AGCCAGTCAGAGGAGGAGGAGGAGGTGTTTGGCATCCCAAGGAGAAGCTCCCTGGGCCTGAGTGGATATCCCCTAACAGAAGAGGAGCCA
GGAACCGGGGAGCCAGGGCCTGGGGGTCCGTACCCCCGGCCGCTCCGCAGAATCATCTCCGTTGAAGAAGACCCCCTGCCCCAGCTCCTG
GATGGTGGCTTTGAGCAACCCCTGAGCAAATGCTCAGAAGAGGAAGAGGTCTCTGACCAGGGGGTACAGGGACAAATCCCGGAGGCCCCA
CCCTTGAAACTCACCCCCACATCCCCCCGAGGGCAGCCTGTTGGAAAAGAAGCCCTGTGTAAGGAGGAAAGCTCTCCCTCTGCCCCTGAC
CGGCTCTTCAAGATTGTGTTCGTGGGCAATTCCGCGGTGGGGAAGACATCCTTCCTGAGGAGATTCTGTGAGGACCGGTTCTCCCCAGGC
ATGGCGGCCACTGTGGGCATTGATTACCGTGTGAAGACGTTGAATGTGGACAACTCTCAGGTGGCCCTGCAGCTGTGGGACACGGCTGGG
CAGGAGAGGTACCGGTGCATCACCCAGCAGTTCTTCAGAAAGGCAGATGGTGTCATCGTCATGTACGATCTCACAGACAAGCAGTCGTTC
CTGTCGGTCCGGCGGTGGCTGAGCAGCGTGGAGGAAGCTGTGGGAGACCGGGTGCCTGTTCTTCTGCTGGGTAATAAGCTTGACAACGAG
AAGGAGCGGGAAGTCCCCCGGGGCCTCGGAGAGCAGCTTGCCACGGAGAACAATCTGATCTTCTATGAATGCAGCGCCTACTCTGGTCAC
AACACCAAAGAGTCCCTGCTCCATCTGGCCAGGTTCCTCAAGGAGCAAGAAGACACAGTGAGAGAGGACACCATTCAGGTCGGCCACCCT

>In-frame_SFI1_ENST00000540643_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_1650nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGGTATTTTAAGGATGGTGCAGTTAAGAAACCTTATTCTGCAAAGACACTGTCCAACAAGAAGTCTTCTGCATCCTTTGGGATCCGGAGG
GAGTTACCTAGTACCAGTCATCTAGTGCAGTATCGTGGCACACATACTTGTACCCGACAGGGCCGGTTAAGAGAACTGCGCATCAGATTT
TACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGA
GCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGGAACAAG
TACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGGACCAAA
CTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTC
CGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTC
CTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTT
GAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGT
GACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGC
GCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAG
CTGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGG
GACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCC
AGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTC
CTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCC
AAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGG
AGATGGCCACAGAGAGATAGAGGCATCCCGACTCTTCAGTATCAGACCCAGAGAGACCTTGAAGACTGCAAGCATGAAATGAAAAAGATA

>In-frame_SFI1_ENST00000432498_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2529nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGGTATTTTAAGGATGGTGCAGTTAAGAAACCTTATTCTGCAAAGACACTGTCCAACAAGAAGTCTTCTGCATCCTTTGGGATCCGGAGG
GAGTTACCTAGTACCAGTCATCTAGTGCAGTATCGTGGCACACATACTTGTACCCGACAGGGCCGGTTAAGAGAACTGCGCATCAGATGC
GTGGCCAGAAAGTTCTTATATTTATGGATTCGAATGACTTTTGGAAGAGTATTTCCCTCTAAAGCCAGATTTTACTATGAGCAGCGATTA
CTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCTGACTGTCACTACAGG
TATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGGAACAAGTACATTAGAGCCGAGGTT
CATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGGACCAAACTTCAGATGCAGACTACA
GCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTC
CATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAG
AAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGC
AGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGG
GAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAA
CACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGCTGCTGCACAGGTTC
TGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATAGCA
CTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCATTTC
CAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCAACA
CGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCTGCT
TCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGCCAGTCAGAGGAGGAG
GAGGAGGTGTTTGGCATCCCAAGGAGAAGCTCCCTGGGCCTGAGTGGATATCCCCTAACAGAAGAGGAGCCAGGAACCGGGGAGCCAGGG
CCTGGGGGTCCGTACCCCCGGCCGCTCCGCAGAATCATCTCCGTTGAAGAAGACCCCCTGCCCCAGCTCCTGGATGGTGGCTTTGAGCAA
CCCCTGAGCAAATGCTCAGAAGAGGAAGAGGTCTCTGACCAGGGGGTACAGGGACAAATCCCGGAGGCCCCACCCTTGAAACTCACCCCC
ACATCCCCCCGAGGGCAGCCTGTTGGAAAAGAAGCCCTGTGTAAGGAGGAAAGCTCTCCCTCTGCCCCTGACCGGCTCTTCAAGATTGTG
TTCGTGGGCAATTCCGCGGTGGGGAAGACATCCTTCCTGAGGAGATTCTGTGAGGACCGGTTCTCCCCAGGCATGGCGGCCACTGTGGGC
ATTGATTACCGTGTGAAGACGTTGAATGTGGACAACTCTCAGGTGGCCCTGCAGCTGTGGGACACGGCTGGGCAGGAGAGGTACCGGTGC
ATCACCCAGCAGTTCTTCAGAAAGGCAGATGGTGTCATCGTCATGTACGATCTCACAGACAAGCAGTCGTTCCTGTCGGTCCGGCGGTGG
CTGAGCAGCGTGGAGGAAGCTGTGGGAGACCGGGTGCCTGTTCTTCTGCTGGGTAATAAGCTTGACAACGAGAAGGAGCGGGAAGTCCCC
CGGGGCCTCGGAGAGCAGCTTGCCACGGAGAACAATCTGATCTTCTATGAATGCAGCGCCTACTCTGGTCACAACACCAAAGAGTCCCTG
CTCCATCTGGCCAGGTTCCTCAAGGAGCAAGAAGACACAGTGAGAGAGGACACCATTCAGGTCGGCCACCCTGCTAAGAAGAAATCCTGC

>In-frame_SFI1_ENST00000432498_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_1722nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGGTATTTTAAGGATGGTGCAGTTAAGAAACCTTATTCTGCAAAGACACTGTCCAACAAGAAGTCTTCTGCATCCTTTGGGATCCGGAGG
GAGTTACCTAGTACCAGTCATCTAGTGCAGTATCGTGGCACACATACTTGTACCCGACAGGGCCGGTTAAGAGAACTGCGCATCAGATGC
GTGGCCAGAAAGTTCTTATATTTATGGATTCGAATGACTTTTGGAAGAGTATTTCCCTCTAAAGCCAGATTTTACTATGAGCAGCGATTA
CTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCTGACTGTCACTACAGG
TATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGGAACAAGTACATTAGAGCCGAGGTT
CATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGGACCAAACTTCAGATGCAGACTACA
GCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTC
CATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAG
AAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGC
AGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGG
GAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAA
CACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGCTGCTGCACAGGTTC
TGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATAGCA
CTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCATTTC
CAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCAACA
CGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCTGCT
TCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGATGGCCACAGAGAGAT
AGAGGCATCCCGACTCTTCAGTATCAGACCCAGAGAGACCTTGAAGACTGCAAGCATGAAATGAAAAAGATATGCAAAGCGGAAGTGACT

>In-frame_SFI1_ENST00000443011_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2163nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGT
GTTCGAGCTGACTGTCACTACAGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCT
GCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAGAAACAAAAG
GTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGCAGAGTGAAG
AGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGG
GAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAACACTACATG
CTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAA
GACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTCACGCTGCTGCACAGGTTCTGGAAC
CTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATAGCACTGCTG
TGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCATTTCCAGCAG
AGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCAACACGTTTC
CACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCTGCTTCCAGG
GCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGCCAGTCAGAGGAGGAGGAGGAG
GTGTTTGGCATCCCAAGGAGAAGCTCCCTGGGCCTGAGTGGATATCCCCTAACAGAAGAGGAGCCAGGAACCGGGGAGCCAGGGCCTGGG
GGTCCGTACCCCCGGCCGCTCCGCAGAATCATCTCCGTTGAAGAAGACCCCCTGCCCCAGCTCCTGGATGGTGGCTTTGAGCAACCCCTG
AGCAAATGCTCAGAAGAGGAAGAGGTCTCTGACCAGGGGGTACAGGGACAAATCCCGGAGGCCCCACCCTTGAAACTCACCCCCACATCC
CCCCGAGGGCAGCCTGTTGGAAAAGAAGCCCTGTGTAAGGAGGAAAGCTCTCCCTCTGCCCCTGACCGGCTCTTCAAGATTGTGTTCGTG
GGCAATTCCGCGGTGGGGAAGACATCCTTCCTGAGGAGATTCTGTGAGGACCGGTTCTCCCCAGGCATGGCGGCCACTGTGGGCATTGAT
TACCGTGTGAAGACGTTGAATGTGGACAACTCTCAGGTGGCCCTGCAGCTGTGGGACACGGCTGGGCAGGAGAGGTACCGGTGCATCACC
CAGCAGTTCTTCAGAAAGGCAGATGGTGTCATCGTCATGTACGATCTCACAGACAAGCAGTCGTTCCTGTCGGTCCGGCGGTGGCTGAGC
AGCGTGGAGGAAGCTGTGGGAGACCGGGTGCCTGTTCTTCTGCTGGGTAATAAGCTTGACAACGAGAAGGAGCGGGAAGTCCCCCGGGGC
CTCGGAGAGCAGCTTGCCACGGAGAACAATCTGATCTTCTATGAATGCAGCGCCTACTCTGGTCACAACACCAAAGAGTCCCTGCTCCAT
CTGGCCAGGTTCCTCAAGGAGCAAGAAGACACAGTGAGAGAGGACACCATTCAGGTCGGCCACCCTGCTAAGAAGAAATCCTGCTGTGGC

>In-frame_SFI1_ENST00000443011_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_1356nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGT
GTTCGAGCTGACTGTCACTACAGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCT
GCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAGAAACAAAAG
GTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGCAGAGTGAAG
AGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGG
GAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAACACTACATG
CTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAA
GACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTCACGCTGCTGCACAGGTTCTGGAAC
CTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATAGCACTGCTG
TGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCATTTCCAGCAG
AGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCAACACGTTTC
CACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCTGCTTCCAGG
GCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGATGGCCACAGAGAGATAGAGGC
ATCCCGACTCTTCAGTATCAGACCCAGAGAGACCTTGAAGACTGCAAGCATGAAATGAAAAAGATATGCAAAGCGGAAGTGACTCTGGAG

>In-frame_SFI1_ENST00000400289_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2376nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGT
GTTCGAGCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGG
AACAAGTACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGG
ACCAAACTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGA
CAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAA
CAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCC
TGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATAC
TTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTG
CGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCAC
AGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAAGACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAG
CATGGTGTCACGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCAT
GCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTG
CTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAG
GAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAAT
AAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGG
ATTCTTAGGAGCCAGTCAGAGGAGGAGGAGGAGGTGTTTGGCATCCCAAGGAGAAGCTCCCTGGGCCTGAGTGGATATCCCCTAACAGAA
GAGGAGCCAGGAACCGGGGAGCCAGGGCCTGGGGGTCCGTACCCCCGGCCGCTCCGCAGAATCATCTCCGTTGAAGAAGACCCCCTGCCC
CAGCTCCTGGATGGTGGCTTTGAGCAACCCCTGAGCAAATGCTCAGAAGAGGAAGAGGTCTCTGACCAGGGGGTACAGGGACAAATCCCG
GAGGCCCCACCCTTGAAACTCACCCCCACATCCCCCCGAGGGCAGCCTGTTGGAAAAGAAGCCCTGTGTAAGGAGGAAAGCTCTCCCTCT
GCCCCTGACCGGCTCTTCAAGATTGTGTTCGTGGGCAATTCCGCGGTGGGGAAGACATCCTTCCTGAGGAGATTCTGTGAGGACCGGTTC
TCCCCAGGCATGGCGGCCACTGTGGGCATTGATTACCGTGTGAAGACGTTGAATGTGGACAACTCTCAGGTGGCCCTGCAGCTGTGGGAC
ACGGCTGGGCAGGAGAGGTACCGGTGCATCACCCAGCAGTTCTTCAGAAAGGCAGATGGTGTCATCGTCATGTACGATCTCACAGACAAG
CAGTCGTTCCTGTCGGTCCGGCGGTGGCTGAGCAGCGTGGAGGAAGCTGTGGGAGACCGGGTGCCTGTTCTTCTGCTGGGTAATAAGCTT
GACAACGAGAAGGAGCGGGAAGTCCCCCGGGGCCTCGGAGAGCAGCTTGCCACGGAGAACAATCTGATCTTCTATGAATGCAGCGCCTAC
TCTGGTCACAACACCAAAGAGTCCCTGCTCCATCTGGCCAGGTTCCTCAAGGAGCAAGAAGACACAGTGAGAGAGGACACCATTCAGGTC

>In-frame_SFI1_ENST00000400289_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_1569nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGT
GTTCGAGCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGG
AACAAGTACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGG
ACCAAACTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGA
CAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAA
CAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCC
TGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATAC
TTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTG
CGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCAC
AGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAAGACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAG
CATGGTGTCACGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCAT
GCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTG
CTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAG
GAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAAT
AAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGG
ATTCTTAGGAGATGGCCACAGAGAGATAGAGGCATCCCGACTCTTCAGTATCAGACCCAGAGAGACCTTGAAGACTGCAAGCATGAAATG

>In-frame_SFI1_ENST00000400288_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2622nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGGTATTTTAAGGATGGTGCAGTTAAGAAACCTTATTCTGCAAAGACACTGTCCAACAAGAAGTCTTCTGCATCCTTTGGGATCCGGAGG
GAGTTACCTAGTACCAGTCATCTAGTGCAGTATCGTGGCACACATACTTGTACCCGACAGGGCCGGTTAAGAGAACTGCGCATCAGATGC
GTGGCCAGAAAGTTCTTATATTTATGGATTCGAATGACTTTTGGAAGAGTATTTCCCTCTAAAGCCAGATTTTACTATGAGCAGCGATTA
CTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCTGACTGTCACTACAGG
TATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGGAACAAGTACATTAGAGCCGAGGTT
CATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGGACCAAACTTCAGATGCAGACTACA
GCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTC
CATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAG
AAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGC
AGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGG
GAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAA
CACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGTATTTTTGCTTTAGA
GCCCTAAAAGACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTCACGCTGCTGCACAGG
TTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATA
GCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCAT
TTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCA
ACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCT
GCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGCCAGTCAGAGGAG
GAGGAGGAGGTGTTTGGCATCCCAAGGAGAAGCTCCCTGGGCCTGAGTGGATATCCCCTAACAGAAGAGGAGCCAGGAACCGGGGAGCCA
GGGCCTGGGGGTCCGTACCCCCGGCCGCTCCGCAGAATCATCTCCGTTGAAGAAGACCCCCTGCCCCAGCTCCTGGATGGTGGCTTTGAG
CAACCCCTGAGCAAATGCTCAGAAGAGGAAGAGGTCTCTGACCAGGGGGTACAGGGACAAATCCCGGAGGCCCCACCCTTGAAACTCACC
CCCACATCCCCCCGAGGGCAGCCTGTTGGAAAAGAAGCCCTGTGTAAGGAGGAAAGCTCTCCCTCTGCCCCTGACCGGCTCTTCAAGATT
GTGTTCGTGGGCAATTCCGCGGTGGGGAAGACATCCTTCCTGAGGAGATTCTGTGAGGACCGGTTCTCCCCAGGCATGGCGGCCACTGTG
GGCATTGATTACCGTGTGAAGACGTTGAATGTGGACAACTCTCAGGTGGCCCTGCAGCTGTGGGACACGGCTGGGCAGGAGAGGTACCGG
TGCATCACCCAGCAGTTCTTCAGAAAGGCAGATGGTGTCATCGTCATGTACGATCTCACAGACAAGCAGTCGTTCCTGTCGGTCCGGCGG
TGGCTGAGCAGCGTGGAGGAAGCTGTGGGAGACCGGGTGCCTGTTCTTCTGCTGGGTAATAAGCTTGACAACGAGAAGGAGCGGGAAGTC
CCCCGGGGCCTCGGAGAGCAGCTTGCCACGGAGAACAATCTGATCTTCTATGAATGCAGCGCCTACTCTGGTCACAACACCAAAGAGTCC
CTGCTCCATCTGGCCAGGTTCCTCAAGGAGCAAGAAGACACAGTGAGAGAGGACACCATTCAGGTCGGCCACCCTGCTAAGAAGAAATCC

>In-frame_SFI1_ENST00000400288_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_1815nt
ATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCC
AGGTATTTTAAGGATGGTGCAGTTAAGAAACCTTATTCTGCAAAGACACTGTCCAACAAGAAGTCTTCTGCATCCTTTGGGATCCGGAGG
GAGTTACCTAGTACCAGTCATCTAGTGCAGTATCGTGGCACACATACTTGTACCCGACAGGGCCGGTTAAGAGAACTGCGCATCAGATGC
GTGGCCAGAAAGTTCTTATATTTATGGATTCGAATGACTTTTGGAAGAGTATTTCCCTCTAAAGCCAGATTTTACTATGAGCAGCGATTA
CTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCTGACTGTCACTACAGG
TATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGGAACAAGTACATTAGAGCCGAGGTT
CATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGGACCAAACTTCAGATGCAGACTACA
GCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTC
CATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAG
AAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGC
AGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGG
GAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAA
CACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGTATTTTTGCTTTAGA
GCCCTAAAAGACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTCACGCTGCTGCACAGG
TTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATA
GCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCAT
TTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCA
ACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCT
GCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGATGGCCACAGAGA
GATAGAGGCATCCCGACTCTTCAGTATCAGACCCAGAGAGACCTTGAAGACTGCAAGCATGAAATGAAAAAGATATGCAAAGCGGAAGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SFI1_ENST00000443326_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2796nt
AGCAAGCTGAGCTCAGAGCGAAGCTGGCGAGCCAAGGAGATAAAGAACCCTCGGTGGGGATGCCCAGAGGGTGCATGCTCCACGCCCCTC
GAAACCGATTCTCATTGCTGCTGCTGCAAAGCAACCCGAAGTGCGCCACCTACCCGACTGAGGCTGCGCAAGCCCCGGGGTCTGGGCGGG
GTGGTCCTCGTGCGCGCCGCGTCGCCGTGGAGACGAGGGCGGGCCCGCGCGAGACTGGCGTCTAGAGGCGCGCGAAGCGCTGAGGCGGGC
GTGGACCGCGCGGGAGTTAAGAAGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCGGCTTCCC
CAGTTAGAAGGGGAAGATAAAAGACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTG
ATTAAGCAGAGAATGGAGAAGAAGGTTGATTCCAGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAG
TGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGG
AAGACCTATGTGCGTCAGCAGCAGGAGATGAGGAACAAGTACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGG
AAGTCCTGGTTGATCTACGTGGTTGTTCGTAGGACCAAACTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGG
GTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGC
CTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCAT
CAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAG
CGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCC
CAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCC
CAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAAGACAATGTGACCCACGCTCATCTC
CAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTCACGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAG
AAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTA
CAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCAC
ACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTT
CGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGC
TCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGCCAGTCAGAGGAGGAGGAGGAGGTGTTTGGCATCCCAAGGAGAAGC
TCCCTGGGCCTGAGTGGATATCCCCTAACAGAAGAGGAGCCAGGAACCGGGGAGCCAGGGCCTGGGGGTCCGTACCCCCGGCCGCTCCGC
AGAATCATCTCCGTTGAAGAAGACCCCCTGCCCCAGCTCCTGGATGGTGGCTTTGAGCAACCCCTGAGCAAATGCTCAGAAGAGGAAGAG
GTCTCTGACCAGGGGGTACAGGGACAAATCCCGGAGGCCCCACCCTTGAAACTCACCCCCACATCCCCCCGAGGGCAGCCTGTTGGAAAA
GAAGCCCTGTGTAAGGAGGAAAGCTCTCCCTCTGCCCCTGACCGGCTCTTCAAGATTGTGTTCGTGGGCAATTCCGCGGTGGGGAAGACA
TCCTTCCTGAGGAGATTCTGTGAGGACCGGTTCTCCCCAGGCATGGCGGCCACTGTGGGCATTGATTACCGTGTGAAGACGTTGAATGTG
GACAACTCTCAGGTGGCCCTGCAGCTGTGGGACACGGCTGGGCAGGAGAGGTACCGGTGCATCACCCAGCAGTTCTTCAGAAAGGCAGAT
GGTGTCATCGTCATGTACGATCTCACAGACAAGCAGTCGTTCCTGTCGGTCCGGCGGTGGCTGAGCAGCGTGGAGGAAGCTGTGGGAGAC
CGGGTGCCTGTTCTTCTGCTGGGTAATAAGCTTGACAACGAGAAGGAGCGGGAAGTCCCCCGGGGCCTCGGAGAGCAGCTTGCCACGGAG
AACAATCTGATCTTCTATGAATGCAGCGCCTACTCTGGTCACAACACCAAAGAGTCCCTGCTCCATCTGGCCAGGTTCCTCAAGGAGCAA
GAAGACACAGTGAGAGAGGACACCATTCAGGTCGGCCACCCTGCTAAGAAGAAATCCTGCTGTGGCTGATAGGGTCCTACAAGGACTGCC

>In-frame_SFI1_ENST00000443326_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_2229nt
AGCAAGCTGAGCTCAGAGCGAAGCTGGCGAGCCAAGGAGATAAAGAACCCTCGGTGGGGATGCCCAGAGGGTGCATGCTCCACGCCCCTC
GAAACCGATTCTCATTGCTGCTGCTGCAAAGCAACCCGAAGTGCGCCACCTACCCGACTGAGGCTGCGCAAGCCCCGGGGTCTGGGCGGG
GTGGTCCTCGTGCGCGCCGCGTCGCCGTGGAGACGAGGGCGGGCCCGCGCGAGACTGGCGTCTAGAGGCGCGCGAAGCGCTGAGGCGGGC
GTGGACCGCGCGGGAGTTAAGAAGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCGGCTTCCC
CAGTTAGAAGGGGAAGATAAAAGACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTG
ATTAAGCAGAGAATGGAGAAGAAGGTTGATTCCAGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAG
TGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGG
AAGACCTATGTGCGTCAGCAGCAGGAGATGAGGAACAAGTACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGG
AAGTCCTGGTTGATCTACGTGGTTGTTCGTAGGACCAAACTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGG
GTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGC
CTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCAT
CAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAG
CGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCC
CAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCC
CAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAAGACAATGTGACCCACGCTCATCTC
CAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTCACGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAG
AAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTA
CAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCAC
ACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTT
CGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGC
TCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGATGGCCACAGAGAGATAGAGGCATCCCGACTCTTCAGTATCAGACC
CAGAGAGACCTTGAAGACTGCAAGCATGAAATGAAAAAGATATGCAAAGCGGAAGTGACTCTGGAGATGTAAATCAGCTCATCAGTAAAA
CCTTTGGGCCTGATCATCATGAATTCTTGTTCTAAATAGCTGAATAATGAGATACAATTTGGGAGCCAAATCTCTGCAATAGTGGTTGGC
CTGTTGGTTCCTCAGAATGGAATGGATTGATTGATTGATTCAGCAGACGTTTACTGATTACCTACTGTGTACCAGACATTCTTTTGAGTT

>In-frame_SFI1_ENST00000414585_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2583nt
AGCAAGCTGAGCTCAGAGCGAAGCTGGCGAGCCAAGGAGATAAAGAACCCTCGGTGGGGATGCCCAGAGGGTGCATGCTCCACGCCCCTC
GAAACCGATTCTCATTGCTGCTGCTGCAAAGCAACCCGAAGTGCGCCACCTACCCGACTGAGGCTGCGCAAGCCCCGGGGTCTGGGCGGG
GTGGTCCTCGTGCGCGCCGCGTCGCCGTGGAGACGAGGGCGGGCCCGCGCGAGACTGGCGTCTAGAGGCGCGCGAAGCGCTGAGGCGGGC
GTGGACCGCGCGGGAGTTAAGAAGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCGGCTTCCC
CAGTTAGAAGGGGAAGATAAAAGACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTG
ATTAAGCAGAGAATGGAGAAGAAGGTTGATTCCAGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAG
TGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCTGACTGTCACTACAGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGA
CAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAA
CAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCC
TGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATAC
TTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTG
CGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCAC
AGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAAGACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAG
CATGGTGTCACGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCAT
GCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTG
CTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAG
GAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAAT
AAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGG
ATTCTTAGGAGCCAGTCAGAGGAGGAGGAGGAGGTGTTTGGCATCCCAAGGAGAAGCTCCCTGGGCCTGAGTGGATATCCCCTAACAGAA
GAGGAGCCAGGAACCGGGGAGCCAGGGCCTGGGGGTCCGTACCCCCGGCCGCTCCGCAGAATCATCTCCGTTGAAGAAGACCCCCTGCCC
CAGCTCCTGGATGGTGGCTTTGAGCAACCCCTGAGCAAATGCTCAGAAGAGGAAGAGGTCTCTGACCAGGGGGTACAGGGACAAATCCCG
GAGGCCCCACCCTTGAAACTCACCCCCACATCCCCCCGAGGGCAGCCTGTTGGAAAAGAAGCCCTGTGTAAGGAGGAAAGCTCTCCCTCT
GCCCCTGACCGGCTCTTCAAGATTGTGTTCGTGGGCAATTCCGCGGTGGGGAAGACATCCTTCCTGAGGAGATTCTGTGAGGACCGGTTC
TCCCCAGGCATGGCGGCCACTGTGGGCATTGATTACCGTGTGAAGACGTTGAATGTGGACAACTCTCAGGTGGCCCTGCAGCTGTGGGAC
ACGGCTGGGCAGGAGAGGTACCGGTGCATCACCCAGCAGTTCTTCAGAAAGGCAGATGGTGTCATCGTCATGTACGATCTCACAGACAAG
CAGTCGTTCCTGTCGGTCCGGCGGTGGCTGAGCAGCGTGGAGGAAGCTGTGGGAGACCGGGTGCCTGTTCTTCTGCTGGGTAATAAGCTT
GACAACGAGAAGGAGCGGGAAGTCCCCCGGGGCCTCGGAGAGCAGCTTGCCACGGAGAACAATCTGATCTTCTATGAATGCAGCGCCTAC
TCTGGTCACAACACCAAAGAGTCCCTGCTCCATCTGGCCAGGTTCCTCAAGGAGCAAGAAGACACAGTGAGAGAGGACACCATTCAGGTC

>In-frame_SFI1_ENST00000414585_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_2016nt
AGCAAGCTGAGCTCAGAGCGAAGCTGGCGAGCCAAGGAGATAAAGAACCCTCGGTGGGGATGCCCAGAGGGTGCATGCTCCACGCCCCTC
GAAACCGATTCTCATTGCTGCTGCTGCAAAGCAACCCGAAGTGCGCCACCTACCCGACTGAGGCTGCGCAAGCCCCGGGGTCTGGGCGGG
GTGGTCCTCGTGCGCGCCGCGTCGCCGTGGAGACGAGGGCGGGCCCGCGCGAGACTGGCGTCTAGAGGCGCGCGAAGCGCTGAGGCGGGC
GTGGACCGCGCGGGAGTTAAGAAGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCGGCTTCCC
CAGTTAGAAGGGGAAGATAAAAGACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTG
ATTAAGCAGAGAATGGAGAAGAAGGTTGATTCCAGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAG
TGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCTGACTGTCACTACAGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGA
CAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAA
CAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCC
TGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATAC
TTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTG
CGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCAC
AGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAAGACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAG
CATGGTGTCACGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCAT
GCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTG
CTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAG
GAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAAT
AAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGG
ATTCTTAGGAGATGGCCACAGAGAGATAGAGGCATCCCGACTCTTCAGTATCAGACCCAGAGAGACCTTGAAGACTGCAAGCATGAAATG
AAAAAGATATGCAAAGCGGAAGTGACTCTGGAGATGTAAATCAGCTCATCAGTAAAACCTTTGGGCCTGATCATCATGAATTCTTGTTCT
AAATAGCTGAATAATGAGATACAATTTGGGAGCCAAATCTCTGCAATAGTGGTTGGCCTGTTGGTTCCTCAGAATGGAATGGATTGATTG
ATTGATTCAGCAGACGTTTACTGATTACCTACTGTGTACCAGACATTCTTTTGAGTTCTGTAAAGCCTCCAAAAATAAATTAGACATGAG

>In-frame_SFI1_ENST00000540643_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2877nt
AGCAAGCTGAGCTCAGAGCGAAGCTGGCGAGCCAAGGAGATAAAGAACCCTCGGTGGGGATGCCCAGAGGGTGCATGCTCCACGCCCCTC
GAAACCGATTCTCATTGCTGCTGCTGCAAAGCAACCCGAAGTGCGCCACCTACCCGACTGAGGCTGCGCAAGCCCCGGGGTCTGGGCGGG
GTGGTCCTCGTGCGCGCCGCGTCGCCGTGGAGACGAGGGCGGGCCCGCGCGAGACTGGCGTCTAGAGGCGCGCGAAGCGCTGAGGCGGGC
GTGGACCGCGCGGGAGTTAAGAAGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCGGCTTCCC
CAGTTAGAAGGGGAAGATAAAAGACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTG
ATTAAGCAGAGAATGGAGAAGAAGGTTGATTCCAGGTATTTTAAGGATGGTGCAGTTAAGAAACCTTATTCTGCAAAGACACTGTCCAAC
AAGAAGTCTTCTGCATCCTTTGGGATCCGGAGGGAGTTACCTAGTACCAGTCATCTAGTGCAGTATCGTGGCACACATACTTGTACCCGA
CAGGGCCGGTTAAGAGAACTGCGCATCAGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGG
GTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACC
TATGTGCGTCAGCAGCAGGAGATGAGGAACAAGTACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCC
TGGTTGATCTACGTGGTTGTTCGTAGGACCAAACTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGG
TGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAG
GTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCAC
TGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTC
CATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTG
GAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTT
GAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAA
AGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACT
CAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAAC
AGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAA
CGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATA
GGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGCCAGTCAGAGGAGGAGGAGGAGGTGTTTGGCATCCCAAGGAGAAGCTCCCTGGGC
CTGAGTGGATATCCCCTAACAGAAGAGGAGCCAGGAACCGGGGAGCCAGGGCCTGGGGGTCCGTACCCCCGGCCGCTCCGCAGAATCATC
TCCGTTGAAGAAGACCCCCTGCCCCAGCTCCTGGATGGTGGCTTTGAGCAACCCCTGAGCAAATGCTCAGAAGAGGAAGAGGTCTCTGAC
CAGGGGGTACAGGGACAAATCCCGGAGGCCCCACCCTTGAAACTCACCCCCACATCCCCCCGAGGGCAGCCTGTTGGAAAAGAAGCCCTG
TGTAAGGAGGAAAGCTCTCCCTCTGCCCCTGACCGGCTCTTCAAGATTGTGTTCGTGGGCAATTCCGCGGTGGGGAAGACATCCTTCCTG
AGGAGATTCTGTGAGGACCGGTTCTCCCCAGGCATGGCGGCCACTGTGGGCATTGATTACCGTGTGAAGACGTTGAATGTGGACAACTCT
CAGGTGGCCCTGCAGCTGTGGGACACGGCTGGGCAGGAGAGGTACCGGTGCATCACCCAGCAGTTCTTCAGAAAGGCAGATGGTGTCATC
GTCATGTACGATCTCACAGACAAGCAGTCGTTCCTGTCGGTCCGGCGGTGGCTGAGCAGCGTGGAGGAAGCTGTGGGAGACCGGGTGCCT
GTTCTTCTGCTGGGTAATAAGCTTGACAACGAGAAGGAGCGGGAAGTCCCCCGGGGCCTCGGAGAGCAGCTTGCCACGGAGAACAATCTG
ATCTTCTATGAATGCAGCGCCTACTCTGGTCACAACACCAAAGAGTCCCTGCTCCATCTGGCCAGGTTCCTCAAGGAGCAAGAAGACACA

>In-frame_SFI1_ENST00000540643_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_2310nt
AGCAAGCTGAGCTCAGAGCGAAGCTGGCGAGCCAAGGAGATAAAGAACCCTCGGTGGGGATGCCCAGAGGGTGCATGCTCCACGCCCCTC
GAAACCGATTCTCATTGCTGCTGCTGCAAAGCAACCCGAAGTGCGCCACCTACCCGACTGAGGCTGCGCAAGCCCCGGGGTCTGGGCGGG
GTGGTCCTCGTGCGCGCCGCGTCGCCGTGGAGACGAGGGCGGGCCCGCGCGAGACTGGCGTCTAGAGGCGCGCGAAGCGCTGAGGCGGGC
GTGGACCGCGCGGGAGTTAAGAAGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCGGCTTCCC
CAGTTAGAAGGGGAAGATAAAAGACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTG
ATTAAGCAGAGAATGGAGAAGAAGGTTGATTCCAGGTATTTTAAGGATGGTGCAGTTAAGAAACCTTATTCTGCAAAGACACTGTCCAAC
AAGAAGTCTTCTGCATCCTTTGGGATCCGGAGGGAGTTACCTAGTACCAGTCATCTAGTGCAGTATCGTGGCACACATACTTGTACCCGA
CAGGGCCGGTTAAGAGAACTGCGCATCAGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGG
GTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACC
TATGTGCGTCAGCAGCAGGAGATGAGGAACAAGTACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCC
TGGTTGATCTACGTGGTTGTTCGTAGGACCAAACTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGG
TGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAG
GTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCAC
TGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTC
CATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTG
GAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTT
GAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAA
AGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACT
CAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAAC
AGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAA
CGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATA
GGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGATGGCCACAGAGAGATAGAGGCATCCCGACTCTTCAGTATCAGACCCAGAGAGAC
CTTGAAGACTGCAAGCATGAAATGAAAAAGATATGCAAAGCGGAAGTGACTCTGGAGATGTAAATCAGCTCATCAGTAAAACCTTTGGGC
CTGATCATCATGAATTCTTGTTCTAAATAGCTGAATAATGAGATACAATTTGGGAGCCAAATCTCTGCAATAGTGGTTGGCCTGTTGGTT
CCTCAGAATGGAATGGATTGATTGATTGATTCAGCAGACGTTTACTGATTACCTACTGTGTACCAGACATTCTTTTGAGTTCTGTAAAGC

>In-frame_SFI1_ENST00000432498_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2949nt
AGCAAGCTGAGCTCAGAGCGAAGCTGGCGAGCCAAGGAGATAAAGAACCCTCGGTGGGGATGCCCAGAGGGTGCATGCTCCACGCCCCTC
GAAACCGATTCTCATTGCTGCTGCTGCAAAGCAACCCGAAGTGCGCCACCTACCCGACTGAGGCTGCGCAAGCCCCGGGGTCTGGGCGGG
GTGGTCCTCGTGCGCGCCGCGTCGCCGTGGAGACGAGGGCGGGCCCGCGCGAGACTGGCGTCTAGAGGCGCGCGAAGCGCTGAGGCGGGC
GTGGACCGCGCGGGAGTTAAGAAGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCGGCTTCCC
CAGTTAGAAGGGGAAGATAAAAGACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTG
ATTAAGCAGAGAATGGAGAAGAAGGTTGATTCCAGGTATTTTAAGGATGGTGCAGTTAAGAAACCTTATTCTGCAAAGACACTGTCCAAC
AAGAAGTCTTCTGCATCCTTTGGGATCCGGAGGGAGTTACCTAGTACCAGTCATCTAGTGCAGTATCGTGGCACACATACTTGTACCCGA
CAGGGCCGGTTAAGAGAACTGCGCATCAGATGCGTGGCCAGAAAGTTCTTATATTTATGGATTCGAATGACTTTTGGAAGAGTATTTCCC
TCTAAAGCCAGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGG
AAACTCTGTGTTCGAGCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAG
GAGATGAGGAACAAGTACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTT
GTTCGTAGGACCAAACTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAG
CGACTAGGACAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAG
TGGCGGGAACAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTT
CTAAAGGCCTGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTC
CAGATATACTTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAG
ATGGCCCTGCGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCAC
CACAGGCACAGCCAGCTGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTA
CTGCATGCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAG
CAGCTGCTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGC
CACCAGGAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAG
AAAAATAAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGC
AGAGGGATTCTTAGGAGCCAGTCAGAGGAGGAGGAGGAGGTGTTTGGCATCCCAAGGAGAAGCTCCCTGGGCCTGAGTGGATATCCCCTA
ACAGAAGAGGAGCCAGGAACCGGGGAGCCAGGGCCTGGGGGTCCGTACCCCCGGCCGCTCCGCAGAATCATCTCCGTTGAAGAAGACCCC
CTGCCCCAGCTCCTGGATGGTGGCTTTGAGCAACCCCTGAGCAAATGCTCAGAAGAGGAAGAGGTCTCTGACCAGGGGGTACAGGGACAA
ATCCCGGAGGCCCCACCCTTGAAACTCACCCCCACATCCCCCCGAGGGCAGCCTGTTGGAAAAGAAGCCCTGTGTAAGGAGGAAAGCTCT
CCCTCTGCCCCTGACCGGCTCTTCAAGATTGTGTTCGTGGGCAATTCCGCGGTGGGGAAGACATCCTTCCTGAGGAGATTCTGTGAGGAC
CGGTTCTCCCCAGGCATGGCGGCCACTGTGGGCATTGATTACCGTGTGAAGACGTTGAATGTGGACAACTCTCAGGTGGCCCTGCAGCTG
TGGGACACGGCTGGGCAGGAGAGGTACCGGTGCATCACCCAGCAGTTCTTCAGAAAGGCAGATGGTGTCATCGTCATGTACGATCTCACA
GACAAGCAGTCGTTCCTGTCGGTCCGGCGGTGGCTGAGCAGCGTGGAGGAAGCTGTGGGAGACCGGGTGCCTGTTCTTCTGCTGGGTAAT
AAGCTTGACAACGAGAAGGAGCGGGAAGTCCCCCGGGGCCTCGGAGAGCAGCTTGCCACGGAGAACAATCTGATCTTCTATGAATGCAGC
GCCTACTCTGGTCACAACACCAAAGAGTCCCTGCTCCATCTGGCCAGGTTCCTCAAGGAGCAAGAAGACACAGTGAGAGAGGACACCATT

>In-frame_SFI1_ENST00000432498_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_2382nt
AGCAAGCTGAGCTCAGAGCGAAGCTGGCGAGCCAAGGAGATAAAGAACCCTCGGTGGGGATGCCCAGAGGGTGCATGCTCCACGCCCCTC
GAAACCGATTCTCATTGCTGCTGCTGCAAAGCAACCCGAAGTGCGCCACCTACCCGACTGAGGCTGCGCAAGCCCCGGGGTCTGGGCGGG
GTGGTCCTCGTGCGCGCCGCGTCGCCGTGGAGACGAGGGCGGGCCCGCGCGAGACTGGCGTCTAGAGGCGCGCGAAGCGCTGAGGCGGGC
GTGGACCGCGCGGGAGTTAAGAAGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCGGCTTCCC
CAGTTAGAAGGGGAAGATAAAAGACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTG
ATTAAGCAGAGAATGGAGAAGAAGGTTGATTCCAGGTATTTTAAGGATGGTGCAGTTAAGAAACCTTATTCTGCAAAGACACTGTCCAAC
AAGAAGTCTTCTGCATCCTTTGGGATCCGGAGGGAGTTACCTAGTACCAGTCATCTAGTGCAGTATCGTGGCACACATACTTGTACCCGA
CAGGGCCGGTTAAGAGAACTGCGCATCAGATGCGTGGCCAGAAAGTTCTTATATTTATGGATTCGAATGACTTTTGGAAGAGTATTTCCC
TCTAAAGCCAGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGG
AAACTCTGTGTTCGAGCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAG
GAGATGAGGAACAAGTACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTT
GTTCGTAGGACCAAACTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAG
CGACTAGGACAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAG
TGGCGGGAACAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTT
CTAAAGGCCTGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTC
CAGATATACTTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAG
ATGGCCCTGCGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCAC
CACAGGCACAGCCAGCTGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTA
CTGCATGCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAG
CAGCTGCTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGC
CACCAGGAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAG
AAAAATAAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGC
AGAGGGATTCTTAGGAGATGGCCACAGAGAGATAGAGGCATCCCGACTCTTCAGTATCAGACCCAGAGAGACCTTGAAGACTGCAAGCAT
GAAATGAAAAAGATATGCAAAGCGGAAGTGACTCTGGAGATGTAAATCAGCTCATCAGTAAAACCTTTGGGCCTGATCATCATGAATTCT
TGTTCTAAATAGCTGAATAATGAGATACAATTTGGGAGCCAAATCTCTGCAATAGTGGTTGGCCTGTTGGTTCCTCAGAATGGAATGGAT
TGATTGATTGATTCAGCAGACGTTTACTGATTACCTACTGTGTACCAGACATTCTTTTGAGTTCTGTAAAGCCTCCAAAAATAAATTAGA

>In-frame_SFI1_ENST00000443011_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2471nt
GCTGCAAAGCAACCCGAAGTGCGCCACCTACCCGACTGAGGCTGCGCAAGCCCCGGGGTCTGGGCGGGGTGGTCCTCGTGCGCGCCGCGT
CGCCGTGGAGACGAGGGCGGGCCCGCGCGAGACTGGCGTCTAGAGGCGCGCGAAGCGCTGAGGCGGGCGTGGACCGCGCGGGAGTTAAGA
AGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCGGCTTCCCCAGTTAGAAGGGGAAGATAAAA
GACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGA
AGGTTGATTCCAGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGT
GGAAACTCTGTGTTCGAGCTGACTGTCACTACAGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCC
TCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGG
AGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCC
GCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCT
GGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGA
AACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGTATTTTTGCTTTA
GAGCCCTAAAAGACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTCACGCTGCTGCACA
GGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAA
TAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTC
ATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAG
CAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAG
CTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGCCAGTCAGAGG
AGGAGGAGGAGGTGTTTGGCATCCCAAGGAGAAGCTCCCTGGGCCTGAGTGGATATCCCCTAACAGAAGAGGAGCCAGGAACCGGGGAGC
CAGGGCCTGGGGGTCCGTACCCCCGGCCGCTCCGCAGAATCATCTCCGTTGAAGAAGACCCCCTGCCCCAGCTCCTGGATGGTGGCTTTG
AGCAACCCCTGAGCAAATGCTCAGAAGAGGAAGAGGTCTCTGACCAGGGGGTACAGGGACAAATCCCGGAGGCCCCACCCTTGAAACTCA
CCCCCACATCCCCCCGAGGGCAGCCTGTTGGAAAAGAAGCCCTGTGTAAGGAGGAAAGCTCTCCCTCTGCCCCTGACCGGCTCTTCAAGA
TTGTGTTCGTGGGCAATTCCGCGGTGGGGAAGACATCCTTCCTGAGGAGATTCTGTGAGGACCGGTTCTCCCCAGGCATGGCGGCCACTG
TGGGCATTGATTACCGTGTGAAGACGTTGAATGTGGACAACTCTCAGGTGGCCCTGCAGCTGTGGGACACGGCTGGGCAGGAGAGGTACC
GGTGCATCACCCAGCAGTTCTTCAGAAAGGCAGATGGTGTCATCGTCATGTACGATCTCACAGACAAGCAGTCGTTCCTGTCGGTCCGGC
GGTGGCTGAGCAGCGTGGAGGAAGCTGTGGGAGACCGGGTGCCTGTTCTTCTGCTGGGTAATAAGCTTGACAACGAGAAGGAGCGGGAAG
TCCCCCGGGGCCTCGGAGAGCAGCTTGCCACGGAGAACAATCTGATCTTCTATGAATGCAGCGCCTACTCTGGTCACAACACCAAAGAGT
CCCTGCTCCATCTGGCCAGGTTCCTCAAGGAGCAAGAAGACACAGTGAGAGAGGACACCATTCAGGTCGGCCACCCTGCTAAGAAGAAAT

>In-frame_SFI1_ENST00000443011_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_1904nt
GCTGCAAAGCAACCCGAAGTGCGCCACCTACCCGACTGAGGCTGCGCAAGCCCCGGGGTCTGGGCGGGGTGGTCCTCGTGCGCGCCGCGT
CGCCGTGGAGACGAGGGCGGGCCCGCGCGAGACTGGCGTCTAGAGGCGCGCGAAGCGCTGAGGCGGGCGTGGACCGCGCGGGAGTTAAGA
AGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCGGCTTCCCCAGTTAGAAGGGGAAGATAAAA
GACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAGAAGA
AGGTTGATTCCAGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGT
GGAAACTCTGTGTTCGAGCTGACTGTCACTACAGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCC
TCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGG
AGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCC
GCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCT
GGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGA
AACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGTATTTTTGCTTTA
GAGCCCTAAAAGACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTCACGCTGCTGCACA
GGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAA
TAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTC
ATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAG
CAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAG
CTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGATGGCCACAGA
GAGATAGAGGCATCCCGACTCTTCAGTATCAGACCCAGAGAGACCTTGAAGACTGCAAGCATGAAATGAAAAAGATATGCAAAGCGGAAG
TGACTCTGGAGATGTAAATCAGCTCATCAGTAAAACCTTTGGGCCTGATCATCATGAATTCTTGTTCTAAATAGCTGAATAATGAGATAC
AATTTGGGAGCCAAATCTCTGCAATAGTGGTTGGCCTGTTGGTTCCTCAGAATGGAATGGATTGATTGATTGATTCAGCAGACGTTTACT
GATTACCTACTGTGTACCAGACATTCTTTTGAGTTCTGTAAAGCCTCCAAAAATAAATTAGACATGAGGTCCTACCATTAATCTCCATTA

>In-frame_SFI1_ENST00000400289_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2529nt
GGCGGGCGTGGACCGCGCGGGAGTTAAGAAGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCG
GCTTCCCCAGAAGGGGAAGATAAAAGACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAA
GTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCCAGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAG
GAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACG
TGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGGAACAAGTACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCC
TGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGGACCAAACTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTA
CGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTG
AGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACAT
CATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCT
GAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCAT
GCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCT
GCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAAGACAATGTGACCCACGCTCAT
CTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTCACGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAG
CAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGG
CTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTC
CACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCAC
CTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCT
GGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGCCAGTCAGAGGAGGAGGAGGAGGTGTTTGGCATCCCAAGGAGA
AGCTCCCTGGGCCTGAGTGGATATCCCCTAACAGAAGAGGAGCCAGGAACCGGGGAGCCAGGGCCTGGGGGTCCGTACCCCCGGCCGCTC
CGCAGAATCATCTCCGTTGAAGAAGACCCCCTGCCCCAGCTCCTGGATGGTGGCTTTGAGCAACCCCTGAGCAAATGCTCAGAAGAGGAA
GAGGTCTCTGACCAGGGGGTACAGGGACAAATCCCGGAGGCCCCACCCTTGAAACTCACCCCCACATCCCCCCGAGGGCAGCCTGTTGGA
AAAGAAGCCCTGTGTAAGGAGGAAAGCTCTCCCTCTGCCCCTGACCGGCTCTTCAAGATTGTGTTCGTGGGCAATTCCGCGGTGGGGAAG
ACATCCTTCCTGAGGAGATTCTGTGAGGACCGGTTCTCCCCAGGCATGGCGGCCACTGTGGGCATTGATTACCGTGTGAAGACGTTGAAT
GTGGACAACTCTCAGGTGGCCCTGCAGCTGTGGGACACGGCTGGGCAGGAGAGGTACCGGTGCATCACCCAGCAGTTCTTCAGAAAGGCA
GATGGTGTCATCGTCATGTACGATCTCACAGACAAGCAGTCGTTCCTGTCGGTCCGGCGGTGGCTGAGCAGCGTGGAGGAAGCTGTGGGA
GACCGGGTGCCTGTTCTTCTGCTGGGTAATAAGCTTGACAACGAGAAGGAGCGGGAAGTCCCCCGGGGCCTCGGAGAGCAGCTTGCCACG
GAGAACAATCTGATCTTCTATGAATGCAGCGCCTACTCTGGTCACAACACCAAAGAGTCCCTGCTCCATCTGGCCAGGTTCCTCAAGGAG
CAAGAAGACACAGTGAGAGAGGACACCATTCAGGTCGGCCACCCTGCTAAGAAGAAATCCTGCTGTGGCTGATAGGGTCCTACAAGGACT

>In-frame_SFI1_ENST00000400289_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_1962nt
GGCGGGCGTGGACCGCGCGGGAGTTAAGAAGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCG
GCTTCCCCAGAAGGGGAAGATAAAAGACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAA
GTGATTAAGCAGAGAATGGAGAAGAAGGTTGATTCCAGATTTTACTATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAG
GAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCTGACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACG
TGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGGAACAAGTACATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCC
TGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGGACCAAACTTCAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTA
CGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGTGTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTG
AGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTGTATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACAT
CATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAATACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCT
GAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGACTGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCAT
GCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCCTTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCT
GCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTGTATTTTTGCTTTAGAGCCCTAAAAGACAATGTGACCCACGCTCAT
CTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTCACGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAG
CAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGGGACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGG
CTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCCAGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTC
CACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTCCTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCAC
CTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCCAAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCT
GGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGGAGATGGCCACAGAGAGATAGAGGCATCCCGACTCTTCAGTATCAG
ACCCAGAGAGACCTTGAAGACTGCAAGCATGAAATGAAAAAGATATGCAAAGCGGAAGTGACTCTGGAGATGTAAATCAGCTCATCAGTA
AAACCTTTGGGCCTGATCATCATGAATTCTTGTTCTAAATAGCTGAATAATGAGATACAATTTGGGAGCCAAATCTCTGCAATAGTGGTT
GGCCTGTTGGTTCCTCAGAATGGAATGGATTGATTGATTGATTCAGCAGACGTTTACTGATTACCTACTGTGTACCAGACATTCTTTTGA

>In-frame_SFI1_ENST00000400288_chr22_31985563_+_EFCAB4B_ENST00000440314_chr12_3753806_-_2754nt
AAGAAGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCGGCTTCCCCAGTTAGAAGGGGAAGAT
AAAAGACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAG
AAGAAGGTTGATTCCAGGTATTTTAAGGATGGTGCAGTTAAGAAACCTTATTCTGCAAAGACACTGTCCAACAAGAAGTCTTCTGCATCC
TTTGGGATCCGGAGGGAGTTACCTAGTACCAGTCATCTAGTGCAGTATCGTGGCACACATACTTGTACCCGACAGGGCCGGTTAAGAGAA
CTGCGCATCAGATGCGTGGCCAGAAAGTTCTTATATTTATGGATTCGAATGACTTTTGGAAGAGTATTTCCCTCTAAAGCCAGATTTTAC
TATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCT
GACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGGAACAAGTAC
ATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGGACCAAACTT
CAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGT
GTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTG
TATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAA
TACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGAC
TGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCC
TTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTG
TATTTTTGCTTTAGAGCCCTAAAAGACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTC
ACGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGG
GACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCC
AGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTC
CTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCC
AAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGG
AGCCAGTCAGAGGAGGAGGAGGAGGTGTTTGGCATCCCAAGGAGAAGCTCCCTGGGCCTGAGTGGATATCCCCTAACAGAAGAGGAGCCA
GGAACCGGGGAGCCAGGGCCTGGGGGTCCGTACCCCCGGCCGCTCCGCAGAATCATCTCCGTTGAAGAAGACCCCCTGCCCCAGCTCCTG
GATGGTGGCTTTGAGCAACCCCTGAGCAAATGCTCAGAAGAGGAAGAGGTCTCTGACCAGGGGGTACAGGGACAAATCCCGGAGGCCCCA
CCCTTGAAACTCACCCCCACATCCCCCCGAGGGCAGCCTGTTGGAAAAGAAGCCCTGTGTAAGGAGGAAAGCTCTCCCTCTGCCCCTGAC
CGGCTCTTCAAGATTGTGTTCGTGGGCAATTCCGCGGTGGGGAAGACATCCTTCCTGAGGAGATTCTGTGAGGACCGGTTCTCCCCAGGC
ATGGCGGCCACTGTGGGCATTGATTACCGTGTGAAGACGTTGAATGTGGACAACTCTCAGGTGGCCCTGCAGCTGTGGGACACGGCTGGG
CAGGAGAGGTACCGGTGCATCACCCAGCAGTTCTTCAGAAAGGCAGATGGTGTCATCGTCATGTACGATCTCACAGACAAGCAGTCGTTC
CTGTCGGTCCGGCGGTGGCTGAGCAGCGTGGAGGAAGCTGTGGGAGACCGGGTGCCTGTTCTTCTGCTGGGTAATAAGCTTGACAACGAG
AAGGAGCGGGAAGTCCCCCGGGGCCTCGGAGAGCAGCTTGCCACGGAGAACAATCTGATCTTCTATGAATGCAGCGCCTACTCTGGTCAC
AACACCAAAGAGTCCCTGCTCCATCTGGCCAGGTTCCTCAAGGAGCAAGAAGACACAGTGAGAGAGGACACCATTCAGGTCGGCCACCCT

>In-frame_SFI1_ENST00000400288_chr22_31985563_+_EFCAB4B_ENST00000444507_chr12_3753806_-_2187nt
AAGAAGCAGGTCCCGGATCGCCGTATACCGCCGGGTTTTCTCCCAACGTCAGGCCCGATGGCTCGGCTTCCCCAGTTAGAAGGGGAAGAT
AAAAGACTTTGATTCATGAAGAATCTGCTCACTGAGAAGTGTATATCAAGCCACAATTTCCATCAAAAAGTGATTAAGCAGAGAATGGAG
AAGAAGGTTGATTCCAGGTATTTTAAGGATGGTGCAGTTAAGAAACCTTATTCTGCAAAGACACTGTCCAACAAGAAGTCTTCTGCATCC
TTTGGGATCCGGAGGGAGTTACCTAGTACCAGTCATCTAGTGCAGTATCGTGGCACACATACTTGTACCCGACAGGGCCGGTTAAGAGAA
CTGCGCATCAGATGCGTGGCCAGAAAGTTCTTATATTTATGGATTCGAATGACTTTTGGAAGAGTATTTCCCTCTAAAGCCAGATTTTAC
TATGAGCAGCGATTACTACGGAAGGTCTTCGAAGAATGGAAAGAGGAGTGGTGGGTTTTCCAGCACGAGTGGAAACTCTGTGTTCGAGCT
GACTGTCACTACAGGTATTACCTGTACAACCTGATGTTCCAGACGTGGAAGACCTATGTGCGTCAGCAGCAGGAGATGAGGAACAAGTAC
ATTAGAGCCGAGGTTCATGATGCAAAGCAAAAGATGCGACAGGCCTGGAAGTCCTGGTTGATCTACGTGGTTGTTCGTAGGACCAAACTT
CAGATGCAGACTACAGCTCTGGAGTTTAGGCAACGGATTATCTTACGGGTGTGGTGGAGCACGTGGAGGCAGCGACTAGGACAGGTCCGT
GTGAGCCGTGCCCTCCATGCCTCTGCTTTGAAGCACAGGGCCCTGAGCCTCCAGGTGCAGGCTTGGTCACAGTGGCGGGAACAGCTCCTG
TATGTCCAGAAGGAGAAACAAAAGGTTGTCTCTGCAGTGAAACATCATCAGCACTGGCAAAAACGGAGATTTCTAAAGGCCTGGCTTGAA
TACCTGCAAGTCCGCAGAGTGAAGAGACAGCAGAATGAGATGGCTGAGCGATTCCATCATGTCACTGTGCTCCAGATATACTTCTGTGAC
TGGCAGCAGGCCTGGGAGCGGAGGGAGAGCTTGTACGCTCACCATGCCCAGGTGGAGAAACTGGCCAGGAAGATGGCCCTGCGGCGCGCC
TTTACTCACTGGAAACACTACATGCTGCTGTGTGCAGAAGAAGCTGCCCAGTTTGAGATGGCAGAAGAGCACCACAGGCACAGCCAGCTG
TATTTTTGCTTTAGAGCCCTAAAAGACAATGTGACCCACGCTCATCTCCAGCAAATAAGAAGGAATCTTGCTCACCAGCAGCATGGTGTC
ACGCTGCTGCACAGGTTCTGGAACCTCTGGCGGTCTCAGATTGAGCAGAAAAAGGAAAGAGAGCTGCTCCCCTTACTGCATGCTGCCTGG
GACCACTACAGAATAGCACTGCTGTGCAAATGTATCGAATTGTGGCTACAGTATACTCAGAAGAGGCGGTACAAGCAGCTGCTACAGGCC
AGAGCGGATGGTCATTTCCAGCAGAGAGCCCTGCCTGCTGCCTTCCACACATGGAACAGACTCTGGCGATGGCGCCACCAGGAAAATGTC
CTCAGTGCAAGAGCAACACGTTTCCACAGGGAAAGGAACAAGCACCTTCGGGATGAACGGGACATATGTTTTCAGAAAAATAAGGCAGCC
AAGGCAAACACAGCTGCTTCCAGGGCAAGTTGGAAAAAGAGATCTGGCTCTGTGATAGGCAAATATGTGGACAGCAGAGGGATTCTTAGG
AGATGGCCACAGAGAGATAGAGGCATCCCGACTCTTCAGTATCAGACCCAGAGAGACCTTGAAGACTGCAAGCATGAAATGAAAAAGATA
TGCAAAGCGGAAGTGACTCTGGAGATGTAAATCAGCTCATCAGTAAAACCTTTGGGCCTGATCATCATGAATTCTTGTTCTAAATAGCTG
AATAATGAGATACAATTTGGGAGCCAAATCTCTGCAATAGTGGTTGGCCTGTTGGTTCCTCAGAATGGAATGGATTGATTGATTGATTCA
GCAGACGTTTACTGATTACCTACTGTGTACCAGACATTCTTTTGAGTTCTGTAAAGCCTCCAAAAATAAATTAGACATGAGGTCCTACCA


Top

FusionGenePPI for SFI1_EFCAB4B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SFI1KRT19, RADIL, MDFI, CETN2, CDC5L, CRX, GCSH, LPXN, SFI1, MAD2L2, SERTAD1, CCDC120, CCDC57, FAM131C, GOLGA2, CETN1EFCAB4B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneSFI1chr22:31985563chr12:3753806ENST00000400288+1533111_1305141243CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000400288+1533475_4945141243CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000400289+1331111_1304321161CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000414585+1129111_130361989CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000432498+1432111_1304831212CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000443326+1331111_1304321161CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000540643+1331111_1304591188CETN2


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSFI1chr22:31985563chr12:3753806ENST00000400288+1533641_6605141243CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000400289+1331475_4944321161CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000400289+1331641_6604321161CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000414585+1129475_494361989CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000414585+1129641_660361989CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000432498+1432475_4944831212CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000432498+1432641_6604831212CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000443326+1331475_4944321161CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000443326+1331641_6604321161CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000540643+1331475_4944591188CETN2
HgeneSFI1chr22:31985563chr12:3753806ENST00000540643+1331641_6604591188CETN2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SFI1_EFCAB4B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SFI1_EFCAB4B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource