FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3341

FusionGeneSummary for ATP2B1_CEP290

check button Fusion gene summary
Fusion gene informationFusion gene name: ATP2B1_CEP290
Fusion gene ID: 3341
HgeneTgene
Gene symbol

ATP2B1

CEP290

Gene ID

490

80184

Gene nameATPase plasma membrane Ca2+ transporting 1centrosomal protein 290
SynonymsPMCA1|PMCA1kb3H11Ag|BBS14|CT87|JBTS5|LCA10|MKS4|NPHP6|POC3|SLSN6|rd16
Cytomap

12q21.33

12q21.32

Type of geneprotein-codingprotein-coding
Descriptionplasma membrane calcium-transporting ATPase 1ATPase, Ca++ transporting, plasma membrane 1plasma membrane calcium pumpcentrosomal protein of 290 kDaBardet-Biedl syndrome 14 proteinCTCL tumor antigen se2-2Meckel syndrome, type 4POC3 centriolar protein homologcancer/testis antigen 87centrosomal protein 290kDamonoclonal antibody 3H11 antigennephrocytsin-6prostate c
Modification date2018052320180519
UniProtAcc

P20020

O15078

Ensembl transtripts involved in fusion geneENST00000348959, ENST00000261173, 
ENST00000359142, ENST00000428670, 
ENST00000393164, 
ENST00000547691, 
ENST00000552810, ENST00000397838, 
ENST00000309041, 
Fusion gene scores* DoF score13 X 9 X 6=7025 X 5 X 3=75
# samples 105
** MAII scorelog2(10/702*10)=-2.81147103052984
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ATP2B1 [Title/Abstract] AND CEP290 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneATP2B1

GO:0051480

regulation of cytosolic calcium ion concentration

18029012

HgeneATP2B1

GO:1990034

calcium ion export across plasma membrane

18029012

TgeneCEP290

GO:0045893

positive regulation of transcription, DNA-templated

16682973

TgeneCEP290

GO:0060271

cilium assembly

26386044


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCESCTCGA-C5-A7CH-01AATP2B1chr12

90010579

-CEP290chr12

88478629

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000348959ENST00000547691ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000348959ENST00000552810ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000348959ENST00000397838ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000348959ENST00000309041ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000261173ENST00000547691ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000261173ENST00000552810ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000261173ENST00000397838ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000261173ENST00000309041ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000359142ENST00000547691ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000359142ENST00000552810ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000359142ENST00000397838ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000359142ENST00000309041ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000428670ENST00000547691ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000428670ENST00000552810ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000428670ENST00000397838ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000428670ENST00000309041ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000393164ENST00000547691ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000393164ENST00000552810ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000393164ENST00000397838ATP2B1chr12

90010579

-CEP290chr12

88478629

-
In-frameENST00000393164ENST00000309041ATP2B1chr12

90010579

-CEP290chr12

88478629

-

Top

FusionProtFeatures for ATP2B1_CEP290


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ATP2B1

P20020

CEP290

O15078

This magnesium-dependent enzyme catalyzes the hydrolysisof ATP coupled with the transport of calcium out of the cell. Involved in early and late steps in cilia formation. Itsassociation with CCP110 is required for inhibition of primarycilia formation by CCP110 (PubMed:18694559). May play a role inearly ciliogenesis in the disappearance of centriolar satellitesand in the transition of primary ciliar vesicles (PCVs) to cappedciliary vesicles (CCVs). Required for the centrosomal recruitmentof RAB8A and for the targeting of centriole satellite proteins tocentrosomes such as of PCM1 (PubMed:24421332). Required for thecorrect localization of ciliary and phototransduction proteins inretinal photoreceptor cells; may play a role in ciliary transportprocesses (By similarity). Required for efficient recruitment ofRAB8A to primary cilium (PubMed:17705300). In the ciliarytransition zone is part of the tectonic-like complex which isrequired for tissue-specific ciliogenesis and may regulate ciliarymembrane composition (By similarity). Involved in regulation ofthe BBSome complex integrity, specifically for presence of BBS2,BBS5 and BBS8/TTC8 in the complex, and in ciliary targeting ofselected BBSome cargos. May play a role in controlling entry ofthe BBSome complex to cilia possibly implicating IQCB1/NPHP5(PubMed:25552655). Activates ATF4-mediated transcription(PubMed:16682973). {ECO:0000250|UniProtKB:Q6A078,ECO:0000269|PubMed:16682973, ECO:0000269|PubMed:17705300,ECO:0000269|PubMed:18694559, ECO:0000269|PubMed:24421332,ECO:0000269|PubMed:25552655}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120296_2996891221Compositional biasNote=Poly-Glu
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119296_2996891185Compositional biasNote=Poly-Glu
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121296_2996891177Compositional biasNote=Poly-Glu
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221296_2996891221Compositional biasNote=Poly-Glu
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120119_1546891221Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120176_3666891221Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-11202_976891221Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120387_4196891221Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119119_1546891185Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119176_3666891185Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-11192_976891185Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119387_4196891185Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121119_1546891177Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121176_3666891177Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-11212_976891177Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121387_4196891177Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221119_1546891221Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221176_3666891221Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-12212_976891221Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221387_4196891221Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120155_1756891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120367_3866891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120420_4376891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-112098_1186891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119155_1756891185TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119367_3866891185TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119420_4376891185TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-111998_1186891185TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121155_1756891177TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121367_3866891177TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121420_4376891177TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-112198_1186891177TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221155_1756891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221367_3866891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221420_4376891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-122198_1186891221TransmembraneHelical
TgeneCEP290chr12:90010579chr12:88478629ENST00000397838-25461071_14985391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000397838-25461533_15845391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000397838-25461635_24525391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000397838-2546598_6645391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000397838-2546697_9315391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000397838-2546958_10275391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000547691-8291071_14985391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000547691-8291533_15845391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000547691-8291635_24525391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000547691-829598_6645391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000547691-829697_9315391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000547691-829958_10275391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000552810-33541533_158414792480Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000552810-33541635_245214792480Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000397838-25461966_24795391540RegionSelf-association (with itself or N-terminus)
TgeneCEP290chr12:90010579chr12:88478629ENST00000547691-8291966_24795391540RegionSelf-association (with itself or N-terminus)
TgeneCEP290chr12:90010579chr12:88478629ENST00000552810-33541966_247914792480RegionSelf-association (with itself or N-terminus)

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-11201100_11176891221RegionCalmodulin-binding subdomain A
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-11201118_11276891221RegionCalmodulin-binding subdomain B
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-11191100_11176891185RegionCalmodulin-binding subdomain A
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-11191118_11276891185RegionCalmodulin-binding subdomain B
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-11211100_11176891177RegionCalmodulin-binding subdomain A
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-11211118_11276891177RegionCalmodulin-binding subdomain B
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-12211100_11176891221RegionCalmodulin-binding subdomain A
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-12211118_11276891221RegionCalmodulin-binding subdomain B
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-11201028_10376891221Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-11201060_12586891221Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120438_8526891221Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120873_8826891221Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120904_9236891221Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120947_9646891221Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120987_10056891221Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-11191028_10376891185Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-11191060_12586891185Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119438_8526891185Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119873_8826891185Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119904_9236891185Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119947_9646891185Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119987_10056891185Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-11211028_10376891177Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-11211060_12586891177Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121438_8526891177Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121873_8826891177Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121904_9236891177Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121947_9646891177Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121987_10056891177Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-12211028_10376891221Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-12211060_12586891221Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221438_8526891221Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221873_8826891221Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221904_9236891221Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221947_9646891221Topological domainExtracellular
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221987_10056891221Topological domainCytoplasmic
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-11201006_10276891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-11201038_10596891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120853_8726891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120883_9036891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120924_9466891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000261173-1120965_9866891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-11191006_10276891185TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-11191038_10596891185TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119853_8726891185TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119883_9036891185TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119924_9466891185TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000348959-1119965_9866891185TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-11211006_10276891177TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-11211038_10596891177TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121853_8726891177TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121883_9036891177TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121924_9466891177TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000359142-1121965_9866891177TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-12211006_10276891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-12211038_10596891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221853_8726891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221883_9036891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221924_9466891221TransmembraneHelical
HgeneATP2B1chr12:90010579chr12:88478629ENST00000428670-1221965_9866891221TransmembraneHelical
TgeneCEP290chr12:90010579chr12:88478629ENST00000397838-254659_5655391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000547691-82959_5655391540Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000552810-33541071_149814792480Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000552810-3354598_66414792480Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000552810-335459_56514792480Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000552810-3354697_93114792480Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000552810-3354958_102714792480Coiled coilOntology_term=ECO:0000255
TgeneCEP290chr12:90010579chr12:88478629ENST00000397838-25461_6955391540RegionSelf-association (with itself or C-terminus)
TgeneCEP290chr12:90010579chr12:88478629ENST00000547691-8291_6955391540RegionSelf-association (with itself or C-terminus)
TgeneCEP290chr12:90010579chr12:88478629ENST00000552810-33541_69514792480RegionSelf-association (with itself or C-terminus)


Top

FusionGeneSequence for ATP2B1_CEP290


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ATP2B1_ENST00000348959_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000348959_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000348959_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000348959_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000261173_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000261173_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000261173_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000261173_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000359142_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000359142_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000359142_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000359142_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000428670_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000428670_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000428670_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000428670_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_1690aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFI
PPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGS
GRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM
MKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILSRDKVINELRLRLP
ATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFK
QTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEVKKVKAEVEDL
KYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIV
DRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSGLQGKPLTDNK
QSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTL
QRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDTYSKPSISGIE
SDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKV
VEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAAEKLRIAKNNL
EILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQ
IKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQHLKEEIKKLK

>In-frame_ATP2B1_ENST00000393164_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_1433aa
MFLVIGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEK
DKKKANLPKKEKSVLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPL
AVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSK
ILPPEKEGGLPRHVGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSA
NGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILS
RDKVINELRLRLPATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHR
LELQADSSLNKFKQTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHE
DEVKKVKAEVEDLKYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISAT
SQKEAHLNVQQIVDRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRL
TSGLQGKPLTDNKQSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLK
DLFAKADKEKLTLQRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFS
KDTYSKPSISGIESDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTI
PELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKET
DAAEKLRIAKNNLEILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATERE
QKVNKYNEDLEQQIKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDL

>In-frame_ATP2B1_ENST00000393164_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_1433aa
MFLVIGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEK
DKKKANLPKKEKSVLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPL
AVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSK
ILPPEKEGGLPRHVGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSA
NGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILS
RDKVINELRLRLPATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHR
LELQADSSLNKFKQTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHE
DEVKKVKAEVEDLKYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISAT
SQKEAHLNVQQIVDRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRL
TSGLQGKPLTDNKQSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLK
DLFAKADKEKLTLQRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFS
KDTYSKPSISGIESDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTI
PELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKET
DAAEKLRIAKNNLEILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATERE
QKVNKYNEDLEQQIKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDL

>In-frame_ATP2B1_ENST00000393164_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_1433aa
MFLVIGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEK
DKKKANLPKKEKSVLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPL
AVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSK
ILPPEKEGGLPRHVGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSA
NGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILS
RDKVINELRLRLPATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHR
LELQADSSLNKFKQTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHE
DEVKKVKAEVEDLKYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISAT
SQKEAHLNVQQIVDRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRL
TSGLQGKPLTDNKQSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLK
DLFAKADKEKLTLQRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFS
KDTYSKPSISGIESDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTI
PELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKET
DAAEKLRIAKNNLEILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATERE
QKVNKYNEDLEQQIKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDL

>In-frame_ATP2B1_ENST00000393164_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_1433aa
MFLVIGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEK
DKKKANLPKKEKSVLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPL
AVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSK
ILPPEKEGGLPRHVGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSA
NGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEKLKEKESALRLAEQNILS
RDKVINELRLRLPATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQRLLEKAREEQREIVKKHEEDLHILHHR
LELQADSSLNKFKQTAWDLMKQSPTPVPTNKHFIRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHE
DEVKKVKAEVEDLKYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQQKALSRALLELRAEMTAAAEERIISAT
SQKEAHLNVQQIVDRHTRELKTQVEDLNENLLKLKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRL
TSGLQGKPLTDNKQSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQAKIEGIRNKLKEKEGEVFTLTKQLNTLK
DLFAKADKEKLTLQRKLKTTGMTVDQVLGIRALESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFS
KDTYSKPSISGIESDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMCEFLKKEKAEVQRKLGHVRGSGRSGKTI
PELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKET
DAAEKLRIAKNNLEILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLKELETDIAKKNQSITDLKQLVKEATERE
QKVNKYNEDLEQQIKILKHVPEGAETEQGLKRELQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ATP2B1_ENST00000348959_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000348959_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000348959_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000348959_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000261173_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000261173_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000261173_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000261173_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000359142_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000359142_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000359142_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000359142_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000428670_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000428670_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000428670_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000428670_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_5070nt
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACG
CTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATA
CCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAA
ACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATT
ACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCT
GGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCC
ATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTA
TATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATG
ATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATT
TTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAA
GCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGAT
GATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAA
CTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCT
GCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAA
ACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAA
AGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAA
CAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTA
GCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTA
AAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTA
AAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACA
ACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAA
CTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTT
GATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAAC
AGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAA
GAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAA
CAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATG
AAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAA
GAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTG
CAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAA
AAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTA
CAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAG
TCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAA
CAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTT
CAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTA
GTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAAT
GAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAA
AAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTA
GAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGT
GCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAAT
CAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAG
ATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAG
CTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAA
CTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAA
AAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTC
TTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAA

>In-frame_ATP2B1_ENST00000393164_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_4299nt
ATGTTTTTGGTTATAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATC
TTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATT
GAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAA
GATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGT
CTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAG
TGCACACCAATTTATATACAATACTTTGTGAAGTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTT
GCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGA
AATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTAT
AAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAA
ATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAA
CGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACT
GTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCT
AATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACC
ATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATT
GCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCA
AGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATG
GAACCAAAATCTCACCACACATTGAAAATTGCTCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAG
AAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGA
TTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAAC
AAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTA
TCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAA
GATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAA
CTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAG
GAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACT
TCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAAT
CTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAA
AAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTA
ACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAA
TTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAG
TGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAG
GATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATA
CGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAA
GCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCA
AAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAG
TTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAG
GAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATC
CCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATA
TTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAG
TTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACT
GATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGA
TTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACC
AAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAA
CAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTT
AAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGAC
CAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTA
GAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTT
AAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACT

>In-frame_ATP2B1_ENST00000393164_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_4299nt
ATGTTTTTGGTTATAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATC
TTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATT
GAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAA
GATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGT
CTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAG
TGCACACCAATTTATATACAATACTTTGTGAAGTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTT
GCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGA
AATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTAT
AAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAA
ATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAA
CGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACT
GTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCT
AATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACC
ATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATT
GCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCA
AGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATG
GAACCAAAATCTCACCACACATTGAAAATTGCTCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAG
AAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGA
TTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAAC
AAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTA
TCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAA
GATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAA
CTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAG
GAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACT
TCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAAT
CTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAA
AAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTA
ACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAA
TTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAG
TGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAG
GATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATA
CGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAA
GCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCA
AAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAG
TTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAG
GAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATC
CCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATA
TTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAG
TTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACT
GATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGA
TTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACC
AAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAA
CAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTT
AAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGAC
CAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTA
GAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTT
AAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACT

>In-frame_ATP2B1_ENST00000393164_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_4299nt
ATGTTTTTGGTTATAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATC
TTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATT
GAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAA
GATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGT
CTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAG
TGCACACCAATTTATATACAATACTTTGTGAAGTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTT
GCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGA
AATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTAT
AAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAA
ATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAA
CGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACT
GTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCT
AATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACC
ATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATT
GCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCA
AGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATG
GAACCAAAATCTCACCACACATTGAAAATTGCTCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAG
AAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGA
TTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAAC
AAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTA
TCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAA
GATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAA
CTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAG
GAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACT
TCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAAT
CTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAA
AAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTA
ACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAA
TTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAG
TGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAG
GATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATA
CGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAA
GCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCA
AAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAG
TTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAG
GAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATC
CCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATA
TTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAG
TTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACT
GATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGA
TTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACC
AAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAA
CAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTT
AAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGAC
CAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTA
GAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTT
AAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACT

>In-frame_ATP2B1_ENST00000393164_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_4299nt
ATGTTTTTGGTTATAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATC
TTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATT
GAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAA
GATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGT
CTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAG
TGCACACCAATTTATATACAATACTTTGTGAAGTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTT
GCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGA
AATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTAT
AAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAA
ATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAA
CGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACT
GTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCT
AATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACC
ATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATT
GCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCA
AGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATG
GAACCAAAATCTCACCACACATTGAAAATTGCTCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAG
AAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGA
TTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAAC
AAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTA
TCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAA
GATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAA
CTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAG
GAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACT
TCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAAT
CTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAA
AAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTA
ACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAA
TTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAG
TGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAG
GATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATA
CGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAA
GCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCA
AAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAG
TTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAG
GAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATC
CCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATA
TTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAG
TTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACT
GATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGA
TTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACC
AAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAA
CAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTT
AAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGAC
CAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTA
GAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTT
AAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ATP2B1_ENST00000348959_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_5419nt
GGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCTGCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAAAGATTT
TCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATTAAATTCTTTTGGGAAACATTTTCCTTCTGATATATTATACTTGT
AATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTAC
GCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTG
CACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTAT
ACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGT
ATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGA
AACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACA
GTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACAT
TACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGA
AAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTC
TGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAA
GAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGC
CATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATC
TGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATT
ATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTT
CATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAAT
GATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTT
GACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATAT
TTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCA
CGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGA
AGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAG
CAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGA
TGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACC
AGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAA
ACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCC
TGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCA
AACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCA
AAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAA
ACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGT
AGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATT
AAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTT
AAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAAC
AACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGA
ACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGT
TGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAA
CAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAA
AGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAA
ACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTAT
GAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAA
AGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTT
GCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAA
AAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTT
ACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGA
GTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGA
ACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGT
TCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGT
AGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAA
TGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGA
AAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTT
AGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGG
TGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAA
TCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACA
GATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCA
GCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCA
ACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAA
AAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCT
CTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGA
AGAAAGTCCTGTTAATTTCCCCATTTACTAAAGGTCACCTATAAACTTTGTTTCATTTAACTATTTATTAACTTTATAAGTTAAATATAC
TTGGAAATAAGCAGTTCTCCGAACTGTAGTATTTCCTTCTCACTACCTTGTACCTTTATACTTAGATTGGAATTCTTAATAAATAAAATT

>In-frame_ATP2B1_ENST00000348959_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_5415nt
GGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCTGCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAAAGATTT
TCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATTAAATTCTTTTGGGAAACATTTTCCTTCTGATATATTATACTTGT
AATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTAC
GCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTG
CACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTAT
ACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGT
ATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGA
AACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACA
GTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACAT
TACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGA
AAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTC
TGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAA
GAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGC
CATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATC
TGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATT
ATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTT
CATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAAT
GATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTT
GACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATAT
TTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCA
CGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGA
AGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAG
CAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGA
TGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACC
AGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAA
ACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCC
TGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCA
AACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCA
AAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAA
ACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGT
AGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATT
AAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTT
AAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAAC
AACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGA
ACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGT
TGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAA
CAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAA
AGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAA
ACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTAT
GAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAA
AGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTT
GCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAA
AAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTT
ACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGA
GTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGA
ACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGT
TCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGT
AGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAA
TGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGA
AAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTT
AGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGG
TGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAA
TCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACA
GATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCA
GCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCA
ACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAA
AAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCT
CTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGA
AGAAAGTCCTGTTAATTTCCCCATTTACTAAAGGTCACCTATAAACTTTGTTTCATTTAACTATTTATTAACTTTATAAGTTAAATATAC
TTGGAAATAAGCAGTTCTCCGAACTGTAGTATTTCCTTCTCACTACCTTGTACCTTTATACTTAGATTGGAATTCTTAATAAATAAAATT

>In-frame_ATP2B1_ENST00000348959_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_5251nt
GGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCTGCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAAAGATTT
TCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATTAAATTCTTTTGGGAAACATTTTCCTTCTGATATATTATACTTGT
AATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTAC
GCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTG
CACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTAT
ACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGT
ATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGA
AACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACA
GTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACAT
TACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGA
AAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTC
TGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAA
GAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGC
CATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATC
TGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATT
ATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTT
CATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAAT
GATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTT
GACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATAT
TTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCA
CGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGA
AGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAG
CAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGA
TGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACC
AGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAA
ACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCC
TGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCA
AACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCA
AAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAA
ACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGT
AGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATT
AAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTT
AAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAAC
AACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGA
ACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGT
TGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAA
CAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAA
AGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAA
ACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTAT
GAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAA
AGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTT
GCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAA
AAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTT
ACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGA
GTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGA
ACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGT
TCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGT
AGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAA
TGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGA
AAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTT
AGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGG
TGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAA
TCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACA
GATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCA
GCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCA
ACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAA
AAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCT
CTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGA

>In-frame_ATP2B1_ENST00000348959_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_5251nt
GGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCTGCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAAAGATTT
TCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATTAAATTCTTTTGGGAAACATTTTCCTTCTGATATATTATACTTGT
AATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTAC
GCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTG
CACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTAT
ACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGT
ATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGA
AACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACA
GTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACAT
TACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGA
AAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTC
TGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAA
GAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGC
CATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATC
TGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATT
ATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTT
CATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAAT
GATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTT
GACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATAT
TTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCA
CGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGA
AGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAG
CAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGA
TGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACC
AGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAA
ACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCC
TGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCA
AACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCA
AAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAA
ACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGT
AGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATT
AAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTT
AAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAAC
AACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGA
ACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGT
TGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAA
CAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAA
AGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAA
ACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTAT
GAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAA
AGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTT
GCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAA
AAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTT
ACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGA
GTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGA
ACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGT
TCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGT
AGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAA
TGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGA
AAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTT
AGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGG
TGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAA
TCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACA
GATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCA
GCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCA
ACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAA
AAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCT
CTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGA

>In-frame_ATP2B1_ENST00000261173_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_5419nt
GGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCTGCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAAAGATTT
TCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATTAAATTCTTTTGGGAAACATTTTCCTTCTGATATATTATACTTGT
AATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTAC
GCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTG
CACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTAT
ACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGT
ATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGA
AACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACA
GTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACAT
TACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGA
AAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTC
TGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAA
GAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGC
CATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATC
TGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATT
ATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTT
CATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAAT
GATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTT
GACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATAT
TTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCA
CGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGA
AGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAG
CAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGA
TGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACC
AGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAA
ACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCC
TGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCA
AACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCA
AAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAA
ACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGT
AGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATT
AAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTT
AAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAAC
AACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGA
ACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGT
TGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAA
CAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAA
AGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAA
ACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTAT
GAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAA
AGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTT
GCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAA
AAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTT
ACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGA
GTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGA
ACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGT
TCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGT
AGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAA
TGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGA
AAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTT
AGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGG
TGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAA
TCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACA
GATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCA
GCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCA
ACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAA
AAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCT
CTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGA
AGAAAGTCCTGTTAATTTCCCCATTTACTAAAGGTCACCTATAAACTTTGTTTCATTTAACTATTTATTAACTTTATAAGTTAAATATAC
TTGGAAATAAGCAGTTCTCCGAACTGTAGTATTTCCTTCTCACTACCTTGTACCTTTATACTTAGATTGGAATTCTTAATAAATAAAATT

>In-frame_ATP2B1_ENST00000261173_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_5415nt
GGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCTGCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAAAGATTT
TCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATTAAATTCTTTTGGGAAACATTTTCCTTCTGATATATTATACTTGT
AATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTAC
GCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTG
CACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTAT
ACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGT
ATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGA
AACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACA
GTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACAT
TACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGA
AAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTC
TGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAA
GAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGC
CATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATC
TGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATT
ATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTT
CATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAAT
GATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTT
GACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATAT
TTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCA
CGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGA
AGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAG
CAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGA
TGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACC
AGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAA
ACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCC
TGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCA
AACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCA
AAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAA
ACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGT
AGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATT
AAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTT
AAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAAC
AACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGA
ACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGT
TGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAA
CAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAA
AGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAA
ACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTAT
GAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAA
AGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTT
GCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAA
AAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTT
ACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGA
GTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGA
ACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGT
TCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGT
AGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAA
TGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGA
AAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTT
AGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGG
TGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAA
TCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACA
GATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCA
GCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCA
ACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAA
AAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCT
CTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGA
AGAAAGTCCTGTTAATTTCCCCATTTACTAAAGGTCACCTATAAACTTTGTTTCATTTAACTATTTATTAACTTTATAAGTTAAATATAC
TTGGAAATAAGCAGTTCTCCGAACTGTAGTATTTCCTTCTCACTACCTTGTACCTTTATACTTAGATTGGAATTCTTAATAAATAAAATT

>In-frame_ATP2B1_ENST00000261173_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_5251nt
GGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCTGCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAAAGATTT
TCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATTAAATTCTTTTGGGAAACATTTTCCTTCTGATATATTATACTTGT
AATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTAC
GCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTG
CACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTAT
ACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGT
ATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGA
AACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACA
GTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACAT
TACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGA
AAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTC
TGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAA
GAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGC
CATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATC
TGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATT
ATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTT
CATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAAT
GATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTT
GACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATAT
TTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCA
CGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGA
AGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAG
CAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGA
TGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACC
AGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAA
ACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCC
TGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCA
AACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCA
AAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAA
ACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGT
AGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATT
AAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTT
AAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAAC
AACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGA
ACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGT
TGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAA
CAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAA
AGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAA
ACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTAT
GAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAA
AGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTT
GCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAA
AAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTT
ACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGA
GTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGA
ACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGT
TCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGT
AGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAA
TGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGA
AAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTT
AGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGG
TGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAA
TCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACA
GATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCA
GCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCA
ACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAA
AAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCT
CTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGA

>In-frame_ATP2B1_ENST00000261173_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_5251nt
GGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCTGCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAAAGATTT
TCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATTAAATTCTTTTGGGAAACATTTTCCTTCTGATATATTATACTTGT
AATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTAC
GCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTG
CACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTAT
ACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGT
ATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGA
AACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACA
GTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACAT
TACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGA
AAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTC
TGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAA
GAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGC
CATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATC
TGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATT
ATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTT
CATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAAT
GATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTT
GACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATAT
TTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCA
CGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGA
AGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAG
CAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGA
TGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACC
AGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAA
ACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCC
TGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCA
AACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCA
AAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAA
ACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGT
AGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATT
AAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTT
AAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAAC
AACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGA
ACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGT
TGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAA
CAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAA
AGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAA
ACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTAT
GAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAA
AGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTT
GCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAA
AAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTT
ACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGA
GTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGA
ACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGT
TCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGT
AGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAA
TGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGA
AAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTT
AGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGG
TGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAA
TCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACA
GATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCA
GCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCA
ACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAA
AAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCT
CTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGA

>In-frame_ATP2B1_ENST00000359142_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_5463nt
ACAGATGTGTATATCTCATGATTGATATGGAGAAACTAGTCATGGGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCT
GCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAAAGATTTTCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATT
AAATTCTTTTGGGAAACATTTTCCTTCTGATATATTATACTTGTAATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAA
AACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACGCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCA
TTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGCACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCT
GCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCA
TTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCA
CTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAAACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGT
GTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAGTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACT
GTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATTACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCA
GCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAAAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGAT
AAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGA
ATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGA
GCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGAT
GAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAA
GCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTT
GCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTT
CCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACC
ATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAA
CATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACA
TCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGAT
TTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATG
AGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTG
AGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTG
AGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACA
TGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATA
CTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAA
GAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTA
TTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCAT
CACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCT
ACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAG
AAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAAC
CATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAA
TCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCC
TTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCT
GCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAAT
GAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAA
CTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAA
AGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAG
AACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGT
AAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACT
TTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTG
GGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCC
CACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAG
TTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAAC
TTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGAT
TTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAG
ACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCA
GGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGG
CATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAA
GAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGT
AAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTAT
GAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAG
AGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAA
GGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAAC
AAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCA
GATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAA
GATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAA
TTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAAGAAAGTCCTGTTAATTTCCCCATTTACTAAAGGTCACCTATAAAC
TTTGTTTCATTTAACTATTTATTAACTTTATAAGTTAAATATACTTGGAAATAAGCAGTTCTCCGAACTGTAGTATTTCCTTCTCACTAC

>In-frame_ATP2B1_ENST00000359142_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_5459nt
ACAGATGTGTATATCTCATGATTGATATGGAGAAACTAGTCATGGGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCT
GCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAAAGATTTTCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATT
AAATTCTTTTGGGAAACATTTTCCTTCTGATATATTATACTTGTAATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAA
AACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACGCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCA
TTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGCACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCT
GCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCA
TTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCA
CTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAAACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGT
GTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAGTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACT
GTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATTACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCA
GCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAAAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGAT
AAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGA
ATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGA
GCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGAT
GAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAA
GCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTT
GCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTT
CCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACC
ATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAA
CATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACA
TCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGAT
TTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATG
AGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTG
AGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTG
AGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACA
TGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATA
CTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAA
GAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTA
TTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCAT
CACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCT
ACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAG
AAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAAC
CATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAA
TCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCC
TTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCT
GCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAAT
GAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAA
CTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAA
AGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAG
AACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGT
AAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACT
TTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTG
GGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCC
CACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAG
TTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAAC
TTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGAT
TTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAG
ACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCA
GGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGG
CATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAA
GAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGT
AAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTAT
GAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAG
AGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAA
GGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAAC
AAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCA
GATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAA
GATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAA
TTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAAGAAAGTCCTGTTAATTTCCCCATTTACTAAAGGTCACCTATAAAC
TTTGTTTCATTTAACTATTTATTAACTTTATAAGTTAAATATACTTGGAAATAAGCAGTTCTCCGAACTGTAGTATTTCCTTCTCACTAC

>In-frame_ATP2B1_ENST00000359142_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_5295nt
ACAGATGTGTATATCTCATGATTGATATGGAGAAACTAGTCATGGGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCT
GCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAAAGATTTTCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATT
AAATTCTTTTGGGAAACATTTTCCTTCTGATATATTATACTTGTAATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAA
AACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACGCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCA
TTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGCACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCT
GCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCA
TTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCA
CTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAAACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGT
GTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAGTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACT
GTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATTACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCA
GCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAAAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGAT
AAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGA
ATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGA
GCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGAT
GAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAA
GCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTT
GCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTT
CCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACC
ATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAA
CATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACA
TCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGAT
TTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATG
AGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTG
AGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTG
AGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACA
TGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATA
CTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAA
GAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTA
TTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCAT
CACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCT
ACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAG
AAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAAC
CATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAA
TCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCC
TTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCT
GCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAAT
GAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAA
CTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAA
AGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAG
AACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGT
AAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACT
TTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTG
GGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCC
CACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAG
TTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAAC
TTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGAT
TTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAG
ACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCA
GGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGG
CATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAA
GAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGT
AAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTAT
GAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAG
AGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAA
GGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAAC
AAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCA
GATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAA
GATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAA

>In-frame_ATP2B1_ENST00000359142_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_5295nt
ACAGATGTGTATATCTCATGATTGATATGGAGAAACTAGTCATGGGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCT
GCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAAAGATTTTCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATT
AAATTCTTTTGGGAAACATTTTCCTTCTGATATATTATACTTGTAATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAA
AACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGGAATTACGCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCA
TTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGCACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCT
GCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAATTTTATACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCA
TTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCA
CTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGAAGGTGAAACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGT
GTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAGTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACT
GTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGCTGACATTACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCA
GCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAAAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGAT
AAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGA
ATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGA
GCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGAT
GAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAA
GCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTT
GCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTT
CCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACC
ATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAA
CATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACA
TCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGAT
TTAAAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATG
AGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTG
AGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTG
AGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACA
TGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATA
CTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAA
GAGATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTA
TTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCAT
CACAGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCT
ACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAG
AAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAAC
CATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAA
TCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCC
TTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCT
GCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAAT
GAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAA
CTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAA
AGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAG
AACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGT
AAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACT
TTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTG
GGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCC
CACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAG
TTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAAC
TTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGAT
TTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAG
ACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCA
GGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGG
CATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAA
GAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGT
AAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTAT
GAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAG
AGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAA
GGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAAC
AAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCA
GATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAA
GATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAA

>In-frame_ATP2B1_ENST00000428670_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_5695nt
AGCGTGAGTAGGGAGCCCCGGCTGGTGGACGCCGAGCCTCTCGGCTCCTTGGCCGCCCCATCCCCGAGGTGCAGCTGCACCTCCGCGTGG
CGCCCCGAGCCCTGCGAGCCGGCTGCGGACGCGCTGAGGACGGAGCCCCCATCCTCTGCGTTTCCCGCTGCCCCTTAACGCCCCGCGACC
CTCCCGCAGCCTGCCTTTCCTTCCCCCTCGGAAAATGGTTCCCACTGCCGGGCGAGATGTGTATATCTCATGATTGATATGGAGAAACTA
GTCATGGGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCTGCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAA
AGATTTTCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATTAAATTCTTTTGGGAAACATTTTCCTTCTGATATATTAT
ACTTGTAATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGG
AATTACGCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGG
AATTTGCACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAA
TTTTATACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGC
CATAGTATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGA
AGGTGAAACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGA
AAAACAGTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGC
TGACATTACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAAT
TGATGAAAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGA
AGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGA
AGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGG
TGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGA
AAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCT
AGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAA
GTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAA
AAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGG
AACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACC
AAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACC
TCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACC
AGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAAT
ATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGA
CCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGG
AGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACC
TGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCG
ATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGC
TCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGA
GGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAA
ATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACA
GACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCAC
TGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGA
GGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGC
TCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACT
TTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACA
AATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAG
TAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAG
AGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGA
TAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAA
ACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAA
GTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACT
TACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGA
ATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTT
ACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGG
AATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCA
GCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGC
AGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAA
AAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCA
GGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGG
CACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAA
TAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCT
TGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAA
AAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGA
ACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAA
TCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGC
TGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAA
GCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAA
TATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGA
TGAAGAAGAAAGTCCTGTTAATTTCCCCATTTACTAAAGGTCACCTATAAACTTTGTTTCATTTAACTATTTATTAACTTTATAAGTTAA
ATATACTTGGAAATAAGCAGTTCTCCGAACTGTAGTATTTCCTTCTCACTACCTTGTACCTTTATACTTAGATTGGAATTCTTAATAAAT

>In-frame_ATP2B1_ENST00000428670_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_5691nt
AGCGTGAGTAGGGAGCCCCGGCTGGTGGACGCCGAGCCTCTCGGCTCCTTGGCCGCCCCATCCCCGAGGTGCAGCTGCACCTCCGCGTGG
CGCCCCGAGCCCTGCGAGCCGGCTGCGGACGCGCTGAGGACGGAGCCCCCATCCTCTGCGTTTCCCGCTGCCCCTTAACGCCCCGCGACC
CTCCCGCAGCCTGCCTTTCCTTCCCCCTCGGAAAATGGTTCCCACTGCCGGGCGAGATGTGTATATCTCATGATTGATATGGAGAAACTA
GTCATGGGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCTGCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAA
AGATTTTCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATTAAATTCTTTTGGGAAACATTTTCCTTCTGATATATTAT
ACTTGTAATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGG
AATTACGCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGG
AATTTGCACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAA
TTTTATACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGC
CATAGTATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGA
AGGTGAAACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGA
AAAACAGTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGC
TGACATTACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAAT
TGATGAAAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGA
AGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGA
AGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGG
TGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGA
AAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCT
AGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAA
GTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAA
AAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGG
AACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACC
AAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACC
TCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACC
AGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAAT
ATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGA
CCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGG
AGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACC
TGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCG
ATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGC
TCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGA
GGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAA
ATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACA
GACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCAC
TGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGA
GGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGC
TCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACT
TTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACA
AATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAG
TAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAG
AGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGA
TAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAA
ACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAA
GTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACT
TACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGA
ATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTT
ACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGG
AATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCA
GCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGC
AGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAA
AAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCA
GGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGG
CACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAA
TAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCT
TGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAA
AAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGA
ACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAA
TCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGC
TGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAA
GCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAA
TATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGA
TGAAGAAGAAAGTCCTGTTAATTTCCCCATTTACTAAAGGTCACCTATAAACTTTGTTTCATTTAACTATTTATTAACTTTATAAGTTAA
ATATACTTGGAAATAAGCAGTTCTCCGAACTGTAGTATTTCCTTCTCACTACCTTGTACCTTTATACTTAGATTGGAATTCTTAATAAAT

>In-frame_ATP2B1_ENST00000428670_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_5527nt
AGCGTGAGTAGGGAGCCCCGGCTGGTGGACGCCGAGCCTCTCGGCTCCTTGGCCGCCCCATCCCCGAGGTGCAGCTGCACCTCCGCGTGG
CGCCCCGAGCCCTGCGAGCCGGCTGCGGACGCGCTGAGGACGGAGCCCCCATCCTCTGCGTTTCCCGCTGCCCCTTAACGCCCCGCGACC
CTCCCGCAGCCTGCCTTTCCTTCCCCCTCGGAAAATGGTTCCCACTGCCGGGCGAGATGTGTATATCTCATGATTGATATGGAGAAACTA
GTCATGGGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCTGCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAA
AGATTTTCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATTAAATTCTTTTGGGAAACATTTTCCTTCTGATATATTAT
ACTTGTAATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGG
AATTACGCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGG
AATTTGCACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAA
TTTTATACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGC
CATAGTATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGA
AGGTGAAACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGA
AAAACAGTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGC
TGACATTACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAAT
TGATGAAAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGA
AGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGA
AGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGG
TGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGA
AAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCT
AGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAA
GTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAA
AAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGG
AACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACC
AAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACC
TCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACC
AGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAAT
ATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGA
CCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGG
AGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACC
TGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCG
ATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGC
TCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGA
GGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAA
ATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACA
GACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCAC
TGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGA
GGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGC
TCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACT
TTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACA
AATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAG
TAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAG
AGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGA
TAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAA
ACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAA
GTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACT
TACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGA
ATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTT
ACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGG
AATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCA
GCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGC
AGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAA
AAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCA
GGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGG
CACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAA
TAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCT
TGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAA
AAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGA
ACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAA
TCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGC
TGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAA
GCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAA
TATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGA

>In-frame_ATP2B1_ENST00000428670_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_5527nt
AGCGTGAGTAGGGAGCCCCGGCTGGTGGACGCCGAGCCTCTCGGCTCCTTGGCCGCCCCATCCCCGAGGTGCAGCTGCACCTCCGCGTGG
CGCCCCGAGCCCTGCGAGCCGGCTGCGGACGCGCTGAGGACGGAGCCCCCATCCTCTGCGTTTCCCGCTGCCCCTTAACGCCCCGCGACC
CTCCCGCAGCCTGCCTTTCCTTCCCCCTCGGAAAATGGTTCCCACTGCCGGGCGAGATGTGTATATCTCATGATTGATATGGAGAAACTA
GTCATGGGCCAAAGGTCAAGATACTTCTCTGGGAAATGTTGCTGCTGATGCTGCTTTACAAAGTCATACAATGAGTGTTTGGTTTAAGAA
AGATTTTCATACTTAAAAGATTTTCATCTTGGAAATACATCAAGTGAAAATTAAATTCTTTTGGGAAACATTTTCCTTCTGATATATTAT
ACTTGTAATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAAGCTAATCATGATGGAGACTTTGG
AATTACGCTCGCAGAGCTGCGGGCTCTCATGGAGCTCAGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGG
AATTTGCACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGAAGAGAAGCAGTGTTTGGAAAGAA
TTTTATACCTCCTAAAAAGCCAAAAACCTTTCTTCAATTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGC
CATAGTATCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTTTCTGTTGGGGAGGAAGAAGGTGA
AGGTGAAACTGGTTGGATTGAAGGAGCTGCAATCCTCTTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGA
AAAACAGTTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGTCAGGTCATTCAGATACCTGTAGC
TGACATTACTGTTGGAGATATTGCTCAAGTGAAATATGGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAAT
TGATGAAAGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTTCTATCAGGTACTCATGTAATGGA
AGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGA
AGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGG
TGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGA
AAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATGTCTGCCATCACAGTTATCATTCT
AGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAA
GTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACGATCTCACTGGCTTATTCAGTCAA
AAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGG
AACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTTCCTGAACCAGAAGCTATTCCACC
AAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACC
TCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTATCAGGATGTTAGAAATGAAATACC
AGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAAT
ATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGA
CCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGG
AGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACC
TGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCG
ATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAGATGGAACCAAAATCTCACCACACATTGAAAATTGC
TCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTAAAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGA
GGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCACAGATTAGAACTACAGGCTGATAGTTCACTAAATAA
ATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACCAACAAGCATTTTATTCGTCTGGCTGAGATGGAACA
GACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAAGTATCACAAGATTTGGAGAGACAAAGAGAAATCAC
TGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCATGAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGA
GGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCTGAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGC
TCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTGAAGGAGAAACAACAGAAAGCACTTAGTCGGGCACT
TTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCAACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACA
AATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAAAATCTTTTAAAATTGAAAGAAGCACTTAAAACAAG
TAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTGCAAAAGAAACAAAAAGCCTATAATAAAATACTTAG
AGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGACTAACCAGTGGATTACAGGGCAAACCCCTGACAGA
TAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAACCAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAA
ACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAAAAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAA
GTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTGAAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACT
TACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGAATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGA
ATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCACCAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTT
ACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTTTCAAAGGATACATATTCTAAGCCTTCAATTTCAGG
AATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTGAAGTTGTCATCTGAAAATATTGAACTGAAATTTCA
GCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTGAAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGC
AGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACAATCCCAGAACTGGAAAAAACCATTGGTTTAATGAA
AAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGAATATTGACTAGTGAAAAAATGGCTAATATTGAGCA
GGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCATCAGTTGAGCATGCACTATGAATCCAAGACCAAAGG
CACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAAACTGATGCTGCAGAGAAATTACGGATAGCAAAGAA
TAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAGAGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCT
TGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAAACCAAGTTAAAAGAATTGGAAACTGATATTGCCAA
AAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGAGAACAAAAAGTTAACAAATACAATGAAGACCTTGA
ACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGCCTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAA
TCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAGGACCAAAGTGGAGCTGAAAGCACCATACCTGATGC
TGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGATCTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAA
GCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGATCTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAA
TATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTAACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGA

>In-frame_ATP2B1_ENST00000393164_chr12_90010579_-_CEP290_ENST00000547691_chr12_88478629_-_4560nt
TTTCCTAAATGTTGAGGCTGTTAAAAACAATATTACTGAAGTTTGAAATTTGGTGGTAGCAAGGAGATCTATCAGTATTTTTAAAAACAA
ACTATGTTTTTGGTTATAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATT
ATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCT
ATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAA
AAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCA
GGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCT
GAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCA
CTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATG
GGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACAT
TATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCA
AAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTA
AAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGT
ACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGT
GCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGA
ACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGC
ATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTG
TCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAG
ATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTA
AAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCAC
AGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACC
AACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAA
GTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCAT
GAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCT
GAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTG
AAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCA
ACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAA
AATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTG
CAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGA
CTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAAC
CAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAA
AAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTG
AAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGA
ATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCAC
CAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTT
TCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTG
AAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTG
AAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACA
ATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGA
ATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCAT
CAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAA
ACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAG
AGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAA
ACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGA
GAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGC
CTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAG
GACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGAT
CTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGAT
CTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTA
ACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAAGAAAGTCCTGTTAATTTCCCCATTTACTAAAGGTCACCTATAAACTTT
GTTTCATTTAACTATTTATTAACTTTATAAGTTAAATATACTTGGAAATAAGCAGTTCTCCGAACTGTAGTATTTCCTTCTCACTACCTT

>In-frame_ATP2B1_ENST00000393164_chr12_90010579_-_CEP290_ENST00000552810_chr12_88478629_-_4556nt
TTTCCTAAATGTTGAGGCTGTTAAAAACAATATTACTGAAGTTTGAAATTTGGTGGTAGCAAGGAGATCTATCAGTATTTTTAAAAACAA
ACTATGTTTTTGGTTATAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATT
ATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCT
ATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAA
AAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCA
GGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCT
GAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCA
CTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATG
GGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACAT
TATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCA
AAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTA
AAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGT
ACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGT
GCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGA
ACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGC
ATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTG
TCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAG
ATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTA
AAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCAC
AGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACC
AACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAA
GTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCAT
GAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCT
GAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTG
AAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCA
ACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAA
AATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTG
CAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGA
CTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAAC
CAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAA
AAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTG
AAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGA
ATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCAC
CAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTT
TCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTG
AAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTG
AAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACA
ATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGA
ATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCAT
CAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAA
ACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAG
AGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAA
ACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGA
GAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGC
CTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAG
GACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGAT
CTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGAT
CTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTA
ACTAGCCCTGTTGCTGCTTCTGAAGAGTTTGAAGATGAAGAAGAAAGTCCTGTTAATTTCCCCATTTACTAAAGGTCACCTATAAACTTT
GTTTCATTTAACTATTTATTAACTTTATAAGTTAAATATACTTGGAAATAAGCAGTTCTCCGAACTGTAGTATTTCCTTCTCACTACCTT

>In-frame_ATP2B1_ENST00000393164_chr12_90010579_-_CEP290_ENST00000397838_chr12_88478629_-_4392nt
TTTCCTAAATGTTGAGGCTGTTAAAAACAATATTACTGAAGTTTGAAATTTGGTGGTAGCAAGGAGATCTATCAGTATTTTTAAAAACAA
ACTATGTTTTTGGTTATAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATT
ATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCT
ATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAA
AAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCA
GGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCT
GAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCA
CTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATG
GGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACAT
TATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCA
AAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTA
AAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGT
ACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGT
GCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGA
ACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGC
ATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTG
TCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAG
ATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTA
AAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCAC
AGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACC
AACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAA
GTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCAT
GAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCT
GAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTG
AAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCA
ACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAA
AATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTG
CAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGA
CTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAAC
CAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAA
AAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTG
AAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGA
ATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCAC
CAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTT
TCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTG
AAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTG
AAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACA
ATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGA
ATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCAT
CAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAA
ACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAG
AGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAA
ACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGA
GAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGC
CTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAG
GACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGAT
CTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGAT
CTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTA

>In-frame_ATP2B1_ENST00000393164_chr12_90010579_-_CEP290_ENST00000309041_chr12_88478629_-_4392nt
TTTCCTAAATGTTGAGGCTGTTAAAAACAATATTACTGAAGTTTGAAATTTGGTGGTAGCAAGGAGATCTATCAGTATTTTTAAAAACAA
ACTATGTTTTTGGTTATAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTAAATTCTCAAACTGGAATT
ATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAGAAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCT
ATTGAGAATCGCAACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAAGGTGGAGATGGTGATGAA
AAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCTGTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCA
GGTCTGTTGATGTCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAGAAAAGACCATGGCTTGCT
GAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTCATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCA
CTTGCAGTCACGATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTGGATGCTTGTGAAACCATG
GGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTGACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACAT
TATAAAAAGGTTCCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTGAATTGTGCTTATACATCA
AAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCACGTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTA
AAACGGGATTATCAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCTGTTAGGAAGTCCATGAGT
ACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGCAAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGT
GCTAATGGTGAGGCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATGGCATCAGAAGGCTTGAGA
ACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCAGAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGC
ATTGCTGTTGTGGGGATTGAAGATCCTGTGAGACCTGAGAAACTAAAAGAGAAAGAATCTGCTTTAAGGTTAGCAGAACAAAATATACTG
TCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCTGCCACTGCAGAAAGAGAAAAGCTCATAGCTGAGCTAGGCAGAAAAGAG
ATGGAACCAAAATCTCACCACACATTGAAAATTGCTCATCAAACCATTGCAAACATGCAAGCAAGGTTAAATCAAAAAGAAGAAGTATTA
AAGAAGTATCAACGTCTTCTAGAAAAAGCCAGAGAGGAGCAAAGAGAAATTGTGAAGAAACATGAGGAAGACCTTCATATTCTTCATCAC
AGATTAGAACTACAGGCTGATAGTTCACTAAATAAATTCAAACAAACGGCTTGGGATTTAATGAAACAGTCTCCCACTCCAGTTCCTACC
AACAAGCATTTTATTCGTCTGGCTGAGATGGAACAGACAGTAGCAGAACAAGATGACTCTCTTTCCTCACTCTTGGTCAAACTAAAGAAA
GTATCACAAGATTTGGAGAGACAAAGAGAAATCACTGAATTAAAAGTAAAAGAATTTGAAAATATCAAATTACAGCTTCAAGAAAACCAT
GAAGATGAAGTGAAAAAAGTAAAAGCGGAAGTAGAGGATTTAAAGTATCTTCTGGACCAGTCACAAAAGGAGTCACAGTGTTTAAAATCT
GAACTTCAGGCTCAAAAAGAAGCAAATTCAAGAGCTCCAACAACTACAATGAGAAATCTAGTAGAACGGCTAAAGAGCCAATTAGCCTTG
AAGGAGAAACAACAGAAAGCACTTAGTCGGGCACTTTTAGAACTCCGGGCAGAAATGACAGCAGCTGCTGAAGAACGTATTATTTCTGCA
ACTTCTCAAAAAGAGGCCCATCTCAATGTTCAACAAATCGTTGATCGACATACTAGAGAGCTAAAGACACAAGTTGAAGATTTAAATGAA
AATCTTTTAAAATTGAAAGAAGCACTTAAAACAAGTAAAAACAGAGAAAACTCACTAACTGATAATTTGAATGACTTAAATAATGAACTG
CAAAAGAAACAAAAAGCCTATAATAAAATACTTAGAGAGAAAGAGGAAATTGATCAAGAGAATGATGAACTGAAAAGGCAAATTAAAAGA
CTAACCAGTGGATTACAGGGCAAACCCCTGACAGATAATAAACAAAGTCTAATTGAAGAACTCCAAAGGAAAGTTAAAAAACTAGAGAAC
CAATTAGAGGGAAAGGTGGAGGAAGTAGACCTAAAACCTATGAAAGAAAAGAATGCTAAAGAAGAATTAATTAGGTGGGAAGAAGGTAAA
AAGTGGCAAGCCAAAATAGAAGGAATTCGAAACAAGTTAAAAGAGAAAGAGGGGGAAGTCTTTACTTTAACAAAGCAGTTGAATACTTTG
AAGGATCTTTTTGCCAAAGCCGATAAAGAGAAACTTACTTTGCAGAGGAAACTAAAAACAACTGGCATGACTGTTGATCAGGTTTTGGGA
ATACGAGCTTTGGAGTCAGAAAAAGAATTGGAAGAATTAAAAAAGAGAAATCTTGACTTAGAAAATGATATATTGTATATGAGGGCCCAC
CAAGCTCTTCCTCGAGATTCTGTTGTAGAAGATTTACATTTACAAAATAGATACCTCCAAGAAAAACTTCATGCTTTAGAAAAACAGTTT
TCAAAGGATACATATTCTAAGCCTTCAATTTCAGGAATAGAGTCAGATGATCATTGTCAGAGAGAACAGGAGCTTCAGAAGGAAAACTTG
AAGTTGTCATCTGAAAATATTGAACTGAAATTTCAGCTTGAACAAGCAAATAAAGATTTGCCAAGATTAAAGAATCAAGTCAGAGATTTG
AAGGAAATGTGTGAATTTCTTAAGAAAGAAAAAGCAGAAGTTCAGCGGAAACTTGGCCATGTTAGAGGGTCTGGTAGAAGTGGAAAGACA
ATCCCAGAACTGGAAAAAACCATTGGTTTAATGAAAAAAGTAGTTGAAAAAGTCCAGAGAGAAAATGAACAGTTGAAAAAAGCATCAGGA
ATATTGACTAGTGAAAAAATGGCTAATATTGAGCAGGAAAATGAAAAATTGAAGGCTGAATTAGAAAAACTTAAAGCTCATCTTGGGCAT
CAGTTGAGCATGCACTATGAATCCAAGACCAAAGGCACAGAAAAAATTATTGCTGAAAATGAAAGGCTTCGTAAAGAACTTAAAAAAGAA
ACTGATGCTGCAGAGAAATTACGGATAGCAAAGAATAATTTAGAGATATTAAATGAGAAGATGACAGTTCAACTAGAAGAGACTGGTAAG
AGATTGCAGTTTGCAGAAAGCAGAGGTCCACAGCTTGAAGGTGCTGACAGTAAGAGCTGGAAATCCATTGTGGTTACAAGAATGTATGAA
ACCAAGTTAAAAGAATTGGAAACTGATATTGCCAAAAAAAATCAAAGCATTACTGACCTTAAACAGCTTGTAAAAGAAGCAACAGAGAGA
GAACAAAAAGTTAACAAATACAATGAAGACCTTGAACAACAGATTAAGATTCTTAAACATGTTCCTGAAGGTGCTGAGACAGAGCAAGGC
CTTAAACGGGAGCTTCAAGTTCTTAGATTAGCTAATCATCAGCTGGATAAAGAGAAAGCAGAATTAATCCATCAGATAGAAGCTAACAAG
GACCAAAGTGGAGCTGAAAGCACCATACCTGATGCTGATCAACTAAAGGAAAAAATAAAAGATCTAGAGACACAGCTCAAAATGTCAGAT
CTAGAAAAGCAGCATTTGAAGGAGGAAATAAAGAAGCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGAT
CTTAAGTATAATTACAAGGAAGAAGTGAAGAAGAATATTCTCTTAGAAGAGAAGGTAAAAAAACTTTCAGAACAATTGGGAGTTGAATTA


Top

FusionGenePPI for ATP2B1_CEP290


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ATP2B1TERF2, CSNK2A1, ERBB2IP, PARK2, LGR4, PTPLAD1, CCDC8, RNF2, EGFR, HSD17B6, UNK, ATP1A1, GNB2, HM13, IDH3A, CANX, CLGN, NTRK1, NPHP1, RPGRIP1L, TMEM17, CCND1, SRPR, RAB7A, TOMM40, ATL3, TMEM63B, CENPO, TUBA1C, ETS1, CDH1, CTDSPL, TRIM25, CALM1CEP290MAPK10, CCP110, CEP76, CEP97, NEURL4, IQCB1, ZNF423, ESR1, CDKN1A, CEP57, C9orf16, CCDC8, PEG10, DTNBP1, MCM7, MED4, CEP170, FGFR1OP, OFD1, CEP131, CCDC138, CEP72, FKBP4, HERC2, CEP162, MIB1, PTPRR, PCNT, PIBF1, SSX2IP, CCDC77, CSNK1E, ECH1, SREK1, SUPT5H, LDHA, TARDBP, MAPRE1, AKAP12, EMG1, KIF7, PNMA2, SSBP1, CAND1, UBA1, PGD, USO1, CEP104, AHCY, AK2, ANP32A, ARPC3, BCAP31, C11orf49, C21orf2, CSPP1, CYB5R3, GYS1, HAUS7, HAUS8, ISOC1, KDELR2, LRRC49, LUZP1, MIF, MPHOSPH9, MTPN, NEK1, PAWR, PCM1, PLP2, PMPCB, PTGES3, RAB2A, TPGS1, WRAP73, YWHAH, CALM2, CCDC61, CEP350, CHTOP, DDX47, FOPNL, GPATCH1, HAUS1, HAUS3, HAUS4, HAUS6, HMGN1, KIAA0753, KIF14, NEDD1, NME7, TCHP, TBC1D31, WDR83, CEP128, LGALS3BP, CEP135, CCDC14, HYPK, CDC14A, TPTE2, LZTS2, CALM1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneCEP290chr12:90010579chr12:88478629ENST00000397838-2546696_8965391540IQCB1
TgeneCEP290chr12:90010579chr12:88478629ENST00000547691-829696_8965391540IQCB1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneCEP290chr12:90010579chr12:88478629ENST00000552810-3354696_89614792480IQCB1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ATP2B1_CEP290


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ATP2B1_CEP290


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneATP2B1C0020538Hypertensive disease1CTD_human
HgeneATP2B1C0086543Cataract1CTD_human
HgeneATP2B1C1956346Coronary Artery Disease1CTD_human
TgeneCEP290C1857780JOUBERT SYNDROME 53CTD_human;UNIPROT
TgeneCEP290C0752166Bardet-Biedl Syndrome1CTD_human;ORPHANET