FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33148

FusionGeneSummary for SEMA4A_DAP3

check button Fusion gene summary
Fusion gene informationFusion gene name: SEMA4A_DAP3
Fusion gene ID: 33148
HgeneTgene
Gene symbol

SEMA4A

DAP3

Gene ID

64218

58512

Gene namesemaphorin 4ADLG associated protein 3
SynonymsCORD10|RP35|SEMAB|SEMBDAP3|SAPAP3
Cytomap

1q22

1p34.3

Type of geneprotein-codingprotein-coding
Descriptionsemaphorin-4Asema Bsema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4Asemaphorin-Bdisks large-associated protein 3DAP-3PSD-95/SAP90-binding protein 3SAP90/PSD-95-associated protein 3discs large homolog associated protein 3
Modification date2018052320180519
UniProtAcc

Q9H3S1

P51398

Ensembl transtripts involved in fusion geneENST00000355014, ENST00000368285, 
ENST00000368284, ENST00000368286, 
ENST00000368282, ENST00000487358, 
ENST00000471642, ENST00000368336, 
ENST00000343043, ENST00000496863, 
ENST00000535183, ENST00000421487, 
ENST00000465375, 
Fusion gene scores* DoF score2 X 2 X 2=83 X 2 X 2=12
# samples 23
** MAII scorelog2(2/8*10)=1.32192809488736log2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: SEMA4A [Title/Abstract] AND DAP3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-13-1487-01ASEMA4Achr1

156132885

+DAP3chr1

155698833

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000355014ENST00000471642SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000355014ENST00000368336SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000355014ENST00000343043SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000355014ENST00000496863SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000355014ENST00000535183SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000355014ENST00000421487SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000355014ENST00000465375SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000368285ENST00000471642SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000368285ENST00000368336SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000368285ENST00000343043SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368285ENST00000496863SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368285ENST00000535183SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368285ENST00000421487SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368285ENST00000465375SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000368284ENST00000471642SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000368284ENST00000368336SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000368284ENST00000343043SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368284ENST00000496863SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368284ENST00000535183SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368284ENST00000421487SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368284ENST00000465375SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000368286ENST00000471642SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000368286ENST00000368336SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000368286ENST00000343043SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368286ENST00000496863SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368286ENST00000535183SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368286ENST00000421487SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368286ENST00000465375SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000368282ENST00000471642SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000368282ENST00000368336SEMA4Achr1

156132885

+DAP3chr1

155698833

+
In-frameENST00000368282ENST00000343043SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368282ENST00000496863SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368282ENST00000535183SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368282ENST00000421487SEMA4Achr1

156132885

+DAP3chr1

155698833

+
5CDS-intronENST00000368282ENST00000465375SEMA4Achr1

156132885

+DAP3chr1

155698833

+
3UTR-3CDSENST00000487358ENST00000471642SEMA4Achr1

156132885

+DAP3chr1

155698833

+
3UTR-3CDSENST00000487358ENST00000368336SEMA4Achr1

156132885

+DAP3chr1

155698833

+
3UTR-3CDSENST00000487358ENST00000343043SEMA4Achr1

156132885

+DAP3chr1

155698833

+
3UTR-intronENST00000487358ENST00000496863SEMA4Achr1

156132885

+DAP3chr1

155698833

+
3UTR-intronENST00000487358ENST00000535183SEMA4Achr1

156132885

+DAP3chr1

155698833

+
3UTR-intronENST00000487358ENST00000421487SEMA4Achr1

156132885

+DAP3chr1

155698833

+
3UTR-intronENST00000487358ENST00000465375SEMA4Achr1

156132885

+DAP3chr1

155698833

+

Top

FusionProtFeatures for SEMA4A_DAP3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SEMA4A

Q9H3S1

DAP3

P51398

Cell surface receptor for PLXNB1, PLXNB2, PLXNB3 andPLXND1 that plays an important role in cell-cell signaling. Playsa role in priming antigen-specific T-cells, promotesdifferentiation of Th1 T-helper cells, and thereby contributes toadaptive immunity. Promotes phosphorylation of TIMD2. Inhibitsangiogenesis. Promotes axon growth cone collapse. Inhibits axonalextension by providing local signals to specify territoriesinaccessible for growing axons (By similarity).{ECO:0000250|UniProtKB:Q62178}. Involved in mediating interferon-gamma-induced celldeath.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000355014+101536_494378762DomainSema
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000355014+1015496_548378762DomainNote=PSI
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000355014+1015573_631378762DomainNote=Ig-like C2-type
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368282+91436_494378762DomainSema
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368282+914496_548378762DomainNote=PSI
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368282+914573_631378762DomainNote=Ig-like C2-type
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368284+81336_494246630DomainSema
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368284+813496_548246630DomainNote=PSI
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368284+813573_631246630DomainNote=Ig-like C2-type
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368285+101536_494378762DomainSema
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368285+1015496_548378762DomainNote=PSI
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368285+1015573_631378762DomainNote=Ig-like C2-type
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368286+91436_494246630DomainSema
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368286+914496_548246630DomainNote=PSI
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368286+914573_631246630DomainNote=Ig-like C2-type
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000355014+101533_683378762Topological domainExtracellular
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000355014+1015705_761378762Topological domainCytoplasmic
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368282+91433_683378762Topological domainExtracellular
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368282+914705_761378762Topological domainCytoplasmic
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368284+81333_683246630Topological domainExtracellular
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368284+813705_761246630Topological domainCytoplasmic
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368285+101533_683378762Topological domainExtracellular
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368285+1015705_761378762Topological domainCytoplasmic
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368286+91433_683246630Topological domainExtracellular
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368286+914705_761246630Topological domainCytoplasmic
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000355014+1015684_704378762TransmembraneHelical
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368282+914684_704378762TransmembraneHelical
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368284+813684_704246630TransmembraneHelical
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368285+1015684_704378762TransmembraneHelical
HgeneSEMA4Achr1:156132885chr1:155698833ENST00000368286+914684_704246630TransmembraneHelical
TgeneDAP3chr1:156132885chr1:155698833ENST00000343043+613128_135201399Nucleotide bindingGTP
TgeneDAP3chr1:156132885chr1:155698833ENST00000368336+613128_135201399Nucleotide bindingGTP
TgeneDAP3chr1:156132885chr1:155698833ENST00000421487+512128_135167365Nucleotide bindingGTP
TgeneDAP3chr1:156132885chr1:155698833ENST00000535183+512128_135160358Nucleotide bindingGTP


Top

FusionGeneSequence for SEMA4A_DAP3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SEMA4A_ENST00000355014_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_576aa
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYTAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQ
DPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCK
NDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTT
LKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKATLPQELLGKEGFDALDPFIPILVSNTNPKEFESCIQTTLEN

>In-frame_SEMA4A_ENST00000355014_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_576aa
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYTAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQ
DPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCK
NDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTT
LKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKATLPQELLGKEGFDALDPFIPILVSNTNPKEFESCIQTTLEN

>In-frame_SEMA4A_ENST00000355014_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_576aa
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYTAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQ
DPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCK
NDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTT
LKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKATLPQELLGKEGFDALDPFIPILVSNTNPKEFESCIQTTLEN

>In-frame_SEMA4A_ENST00000368285_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_576aa
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYTAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQ
DPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCK
NDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTT
LKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKATLPQELLGKEGFDALDPFIPILVSNTNPKEFESCIQTTLEN

>In-frame_SEMA4A_ENST00000368285_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_576aa
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYTAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQ
DPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCK
NDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTT
LKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKATLPQELLGKEGFDALDPFIPILVSNTNPKEFESCIQTTLEN

>In-frame_SEMA4A_ENST00000368285_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_576aa
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYTAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQ
DPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCK
NDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTT
LKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKATLPQELLGKEGFDALDPFIPILVSNTNPKEFESCIQTTLEN

>In-frame_SEMA4A_ENST00000368284_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_444aa
MIPWPASDRKKSECAFKKKSNEELQDSYLLPISEDKVMEGKGQSPFDPAHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDN
FLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPA
DSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKETSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEV
VEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGS

>In-frame_SEMA4A_ENST00000368284_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_444aa
MIPWPASDRKKSECAFKKKSNEELQDSYLLPISEDKVMEGKGQSPFDPAHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDN
FLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPA
DSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKETSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEV
VEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGS

>In-frame_SEMA4A_ENST00000368284_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_444aa
MIPWPASDRKKSECAFKKKSNEELQDSYLLPISEDKVMEGKGQSPFDPAHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDN
FLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPA
DSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKETSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEV
VEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGS

>In-frame_SEMA4A_ENST00000368286_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_444aa
MIPWPASDRKKSECAFKKKSNEELQDSYLLPISEDKVMEGKGQSPFDPAHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDN
FLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPA
DSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKETSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEV
VEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGS

>In-frame_SEMA4A_ENST00000368286_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_444aa
MIPWPASDRKKSECAFKKKSNEELQDSYLLPISEDKVMEGKGQSPFDPAHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDN
FLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPA
DSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKETSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEV
VEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGS

>In-frame_SEMA4A_ENST00000368286_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_444aa
MIPWPASDRKKSECAFKKKSNEELQDSYLLPISEDKVMEGKGQSPFDPAHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDN
FLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPA
DSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKETSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEV
VEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGS

>In-frame_SEMA4A_ENST00000368282_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_576aa
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYTAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQ
DPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCK
NDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTT
LKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKATLPQELLGKEGFDALDPFIPILVSNTNPKEFESCIQTTLEN

>In-frame_SEMA4A_ENST00000368282_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_576aa
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYTAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQ
DPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCK
NDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTT
LKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKATLPQELLGKEGFDALDPFIPILVSNTNPKEFESCIQTTLEN

>In-frame_SEMA4A_ENST00000368282_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_576aa
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYTAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQ
DPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLTSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCK
NDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTTRGPETNPRPGSIKVQEKTVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTT
LKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKATLPQELLGKEGFDALDPFIPILVSNTNPKEFESCIQTTLEN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SEMA4A_ENST00000355014_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_1728nt
ATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGCTGCCGACGACGACC
GCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGC
CTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAG
GATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAAT
GAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCGCCTTCAGCCCTGCT
TGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCC
GCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGC
ACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACC
CAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAG
AATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCC
TTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTT
GGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAA
ACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGA
GAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTG
CTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACT
CTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGA
GGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGA
TTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAAC
AATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGG

>In-frame_SEMA4A_ENST00000355014_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_1728nt
ATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGCTGCCGACGACGACC
GCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGC
CTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAG
GATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAAT
GAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCGCCTTCAGCCCTGCT
TGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCC
GCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGC
ACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACC
CAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAG
AATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCC
TTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTT
GGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAA
ACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGA
GAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTG
CTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACT
CTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGA
GGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGA
TTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAAC
AATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGG

>In-frame_SEMA4A_ENST00000355014_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_1728nt
ATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGCTGCCGACGACGACC
GCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGC
CTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAG
GATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAAT
GAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCGCCTTCAGCCCTGCT
TGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCC
GCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGC
ACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACC
CAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAG
AATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCC
TTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTT
GGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAA
ACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGA
GAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTG
CTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACT
CTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGA
GGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGA
TTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAAC
AATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGG

>In-frame_SEMA4A_ENST00000368285_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_1728nt
ATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGCTGCCGACGACGACC
GCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGC
CTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAG
GATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAAT
GAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCGCCTTCAGCCCTGCT
TGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCC
GCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGC
ACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACC
CAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAG
AATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCC
TTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTT
GGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAA
ACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGA
GAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTG
CTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACT
CTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGA
GGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGA
TTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAAC
AATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGG

>In-frame_SEMA4A_ENST00000368285_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_1728nt
ATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGCTGCCGACGACGACC
GCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGC
CTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAG
GATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAAT
GAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCGCCTTCAGCCCTGCT
TGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCC
GCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGC
ACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACC
CAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAG
AATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCC
TTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTT
GGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAA
ACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGA
GAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTG
CTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACT
CTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGA
GGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGA
TTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAAC
AATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGG

>In-frame_SEMA4A_ENST00000368285_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_1728nt
ATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGCTGCCGACGACGACC
GCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGC
CTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAG
GATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAAT
GAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCGCCTTCAGCCCTGCT
TGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCC
GCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGC
ACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACC
CAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAG
AATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCC
TTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTT
GGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAA
ACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGA
GAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTG
CTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACT
CTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGA
GGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGA
TTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAAC
AATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGG

>In-frame_SEMA4A_ENST00000368284_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_1332nt
ATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAATGAGGAACTTCAAGATTCCTACCTGTTG
CCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATG
CTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAAC
TTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGC
GAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAG
TGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCC
GATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCT
CTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACC
AACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTG
GTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATG
TTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAG
GAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCT
CTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTT
TCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAA

>In-frame_SEMA4A_ENST00000368284_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_1332nt
ATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAATGAGGAACTTCAAGATTCCTACCTGTTG
CCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATG
CTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAAC
TTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGC
GAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAG
TGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCC
GATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCT
CTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACC
AACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTG
GTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATG
TTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAG
GAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCT
CTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTT
TCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAA

>In-frame_SEMA4A_ENST00000368284_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_1332nt
ATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAATGAGGAACTTCAAGATTCCTACCTGTTG
CCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATG
CTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAAC
TTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGC
GAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAG
TGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCC
GATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCT
CTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACC
AACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTG
GTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATG
TTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAG
GAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCT
CTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTT
TCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAA

>In-frame_SEMA4A_ENST00000368286_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_1332nt
ATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAATGAGGAACTTCAAGATTCCTACCTGTTG
CCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATG
CTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAAC
TTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGC
GAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAG
TGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCC
GATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCT
CTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACC
AACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTG
GTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATG
TTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAG
GAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCT
CTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTT
TCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAA

>In-frame_SEMA4A_ENST00000368286_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_1332nt
ATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAATGAGGAACTTCAAGATTCCTACCTGTTG
CCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATG
CTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAAC
TTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGC
GAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAG
TGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCC
GATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCT
CTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACC
AACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTG
GTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATG
TTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAG
GAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCT
CTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTT
TCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAA

>In-frame_SEMA4A_ENST00000368286_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_1332nt
ATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAATGAGGAACTTCAAGATTCCTACCTGTTG
CCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATG
CTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAAC
TTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGC
GAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAG
TGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCC
GATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCT
CTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACC
AACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTG
GTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATG
TTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAG
GAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCT
CTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTT
TCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAA

>In-frame_SEMA4A_ENST00000368282_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_1728nt
ATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGCTGCCGACGACGACC
GCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGC
CTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAG
GATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAAT
GAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCGCCTTCAGCCCTGCT
TGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCC
GCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGC
ACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACC
CAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAG
AATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCC
TTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTT
GGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAA
ACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGA
GAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTG
CTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACT
CTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGA
GGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGA
TTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAAC
AATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGG

>In-frame_SEMA4A_ENST00000368282_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_1728nt
ATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGCTGCCGACGACGACC
GCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGC
CTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAG
GATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAAT
GAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCGCCTTCAGCCCTGCT
TGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCC
GCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGC
ACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACC
CAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAG
AATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCC
TTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTT
GGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAA
ACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGA
GAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTG
CTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACT
CTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGA
GGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGA
TTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAAC
AATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGG

>In-frame_SEMA4A_ENST00000368282_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_1728nt
ATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGCTGCCGACGACGACC
GCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGC
CTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAG
GATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAAT
GAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCGCCTTCAGCCCTGCT
TGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCC
GCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGC
ACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACC
CAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAG
AATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCC
TTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTT
GGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAA
ACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGA
GAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTG
CTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACT
CTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGA
GGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGA
TTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAAC
AATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SEMA4A_ENST00000355014_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_2116nt
GGGCTGAGGCACTGAGAGACCGGAAAGCCTGGCATTCCAGAGGGAGGGAAACGCAGCGGCATCCCCAGGCTCCAGAGCTCCCTGGTGACA
GTCTGTGGCTGAGCATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGC
TGCCGACGACGACCGCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCT
TCCACCAGAAGGGCCTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGG
CCTTGGATATCCAGGATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTA
AGAAGAAGAGCAATGAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCG
CCTTCAGCCCTGCTTGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAA
GCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGC
CCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAG
CCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGG
CTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGC
CGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCT
CCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAG
AGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATG
TCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATG
CAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTT
GGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAA
ATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGC
TGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGT
ATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCT
CGCTGCTGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTATGCTGGACCCAGTA
AGATGAGGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTGGCTCTGGACCTGCA
TTAAAATGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGATGTGGTTTTTCACA

>In-frame_SEMA4A_ENST00000355014_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_2600nt
GGGCTGAGGCACTGAGAGACCGGAAAGCCTGGCATTCCAGAGGGAGGGAAACGCAGCGGCATCCCCAGGCTCCAGAGCTCCCTGGTGACA
GTCTGTGGCTGAGCATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGC
TGCCGACGACGACCGCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCT
TCCACCAGAAGGGCCTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGG
CCTTGGATATCCAGGATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTA
AGAAGAAGAGCAATGAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCG
CCTTCAGCCCTGCTTGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAA
GCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGC
CCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAG
CCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGG
CTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGC
CGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCT
CCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAG
AGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATG
TCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATG
CAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTT
GGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAA
ATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGC
TGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGT
ATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCT
CGCTGCTGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTATGCTGGACCCAGTA
AGATGAGGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTGGCTCTGGACCTGCA
TTAAAATGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGATGTGGTTTTTCACA
TTTAAGATAATTATGGCTCTTTTCCTAAAAAATAAAATATCTTTCTAAAGTGTTGTGTTAGATTAATAATATGGAAGGAGTCTTTAGATT
GGCCAAATTGCATTTCTCTGATATTCCTCTTGTTGCAGGTCAGAAGAGATCAATTCTACAGAAATTTCCAGTGGTTCTGTTGAGGCTTTA
TGGAATTCAGCATGTCAAAATTCACAGCTGGCTGGGCACAGTGGCTCATGCCTGTAATCCCAGCACTTTGGAAGCCCAAGGCGGGCAGAC
TGCTTGAGTTCAGGAGTTTGCAACCAGCCTGGGCAACATGGTGAAAACCTGTCTCTACTAAAAATACAAAAATTAGCCGGGCACGGTGGC
ATGCGCCTGTAATCCAAGCTACTTGGGAGGCTGAGGCAGGAGAATTGCTTCAACTTGGGAGGCGGATGTTGCAGTGAGCCAAAATTGCAC

>In-frame_SEMA4A_ENST00000355014_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_2116nt
GGGCTGAGGCACTGAGAGACCGGAAAGCCTGGCATTCCAGAGGGAGGGAAACGCAGCGGCATCCCCAGGCTCCAGAGCTCCCTGGTGACA
GTCTGTGGCTGAGCATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGC
TGCCGACGACGACCGCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCT
TCCACCAGAAGGGCCTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGG
CCTTGGATATCCAGGATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTA
AGAAGAAGAGCAATGAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCG
CCTTCAGCCCTGCTTGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAA
GCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGC
CCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAG
CCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGG
CTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGC
CGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCT
CCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAG
AGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATG
TCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATG
CAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTT
GGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAA
ATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGC
TGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGT
ATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCT
CGCTGCTGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTATGCTGGACCCAGTA
AGATGAGGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTGGCTCTGGACCTGCA
TTAAAATGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGATGTGGTTTTTCACA

>In-frame_SEMA4A_ENST00000368285_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_2279nt
CCAGGATCTGTCACAACTCGAGAGGTGGAAATTCCGGTTTCCCTGGCCTAGAGCTCCCAGTGCTGGCTTTGGCATGATGGGCACCTGGAG
GGCCGCACTCCCGTTCCAGCCAGGCTGAGCCTTCTGTCCCCTGCCTCTGGGGCCTGGGAACCCCCCTTCTTCTTTCTCCTGAATGGCACC
CCCGCCCTAGAATCCAGACACCGAGTTTCCCACTGTGGCTGGTTCAAGGGTATGTGAGAGCTCCCTGGTGACAGTCTGTGGCTGAGCATG
GCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGCTGCCGACGACGACCGCG
GGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGCCTC
CAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAGGAT
CCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAATGAG
ACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCGCCTTCAGCCCTGCTTGT
ACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCCGCT
CACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGCACA
CTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACCCAG
GTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAGAAT
GACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCCTTC
AACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTTGGC
GGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAAACT
TCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGAGAA
AGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTGCTG
AAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACTCTG
AAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGAGGC
GCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGATTT
GATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAACAAT
TGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGGCAC
TGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTATGCTGGACCCAGTAAGATGAGGAAGTCGGGC
AGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTGGCTCTGGACCTGCATTAAAATGGGTTTCACT
GTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGATGTGGTTTTTCACATTTAAGATAATTATGGC

>In-frame_SEMA4A_ENST00000368285_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_2763nt
CCAGGATCTGTCACAACTCGAGAGGTGGAAATTCCGGTTTCCCTGGCCTAGAGCTCCCAGTGCTGGCTTTGGCATGATGGGCACCTGGAG
GGCCGCACTCCCGTTCCAGCCAGGCTGAGCCTTCTGTCCCCTGCCTCTGGGGCCTGGGAACCCCCCTTCTTCTTTCTCCTGAATGGCACC
CCCGCCCTAGAATCCAGACACCGAGTTTCCCACTGTGGCTGGTTCAAGGGTATGTGAGAGCTCCCTGGTGACAGTCTGTGGCTGAGCATG
GCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGCTGCCGACGACGACCGCG
GGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGCCTC
CAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAGGAT
CCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAATGAG
ACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCGCCTTCAGCCCTGCTTGT
ACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCCGCT
CACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGCACA
CTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACCCAG
GTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAGAAT
GACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCCTTC
AACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTTGGC
GGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAAACT
TCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGAGAA
AGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTGCTG
AAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACTCTG
AAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGAGGC
GCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGATTT
GATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAACAAT
TGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGGCAC
TGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTATGCTGGACCCAGTAAGATGAGGAAGTCGGGC
AGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTGGCTCTGGACCTGCATTAAAATGGGTTTCACT
GTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGATGTGGTTTTTCACATTTAAGATAATTATGGC
TCTTTTCCTAAAAAATAAAATATCTTTCTAAAGTGTTGTGTTAGATTAATAATATGGAAGGAGTCTTTAGATTGGCCAAATTGCATTTCT
CTGATATTCCTCTTGTTGCAGGTCAGAAGAGATCAATTCTACAGAAATTTCCAGTGGTTCTGTTGAGGCTTTATGGAATTCAGCATGTCA
AAATTCACAGCTGGCTGGGCACAGTGGCTCATGCCTGTAATCCCAGCACTTTGGAAGCCCAAGGCGGGCAGACTGCTTGAGTTCAGGAGT
TTGCAACCAGCCTGGGCAACATGGTGAAAACCTGTCTCTACTAAAAATACAAAAATTAGCCGGGCACGGTGGCATGCGCCTGTAATCCAA
GCTACTTGGGAGGCTGAGGCAGGAGAATTGCTTCAACTTGGGAGGCGGATGTTGCAGTGAGCCAAAATTGCACCACTGCACTCCAGCCTG

>In-frame_SEMA4A_ENST00000368285_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_2279nt
CCAGGATCTGTCACAACTCGAGAGGTGGAAATTCCGGTTTCCCTGGCCTAGAGCTCCCAGTGCTGGCTTTGGCATGATGGGCACCTGGAG
GGCCGCACTCCCGTTCCAGCCAGGCTGAGCCTTCTGTCCCCTGCCTCTGGGGCCTGGGAACCCCCCTTCTTCTTTCTCCTGAATGGCACC
CCCGCCCTAGAATCCAGACACCGAGTTTCCCACTGTGGCTGGTTCAAGGGTATGTGAGAGCTCCCTGGTGACAGTCTGTGGCTGAGCATG
GCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGCTGCTGCCGACGACGACCGCG
GGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGCCTC
CAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAGGAT
CCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAATGAG
ACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACACCTGCGGCACCTTCGCCTTCAGCCCTGCTTGT
ACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCCGCT
CACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGCACA
CTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACCCAG
GTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAGAAT
GACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCCTTC
AACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTTGGC
GGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAAACT
TCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGAGAA
AGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTGCTG
AAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACTCTG
AAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGAGGC
GCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGATTT
GATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAACAAT
TGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGGCAC
TGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTATGCTGGACCCAGTAAGATGAGGAAGTCGGGC
AGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTGGCTCTGGACCTGCATTAAAATGGGTTTCACT
GTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGATGTGGTTTTTCACATTTAAGATAATTATGGC

>In-frame_SEMA4A_ENST00000368284_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_1961nt
AGCTCCCAGTGCTGGCTTTGGCATGATGGGCACCTGGAGGGCCGCACTCCCGTTCCAGCCAGGCTGAGCCTTCTGTCCCCTGCCTCTGGG
GCCTGGGAACCCCCCTTCTTCTTTCTCCTGAATGGCACCCCCGCCCTAGAATCCAGACACCGAGTTTCCCACTGTGGCTGGTTCAAGGGT
ATGTGAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGCCTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAAT
ACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAGGATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCA
GCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAATGAGGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGAC
AAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACT
ATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTG
CATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTT
GAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTG
AAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCT
CCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAA
CGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGC
AGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATA
ACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTG
GCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTT
CACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGG
AAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCA
AAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTG
CTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGA
CATCTGCTTTATGCTGGACCCAGTAAGATGAGGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAG
GACTGCAGTTGGCTCTGGACCTGCATTAAAATGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATC

>In-frame_SEMA4A_ENST00000368284_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_2445nt
AGCTCCCAGTGCTGGCTTTGGCATGATGGGCACCTGGAGGGCCGCACTCCCGTTCCAGCCAGGCTGAGCCTTCTGTCCCCTGCCTCTGGG
GCCTGGGAACCCCCCTTCTTCTTTCTCCTGAATGGCACCCCCGCCCTAGAATCCAGACACCGAGTTTCCCACTGTGGCTGGTTCAAGGGT
ATGTGAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGCCTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAAT
ACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAGGATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCA
GCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAATGAGGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGAC
AAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACT
ATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTG
CATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTT
GAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTG
AAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCT
CCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAA
CGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGC
AGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATA
ACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTG
GCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTT
CACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGG
AAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCA
AAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTG
CTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGA
CATCTGCTTTATGCTGGACCCAGTAAGATGAGGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAG
GACTGCAGTTGGCTCTGGACCTGCATTAAAATGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATC
AGTTTATTGGATGTGGTTTTTCACATTTAAGATAATTATGGCTCTTTTCCTAAAAAATAAAATATCTTTCTAAAGTGTTGTGTTAGATTA
ATAATATGGAAGGAGTCTTTAGATTGGCCAAATTGCATTTCTCTGATATTCCTCTTGTTGCAGGTCAGAAGAGATCAATTCTACAGAAAT
TTCCAGTGGTTCTGTTGAGGCTTTATGGAATTCAGCATGTCAAAATTCACAGCTGGCTGGGCACAGTGGCTCATGCCTGTAATCCCAGCA
CTTTGGAAGCCCAAGGCGGGCAGACTGCTTGAGTTCAGGAGTTTGCAACCAGCCTGGGCAACATGGTGAAAACCTGTCTCTACTAAAAAT
ACAAAAATTAGCCGGGCACGGTGGCATGCGCCTGTAATCCAAGCTACTTGGGAGGCTGAGGCAGGAGAATTGCTTCAACTTGGGAGGCGG
ATGTTGCAGTGAGCCAAAATTGCACCACTGCACTCCAGCCTGGGCAGCAGAGCAAGACTCCGTCTCAAAATAAATAAATAAATAAATAAA

>In-frame_SEMA4A_ENST00000368284_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_1961nt
AGCTCCCAGTGCTGGCTTTGGCATGATGGGCACCTGGAGGGCCGCACTCCCGTTCCAGCCAGGCTGAGCCTTCTGTCCCCTGCCTCTGGG
GCCTGGGAACCCCCCTTCTTCTTTCTCCTGAATGGCACCCCCGCCCTAGAATCCAGACACCGAGTTTCCCACTGTGGCTGGTTCAAGGGT
ATGTGAGGGGATGAACGTAGGGCACTTAGCTTCTTCCACCAGAAGGGCCTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAAT
ACTCTCTACGTGGGGGCTCGAGAAGCCATTCTGGCCTTGGATATCCAGGATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCA
GCCAGTGACAGAAAAAAGAGTGAATGTGCCTTTAAGAAGAAGAGCAATGAGGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGAC
AAGGTCATGGAGGGAAAAGGCCAAAGCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACT
ATGAACAACTTCCTGGGCAGTGAGCCCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTG
CATCATGACGCCTCCTTTGTGGCAGCCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTT
GAGAGGCTCCACACATCGCGGGTGGCTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTG
AAGGCCCAGCTGCTCTGCACCCAGCCGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCT
CCCCACATCTACGCAGTCTTCACCTCCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAA
CGTGTCTTTAAGGGGAAATACAAAGAGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGC
AGTATAAAAGTTCAAGAGAAGTATGTCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATA
ACACGGGTGAGGAACGCCACAGATGCAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTG
GCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTT
CACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGG
AAAGCCTATCTGCCCCAGGAGTTGCTGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCA
AAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTG
CTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGA
CATCTGCTTTATGCTGGACCCAGTAAGATGAGGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAG
GACTGCAGTTGGCTCTGGACCTGCATTAAAATGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATC

>In-frame_SEMA4A_ENST00000368286_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_2110nt
GGCATGATGGGCACCTGGAGGGCCGCACTCCCGTTCCAGCCAGGCTGAGCCTTCTGTCCCCTGCCTCTGGGGCCTGGGAACCCCCCTTCT
TCTTTCTCCTGAATGGCACCCCCGCCCTAGAATCCAGACACCGAGTTTCCCACTGTGGCTGGTTCAAGGGTATGTGAGAGCTCCCTGGTG
ACAGTCTGTGGCTGAGCATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGC
TGCTGCCGACGACGACCGCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCT
TCTTCCACCAGAAGGGCCTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTC
TGGCCTTGGATATCCAGGATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCT
TTAAGAAGAAGAGCAATGAGGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCT
TTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCC
TGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCC
CTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAG
TCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGC
AGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGT
GGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGA
ACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGA
ATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTG
GAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAA
GAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATT
GGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAA
AGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATT
TGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGC
TGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTATGCTGGACCCAGTAAGATGA
GGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTGGCTCTGGACCTGCATTAAAA
TGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGATGTGGTTTTTCACATTTAAG

>In-frame_SEMA4A_ENST00000368286_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_2594nt
GGCATGATGGGCACCTGGAGGGCCGCACTCCCGTTCCAGCCAGGCTGAGCCTTCTGTCCCCTGCCTCTGGGGCCTGGGAACCCCCCTTCT
TCTTTCTCCTGAATGGCACCCCCGCCCTAGAATCCAGACACCGAGTTTCCCACTGTGGCTGGTTCAAGGGTATGTGAGAGCTCCCTGGTG
ACAGTCTGTGGCTGAGCATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGC
TGCTGCCGACGACGACCGCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCT
TCTTCCACCAGAAGGGCCTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTC
TGGCCTTGGATATCCAGGATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCT
TTAAGAAGAAGAGCAATGAGGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCT
TTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCC
TGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCC
CTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAG
TCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGC
AGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGT
GGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGA
ACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGA
ATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTG
GAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAA
GAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATT
GGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAA
AGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATT
TGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGC
TGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTATGCTGGACCCAGTAAGATGA
GGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTGGCTCTGGACCTGCATTAAAA
TGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGATGTGGTTTTTCACATTTAAG
ATAATTATGGCTCTTTTCCTAAAAAATAAAATATCTTTCTAAAGTGTTGTGTTAGATTAATAATATGGAAGGAGTCTTTAGATTGGCCAA
ATTGCATTTCTCTGATATTCCTCTTGTTGCAGGTCAGAAGAGATCAATTCTACAGAAATTTCCAGTGGTTCTGTTGAGGCTTTATGGAAT
TCAGCATGTCAAAATTCACAGCTGGCTGGGCACAGTGGCTCATGCCTGTAATCCCAGCACTTTGGAAGCCCAAGGCGGGCAGACTGCTTG
AGTTCAGGAGTTTGCAACCAGCCTGGGCAACATGGTGAAAACCTGTCTCTACTAAAAATACAAAAATTAGCCGGGCACGGTGGCATGCGC
CTGTAATCCAAGCTACTTGGGAGGCTGAGGCAGGAGAATTGCTTCAACTTGGGAGGCGGATGTTGCAGTGAGCCAAAATTGCACCACTGC

>In-frame_SEMA4A_ENST00000368286_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_2110nt
GGCATGATGGGCACCTGGAGGGCCGCACTCCCGTTCCAGCCAGGCTGAGCCTTCTGTCCCCTGCCTCTGGGGCCTGGGAACCCCCCTTCT
TCTTTCTCCTGAATGGCACCCCCGCCCTAGAATCCAGACACCGAGTTTCCCACTGTGGCTGGTTCAAGGGTATGTGAGAGCTCCCTGGTG
ACAGTCTGTGGCTGAGCATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACTGCTTCAGCTGC
TGCTGCCGACGACGACCGCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAGGGCACTTAGCT
TCTTCCACCAGAAGGGCCTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCGAGAAGCCATTC
TGGCCTTGGATATCCAGGATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAGTGAATGTGCCT
TTAAGAAGAAGAGCAATGAGGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGAGGGAAAAGGCCAAAGCCCCT
TTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTTCCTGGGCAGTGAGCCCATCC
TGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGCCTCCTTTGTGGCAGCCATCC
CTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCACACATCGCGGGTGGCTAGAG
TCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCTGCTCTGCACCCAGCCGGGGC
AGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTACGCAGTCTTCACCTCCCAGT
GGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAAGGGGAAATACAAAGAGTTGA
ACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGTTCAAGAGAAGTATGTCTGGA
ATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAGGAACGCCACAGATGCAGTTG
GAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAA
GAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATT
GGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGAGTTGCTGGGAA
AGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGAAAGTTGTATTCAGTATTATT
TGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGC
TGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTATGCTGGACCCAGTAAGATGA
GGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTGGCTCTGGACCTGCATTAAAA
TGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGATGTGGTTTTTCACATTTAAG

>In-frame_SEMA4A_ENST00000368282_chr1_156132885_+_DAP3_ENST00000471642_chr1_155698833_+_2220nt
AGGATGATGAAAGTGAGACCGTCTTAGGGCCCTTCCAGATAGGGAACCTTCTCTGCCCCAATGCCCCACCCCTGCCACCAATACACACGC
TTCTGCTGCCTGGGGCTCTCCTATTGGTCCTCGGGGGGATGTGGTAAGAACTGCTCACCCAGAAAGTGCCCGGGTGCCTGTTTCCCCAGA
GCTCCCTGGTGACAGTCTGTGGCTGAGCATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACT
GCTTCAGCTGCTGCTGCCGACGACGACCGCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAG
GGCACTTAGCTTCTTCCACCAGAAGGGCCTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCG
AGAAGCCATTCTGGCCTTGGATATCCAGGATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAG
TGAATGTGCCTTTAAGAAGAAGAGCAATGAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACAC
CTGCGGCACCTTCGCCTTCAGCCCTGCTTGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGA
GGGAAAAGGCCAAAGCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTT
CCTGGGCAGTGAGCCCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGC
CTCCTTTGTGGCAGCCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCA
CACATCGCGGGTGGCTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCT
GCTCTGCACCCAGCCGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTA
CGCAGTCTTCACCTCCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAA
GGGGAAATACAAAGAGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGT
TCAAGAGAAGTATGTCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAG
GAACGCCACAGATGCAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGG
AATCAATGCTCTTTGGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAG
GAAAATGATGAAAAATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCT
GCCCCAGGAGTTGCTGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGA
AAGTTGTATTCAGTATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAG
TAACGCGAACCCCTCGCTGCTGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTA
TGCTGGACCCAGTAAGATGAGGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTG
GCTCTGGACCTGCATTAAAATGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGA

>In-frame_SEMA4A_ENST00000368282_chr1_156132885_+_DAP3_ENST00000368336_chr1_155698833_+_2704nt
AGGATGATGAAAGTGAGACCGTCTTAGGGCCCTTCCAGATAGGGAACCTTCTCTGCCCCAATGCCCCACCCCTGCCACCAATACACACGC
TTCTGCTGCCTGGGGCTCTCCTATTGGTCCTCGGGGGGATGTGGTAAGAACTGCTCACCCAGAAAGTGCCCGGGTGCCTGTTTCCCCAGA
GCTCCCTGGTGACAGTCTGTGGCTGAGCATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACT
GCTTCAGCTGCTGCTGCCGACGACGACCGCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAG
GGCACTTAGCTTCTTCCACCAGAAGGGCCTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCG
AGAAGCCATTCTGGCCTTGGATATCCAGGATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAG
TGAATGTGCCTTTAAGAAGAAGAGCAATGAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACAC
CTGCGGCACCTTCGCCTTCAGCCCTGCTTGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGA
GGGAAAAGGCCAAAGCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTT
CCTGGGCAGTGAGCCCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGC
CTCCTTTGTGGCAGCCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCA
CACATCGCGGGTGGCTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCT
GCTCTGCACCCAGCCGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTA
CGCAGTCTTCACCTCCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAA
GGGGAAATACAAAGAGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGT
TCAAGAGAAGTATGTCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAG
GAACGCCACAGATGCAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGG
AATCAATGCTCTTTGGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAG
GAAAATGATGAAAAATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCT
GCCCCAGGAGTTGCTGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGA
AAGTTGTATTCAGTATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAG
TAACGCGAACCCCTCGCTGCTGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTA
TGCTGGACCCAGTAAGATGAGGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTG
GCTCTGGACCTGCATTAAAATGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGA
TGTGGTTTTTCACATTTAAGATAATTATGGCTCTTTTCCTAAAAAATAAAATATCTTTCTAAAGTGTTGTGTTAGATTAATAATATGGAA
GGAGTCTTTAGATTGGCCAAATTGCATTTCTCTGATATTCCTCTTGTTGCAGGTCAGAAGAGATCAATTCTACAGAAATTTCCAGTGGTT
CTGTTGAGGCTTTATGGAATTCAGCATGTCAAAATTCACAGCTGGCTGGGCACAGTGGCTCATGCCTGTAATCCCAGCACTTTGGAAGCC
CAAGGCGGGCAGACTGCTTGAGTTCAGGAGTTTGCAACCAGCCTGGGCAACATGGTGAAAACCTGTCTCTACTAAAAATACAAAAATTAG
CCGGGCACGGTGGCATGCGCCTGTAATCCAAGCTACTTGGGAGGCTGAGGCAGGAGAATTGCTTCAACTTGGGAGGCGGATGTTGCAGTG
AGCCAAAATTGCACCACTGCACTCCAGCCTGGGCAGCAGAGCAAGACTCCGTCTCAAAATAAATAAATAAATAAATAAATAAATAAATAA

>In-frame_SEMA4A_ENST00000368282_chr1_156132885_+_DAP3_ENST00000343043_chr1_155698833_+_2220nt
AGGATGATGAAAGTGAGACCGTCTTAGGGCCCTTCCAGATAGGGAACCTTCTCTGCCCCAATGCCCCACCCCTGCCACCAATACACACGC
TTCTGCTGCCTGGGGCTCTCCTATTGGTCCTCGGGGGGATGTGGTAAGAACTGCTCACCCAGAAAGTGCCCGGGTGCCTGTTTCCCCAGA
GCTCCCTGGTGACAGTCTGTGGCTGAGCATGGCCCTCCCAGCCCTGGGCCTGGACCCCTGGAGCCTCCTGGGCCTTTTCCTCTTCCAACT
GCTTCAGCTGCTGCTGCCGACGACGACCGCGGGGGGAGGCGGGCAGGGGCCCATGCCCAGGGTCAGATACTATGCAGGGGATGAACGTAG
GGCACTTAGCTTCTTCCACCAGAAGGGCCTCCAGGATTTTGACACTCTGCTCCTGAGTGGTGATGGAAATACTCTCTACGTGGGGGCTCG
AGAAGCCATTCTGGCCTTGGATATCCAGGATCCAGGGGTCCCCAGGCTAAAGAACATGATACCGTGGCCAGCCAGTGACAGAAAAAAGAG
TGAATGTGCCTTTAAGAAGAAGAGCAATGAGACACAGTGTTTCAACTTCATCCGTGTCCTGGTTTCTTACAATGTCACCCATCTCTACAC
CTGCGGCACCTTCGCCTTCAGCCCTGCTTGTACCTTCATTGAACTTCAAGATTCCTACCTGTTGCCCATCTCGGAGGACAAGGTCATGGA
GGGAAAAGGCCAAAGCCCCTTTGACCCCGCTCACAAGCATACGGCTGTCTTGGTGGATGGGATGCTCTATTCTGGTACTATGAACAACTT
CCTGGGCAGTGAGCCCATCCTGATGCGCACACTGGGATCCCAGCCTGTCCTCAAGACCGACAACTTCCTCCGCTGGCTGCATCATGACGC
CTCCTTTGTGGCAGCCATCCCTTCGACCCAGGTCGTCTACTTCTTCTTCGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAGAGGCTCCA
CACATCGCGGGTGGCTAGAGTCTGCAAGAATGACGTGGGCGGCGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTGAAGGCCCAGCT
GCTCTGCACCCAGCCGGGGCAGCTGCCCTTCAACGTCATCCGCCACGCGGTCCTGCTCCCCGCCGATTCTCCCACAGCTCCCCACATCTA
CGCAGTCTTCACCTCCCAGTGGCAGGTTGGCGGGACCAGGAGCTCTGCGGTTTGTGCCTTCTCTCTCTTGGACATTGAACGTGTCTTTAA
GGGGAAATACAAAGAGTTGAACAAAGAAACTTCACGCTGGACTACTTATAGGGGCCCTGAGACCAACCCCCGGCCAGGCAGTATAAAAGT
TCAAGAGAAGTATGTCTGGAATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGAG
GAACGCCACAGATGCAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCACCTCCTAGTGGCCGTGGATGG
AATCAATGCTCTTTGGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGCCCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAG
GAAAATGATGAAAAATGATTGGCATGGAGGCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCT
GCCCCAGGAGTTGCTGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCAAAGGAATTTGA
AAGTTGTATTCAGTATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAG
TAACGCGAACCCCTCGCTGCTGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTA
TGCTGGACCCAGTAAGATGAGGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTG
GCTCTGGACCTGCATTAAAATGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGA


Top

FusionGenePPI for SEMA4A_DAP3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SEMA4ADDX54DAP3CNBP, NR3C1, PPARA, HSP90AA1, HIF1A, AHR, ESR1, ESR2, PGR, THRA, AR, DAP3, TNFRSF10A, TNFRSF25, FADD, UBC, ICT1, DYRK2, MRPS27, STOML2, COX5A, YME1L1, C1QBP, SOX2, TARDBP, PARK2, GRSF1, CEP250, HAUS2, VCP, FBXW11, BTRC, TRA2A, RPL6, ZC3H3, RPS8, TRMT10B, HNRNPA1, ZNF707, MRPS31, MRPS35, MRPS10, WDFY2, MTIF2, PNMA6A, MRPS5, NTRK1, PTCD3, MRPS18B, MRPS2, MRPS22, MRPS23, MRPS28, MRPS9, LYST, COL4A5, CSNK1D, MBNL1, PYCR1, HNRNPU, MAGEA1, AP3D1, POC1A, MRPS11, ZNF746, DUSP11, MRPS34, MRPS15, AURKAIP1, RRS1, ZBTB48, E4F1, BHLHA15, FGF8, ZNF331, U2AF2, ZNF324B, ZNF133, ZNF408, SNRNP70, CCDC59, GLTSCR2, RBM3, NCL, DLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SEMA4A_DAP3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SEMA4A_DAP3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSEMA4AC1853214RETINITIS PIGMENTOSA 351CTD_human;UNIPROT
TgeneDAP3C1458155Mammary Neoplasms1CTD_human