FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33143

FusionGeneSummary for SEMA3F_RBM6

check button Fusion gene summary
Fusion gene informationFusion gene name: SEMA3F_RBM6
Fusion gene ID: 33143
HgeneTgene
Gene symbol

SEMA3F

RBM6

Gene ID

6405

10180

Gene namesemaphorin 3FRNA binding motif protein 6
SynonymsSEMA-IV|SEMA4|SEMAK3G2|DEF-3|DEF3|HLC-11|NY-LU-12|g16
Cytomap

3p21.31

3p21.31

Type of geneprotein-codingprotein-coding
Descriptionsemaphorin-3Fsema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Fsema domain, immunoglobulin domain (Ig), short basic domain, secreted, 3Fsemaphorin III/Fsemaphorin IVRNA-binding protein 6RNA-binding protein DEF-3lung cancer antigen NY-LU-12lung cancer protooncogene 11
Modification date2018052320180519
UniProtAcc

Q13275

P78332

Ensembl transtripts involved in fusion geneENST00000413852, ENST00000002829, 
ENST00000434342, 
ENST00000442092, 
ENST00000266022, ENST00000443081, 
ENST00000539992, ENST00000441115, 
ENST00000422955, ENST00000421682, 
Fusion gene scores* DoF score4 X 5 X 5=10010 X 8 X 8=640
# samples 611
** MAII scorelog2(6/100*10)=-0.736965594166206
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/640*10)=-2.5405683813627
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SEMA3F [Title/Abstract] AND RBM6 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSEMA3F

GO:0007411

axon guidance

15814794


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-55-6969-01ASEMA3Fchr3

50212621

+RBM6chr3

50085678

+
TCGARVLUSCTCGA-37-4135-01ASEMA3Fchr3

50197167

+RBM6chr3

50085678

+
TCGARVUCSTCGA-N5-A4RO-01ASEMA3Fchr3

50214294

+RBM6chr3

50095161

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-5UTRENST00000413852ENST00000442092SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
intron-5UTRENST00000413852ENST00000266022SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
intron-5UTRENST00000413852ENST00000443081SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
intron-intronENST00000413852ENST00000539992SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
intron-3UTRENST00000413852ENST00000441115SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
intron-5UTRENST00000413852ENST00000422955SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
intron-intronENST00000413852ENST00000421682SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
5CDS-5UTRENST00000002829ENST00000442092SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
5CDS-5UTRENST00000002829ENST00000266022SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
5CDS-5UTRENST00000002829ENST00000443081SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
5CDS-intronENST00000002829ENST00000539992SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
5CDS-3UTRENST00000002829ENST00000441115SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
5CDS-5UTRENST00000002829ENST00000422955SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
5CDS-intronENST00000002829ENST00000421682SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
intron-5UTRENST00000434342ENST00000442092SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
intron-5UTRENST00000434342ENST00000266022SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
intron-5UTRENST00000434342ENST00000443081SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
intron-intronENST00000434342ENST00000539992SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
intron-3UTRENST00000434342ENST00000441115SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
intron-5UTRENST00000434342ENST00000422955SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
intron-intronENST00000434342ENST00000421682SEMA3Fchr3

50212621

+RBM6chr3

50085678

+
5UTR-5UTRENST00000413852ENST00000442092SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5UTR-5UTRENST00000413852ENST00000266022SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5UTR-5UTRENST00000413852ENST00000443081SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5UTR-intronENST00000413852ENST00000539992SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5UTR-3UTRENST00000413852ENST00000441115SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5UTR-5UTRENST00000413852ENST00000422955SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5UTR-intronENST00000413852ENST00000421682SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-5UTRENST00000002829ENST00000442092SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-5UTRENST00000002829ENST00000266022SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-5UTRENST00000002829ENST00000443081SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-intronENST00000002829ENST00000539992SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-3UTRENST00000002829ENST00000441115SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-5UTRENST00000002829ENST00000422955SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-intronENST00000002829ENST00000421682SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-5UTRENST00000434342ENST00000442092SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-5UTRENST00000434342ENST00000266022SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-5UTRENST00000434342ENST00000443081SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-intronENST00000434342ENST00000539992SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-3UTRENST00000434342ENST00000441115SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-5UTRENST00000434342ENST00000422955SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
5CDS-intronENST00000434342ENST00000421682SEMA3Fchr3

50197167

+RBM6chr3

50085678

+
In-frameENST00000413852ENST00000442092SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
In-frameENST00000413852ENST00000266022SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
In-frameENST00000413852ENST00000443081SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
5CDS-5UTRENST00000413852ENST00000539992SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
5CDS-3UTRENST00000413852ENST00000441115SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
5CDS-3UTRENST00000413852ENST00000422955SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
5CDS-intronENST00000413852ENST00000421682SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
In-frameENST00000002829ENST00000442092SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
In-frameENST00000002829ENST00000266022SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
In-frameENST00000002829ENST00000443081SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
5CDS-5UTRENST00000002829ENST00000539992SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
5CDS-3UTRENST00000002829ENST00000441115SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
5CDS-3UTRENST00000002829ENST00000422955SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
5CDS-intronENST00000002829ENST00000421682SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
In-frameENST00000434342ENST00000442092SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
In-frameENST00000434342ENST00000266022SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
In-frameENST00000434342ENST00000443081SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
5CDS-5UTRENST00000434342ENST00000539992SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
5CDS-3UTRENST00000434342ENST00000441115SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
5CDS-3UTRENST00000434342ENST00000422955SEMA3Fchr3

50214294

+RBM6chr3

50095161

+
5CDS-intronENST00000434342ENST00000421682SEMA3Fchr3

50214294

+RBM6chr3

50095161

+

Top

FusionProtFeatures for SEMA3F_RBM6


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SEMA3F

Q13275

RBM6

P78332

May play a role in cell motility and cell adhesion. Specifically binds poly(G) RNA homopolymers in vitro.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRBM6chr3:50214294chr3:50095161ENST00000266022+721826_8295641124Compositional biasNote=Poly-Glu
TgeneRBM6chr3:50214294chr3:50095161ENST00000266022+721892_8955641124Compositional biasNote=Poly-Pro
TgeneRBM6chr3:50214294chr3:50095161ENST00000266022+721915_9215641124Compositional biasNote=Poly-Glu
TgeneRBM6chr3:50214294chr3:50095161ENST00000422955+519826_82942602Compositional biasNote=Poly-Glu
TgeneRBM6chr3:50214294chr3:50095161ENST00000422955+519892_89542602Compositional biasNote=Poly-Pro
TgeneRBM6chr3:50214294chr3:50095161ENST00000422955+519915_92142602Compositional biasNote=Poly-Glu
TgeneRBM6chr3:50214294chr3:50095161ENST00000442092+317826_82942602Compositional biasNote=Poly-Glu
TgeneRBM6chr3:50214294chr3:50095161ENST00000442092+317892_89542602Compositional biasNote=Poly-Pro
TgeneRBM6chr3:50214294chr3:50095161ENST00000442092+317915_92142602Compositional biasNote=Poly-Glu
TgeneRBM6chr3:50214294chr3:50095161ENST00000266022+7211051_10975641124DomainG-patch
TgeneRBM6chr3:50214294chr3:50095161ENST00000422955+5191051_109742602DomainG-patch
TgeneRBM6chr3:50214294chr3:50095161ENST00000422955+519456_53642602DomainRRM
TgeneRBM6chr3:50214294chr3:50095161ENST00000442092+3171051_109742602DomainG-patch
TgeneRBM6chr3:50214294chr3:50095161ENST00000442092+317456_53642602DomainRRM

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSEMA3Fchr3:50214294chr3:50095161ENST00000002829+719758_779214786Compositional biasNote=Arg/Lys-rich (basic)
HgeneSEMA3Fchr3:50214294chr3:50095161ENST00000434342+618758_779183755Compositional biasNote=Arg/Lys-rich (basic)
HgeneSEMA3Fchr3:50214294chr3:50095161ENST00000002829+71931_545214786DomainSema
HgeneSEMA3Fchr3:50214294chr3:50095161ENST00000002829+719605_690214786DomainNote=Ig-like C2-type
HgeneSEMA3Fchr3:50214294chr3:50095161ENST00000434342+61831_545183755DomainSema
HgeneSEMA3Fchr3:50214294chr3:50095161ENST00000434342+618605_690183755DomainNote=Ig-like C2-type
TgeneRBM6chr3:50214294chr3:50095161ENST00000266022+721456_5365641124DomainRRM


Top

FusionGeneSequence for SEMA3F_RBM6


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SEMA3F_ENST00000413852_chr3_50214294_+_RBM6_ENST00000442092_chr3_50095161_+_675aa
MYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDVNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQDYIFYL
EPERLESGKGKCPYDPKLDTASALIMTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADKEPEPRKREEGQESRLGHQKREAERYLPPS
RREGPTFRRDRERESWSGETRQDGESKTIMLKRIYRSTPPEVIVEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHAEALRVVKIL
QNLDPPFSIDGKMVAVNLATGKRRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNRQGQQSSSDCYIYDSATGYYYDPLAGTYYD
PNTQQEVYVPQDPGLPEEEEIKEKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVN
PLIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLHKQNLEIHRK
IKQSEQELAYLERREREGKFKGRGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLAS

>In-frame_SEMA3F_ENST00000413852_chr3_50214294_+_RBM6_ENST00000266022_chr3_50095161_+_675aa
MYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDVNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQDYIFYL
EPERLESGKGKCPYDPKLDTASALIMTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADKEPEPRKREEGQESRLGHQKREAERYLPPS
RREGPTFRRDRERESWSGETRQDGESKTIMLKRIYRSTPPEVIVEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHAEALRVVKIL
QNLDPPFSIDGKMVAVNLATGKRRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNRQGQQSSSDCYIYDSATGYYYDPLAGTYYD
PNTQQEVYVPQDPGLPEEEEIKEKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVN
PLIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLHKQNLEIHRK
IKQSEQELAYLERREREGKFKGRGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLAS

>In-frame_SEMA3F_ENST00000413852_chr3_50214294_+_RBM6_ENST00000443081_chr3_50095161_+_675aa
MYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDVNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQDYIFYL
EPERLESGKGKCPYDPKLDTASALIMTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADKEPEPRKREEGQESRLGHQKREAERYLPPS
RREGPTFRRDRERESWSGETRQDGESKTIMLKRIYRSTPPEVIVEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHAEALRVVKIL
QNLDPPFSIDGKMVAVNLATGKRRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNRQGQQSSSDCYIYDSATGYYYDPLAGTYYD
PNTQQEVYVPQDPGLPEEEEIKEKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVN
PLIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLHKQNLEIHRK
IKQSEQELAYLERREREGKFKGRGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLAS

>In-frame_SEMA3F_ENST00000002829_chr3_50214294_+_RBM6_ENST00000442092_chr3_50095161_+_774aa
MLVAGLLLWASLLTGAWPSFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRILLKDEDHDRMYVGSKDYVLSLDLHDINREPL
IIHWAASPQRIEECVLSGKDVNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQATPWTQTQAVRGRGSRATDGALRPMPTA
PRQDYIFYLEPERLESGKGKCPYDPKLDTASALIMTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADKEPEPRKREEGQESRLGHQKR
EAERYLPPSRREGPTFRRDRERESWSGETRQDGESKTIMLKRIYRSTPPEVIVEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHA
EALRVVKILQNLDPPFSIDGKMVAVNLATGKRRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNRQGQQSSSDCYIYDSATGYYY
DPLAGTYYDPNTQQEVYVPQDPGLPEEEEIKEKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEE
SPPPPKVVNPLIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLH
KQNLEIHRKIKQSEQELAYLERREREGKFKGRGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGL

>In-frame_SEMA3F_ENST00000002829_chr3_50214294_+_RBM6_ENST00000266022_chr3_50095161_+_774aa
MLVAGLLLWASLLTGAWPSFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRILLKDEDHDRMYVGSKDYVLSLDLHDINREPL
IIHWAASPQRIEECVLSGKDVNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQATPWTQTQAVRGRGSRATDGALRPMPTA
PRQDYIFYLEPERLESGKGKCPYDPKLDTASALIMTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADKEPEPRKREEGQESRLGHQKR
EAERYLPPSRREGPTFRRDRERESWSGETRQDGESKTIMLKRIYRSTPPEVIVEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHA
EALRVVKILQNLDPPFSIDGKMVAVNLATGKRRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNRQGQQSSSDCYIYDSATGYYY
DPLAGTYYDPNTQQEVYVPQDPGLPEEEEIKEKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEE
SPPPPKVVNPLIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLH
KQNLEIHRKIKQSEQELAYLERREREGKFKGRGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGL

>In-frame_SEMA3F_ENST00000002829_chr3_50214294_+_RBM6_ENST00000443081_chr3_50095161_+_774aa
MLVAGLLLWASLLTGAWPSFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRILLKDEDHDRMYVGSKDYVLSLDLHDINREPL
IIHWAASPQRIEECVLSGKDVNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQATPWTQTQAVRGRGSRATDGALRPMPTA
PRQDYIFYLEPERLESGKGKCPYDPKLDTASALIMTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADKEPEPRKREEGQESRLGHQKR
EAERYLPPSRREGPTFRRDRERESWSGETRQDGESKTIMLKRIYRSTPPEVIVEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHA
EALRVVKILQNLDPPFSIDGKMVAVNLATGKRRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNRQGQQSSSDCYIYDSATGYYY
DPLAGTYYDPNTQQEVYVPQDPGLPEEEEIKEKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEE
SPPPPKVVNPLIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLH
KQNLEIHRKIKQSEQELAYLERREREGKFKGRGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGL

>In-frame_SEMA3F_ENST00000434342_chr3_50214294_+_RBM6_ENST00000442092_chr3_50095161_+_743aa
MLVAGLLLWASLLTGAWPSFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRILLKDEDHDRMYVGSKDYVLSLDLHDINREPL
IIHWAASPQRIEECVLSGKDVNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQDYIFYLEPERLESGKGKCPYDPKLDTAS
ALIMTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADKEPEPRKREEGQESRLGHQKREAERYLPPSRREGPTFRRDRERESWSGETRQ
DGESKTIMLKRIYRSTPPEVIVEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHAEALRVVKILQNLDPPFSIDGKMVAVNLATGK
RRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNRQGQQSSSDCYIYDSATGYYYDPLAGTYYDPNTQQEVYVPQDPGLPEEEEIK
EKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVNPLIGLLGEYGGDSDYEEEEEEE
QTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLHKQNLEIHRKIKQSEQELAYLERREREGKFKG
RGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKR

>In-frame_SEMA3F_ENST00000434342_chr3_50214294_+_RBM6_ENST00000266022_chr3_50095161_+_743aa
MLVAGLLLWASLLTGAWPSFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRILLKDEDHDRMYVGSKDYVLSLDLHDINREPL
IIHWAASPQRIEECVLSGKDVNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQDYIFYLEPERLESGKGKCPYDPKLDTAS
ALIMTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADKEPEPRKREEGQESRLGHQKREAERYLPPSRREGPTFRRDRERESWSGETRQ
DGESKTIMLKRIYRSTPPEVIVEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHAEALRVVKILQNLDPPFSIDGKMVAVNLATGK
RRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNRQGQQSSSDCYIYDSATGYYYDPLAGTYYDPNTQQEVYVPQDPGLPEEEEIK
EKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVNPLIGLLGEYGGDSDYEEEEEEE
QTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLHKQNLEIHRKIKQSEQELAYLERREREGKFKG
RGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKR

>In-frame_SEMA3F_ENST00000434342_chr3_50214294_+_RBM6_ENST00000443081_chr3_50095161_+_743aa
MLVAGLLLWASLLTGAWPSFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRILLKDEDHDRMYVGSKDYVLSLDLHDINREPL
IIHWAASPQRIEECVLSGKDVNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQDYIFYLEPERLESGKGKCPYDPKLDTAS
ALIMTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADKEPEPRKREEGQESRLGHQKREAERYLPPSRREGPTFRRDRERESWSGETRQ
DGESKTIMLKRIYRSTPPEVIVEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHAEALRVVKILQNLDPPFSIDGKMVAVNLATGK
RRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNRQGQQSSSDCYIYDSATGYYYDPLAGTYYDPNTQQEVYVPQDPGLPEEEEIK
EKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVNPLIGLLGEYGGDSDYEEEEEEE
QTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLHKQNLEIHRKIKQSEQELAYLERREREGKFKG
RGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SEMA3F_ENST00000413852_chr3_50214294_+_RBM6_ENST00000442092_chr3_50095161_+_2025nt
ATGTACGTGGGCAGCAAGGACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTCATTATACACTGGGCAGCCTCCCCA
CAGCGCATCGAGGAATGCGTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGGCTCATCCAGCCCTGGAACCGAACA
CACCTGTATGTGTGCGGGACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGCGCCCAGGATTACATCTTCTACCTG
GAGCCTGAGCGACTCGAGTCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCGGCCCTCATCATGACAGAGGCCAAG
CAAGAATTAATAACCTACCCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAGCCCAACCAGCCCCTAAGACCAGCTGAT
AAGGAACCTGAACCCAGGAAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAAGCAGAAAGGTATCTGCCTCCTTCT
CGAAGGGAAGGGCCAACTTTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAGGATGGAGAGAGCAAAACTATCATG
CTAAAGCGTATCTATCGTTCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGCCTTACTACTGCCAACGTCCGTATC
ATCAAGAACAGAACAGGCCCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCGGAAGCTCTTCGTGTGGTGAAGATCTTA
CAGAACCTTGATCCGCCATTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAGAAATGATTCTGGGGACCAT
TCTGACCACATGCATTACTATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAATTCAGACTGGTCTTCAGATACAAAT
CGACAAGGACAACAGTCATCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTATGACCCCTTGGCAGGAACTTATTATGAC
CCCAATACCCAGCAAGAAGTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAGGAAAAAAAACCCACCAGTCAAGGA
AAGTCAAGTAGCAAGAAGGAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACGAGGTTTCAGGAAAATGCCAGTGAA
GGGAAGGCCCCTGCAGAAGACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGTCCCCCTCCACCTAAAGTGGTAAAC
CCACTGATCGGCCTCTTGGGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAACAGACCCCTCCCCCACAGCCCCGC
ACAGCACAGCCCCAGAAGCGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACTGACTGGAATAAACTGGCTTGTCTGCTT
TGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAGCAAAACCTGGAAATCCACCGGAAG
ATAAAACAGTCTGAGCAGGAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGAAGAGGAAATGATCGCAGGGAAAAG
CTCCAGTCTTTTGACTCTCCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGTAAACTTGTTGATAAAGAAGATATC
GACACTAGCAGCAAAGGAGGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGATATGGCCATCCTGGATTGGCTTCA
TCAGAGGAGGCTGAAGGCCGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGACAGTCCAACGAGACTTACCGAGAT

>In-frame_SEMA3F_ENST00000413852_chr3_50214294_+_RBM6_ENST00000266022_chr3_50095161_+_2025nt
ATGTACGTGGGCAGCAAGGACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTCATTATACACTGGGCAGCCTCCCCA
CAGCGCATCGAGGAATGCGTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGGCTCATCCAGCCCTGGAACCGAACA
CACCTGTATGTGTGCGGGACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGCGCCCAGGATTACATCTTCTACCTG
GAGCCTGAGCGACTCGAGTCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCGGCCCTCATCATGACAGAGGCCAAG
CAAGAATTAATAACCTACCCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAGCCCAACCAGCCCCTAAGACCAGCTGAT
AAGGAACCTGAACCCAGGAAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAAGCAGAAAGGTATCTGCCTCCTTCT
CGAAGGGAAGGGCCAACTTTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAGGATGGAGAGAGCAAAACTATCATG
CTAAAGCGTATCTATCGTTCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGCCTTACTACTGCCAACGTCCGTATC
ATCAAGAACAGAACAGGCCCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCGGAAGCTCTTCGTGTGGTGAAGATCTTA
CAGAACCTTGATCCGCCATTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAGAAATGATTCTGGGGACCAT
TCTGACCACATGCATTACTATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAATTCAGACTGGTCTTCAGATACAAAT
CGACAAGGACAACAGTCATCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTATGACCCCTTGGCAGGAACTTATTATGAC
CCCAATACCCAGCAAGAAGTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAGGAAAAAAAACCCACCAGTCAAGGA
AAGTCAAGTAGCAAGAAGGAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACGAGGTTTCAGGAAAATGCCAGTGAA
GGGAAGGCCCCTGCAGAAGACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGTCCCCCTCCACCTAAAGTGGTAAAC
CCACTGATCGGCCTCTTGGGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAACAGACCCCTCCCCCACAGCCCCGC
ACAGCACAGCCCCAGAAGCGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACTGACTGGAATAAACTGGCTTGTCTGCTT
TGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAGCAAAACCTGGAAATCCACCGGAAG
ATAAAACAGTCTGAGCAGGAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGAAGAGGAAATGATCGCAGGGAAAAG
CTCCAGTCTTTTGACTCTCCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGTAAACTTGTTGATAAAGAAGATATC
GACACTAGCAGCAAAGGAGGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGATATGGCCATCCTGGATTGGCTTCA
TCAGAGGAGGCTGAAGGCCGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGACAGTCCAACGAGACTTACCGAGAT

>In-frame_SEMA3F_ENST00000413852_chr3_50214294_+_RBM6_ENST00000443081_chr3_50095161_+_2025nt
ATGTACGTGGGCAGCAAGGACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTCATTATACACTGGGCAGCCTCCCCA
CAGCGCATCGAGGAATGCGTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGGCTCATCCAGCCCTGGAACCGAACA
CACCTGTATGTGTGCGGGACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGCGCCCAGGATTACATCTTCTACCTG
GAGCCTGAGCGACTCGAGTCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCGGCCCTCATCATGACAGAGGCCAAG
CAAGAATTAATAACCTACCCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAGCCCAACCAGCCCCTAAGACCAGCTGAT
AAGGAACCTGAACCCAGGAAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAAGCAGAAAGGTATCTGCCTCCTTCT
CGAAGGGAAGGGCCAACTTTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAGGATGGAGAGAGCAAAACTATCATG
CTAAAGCGTATCTATCGTTCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGCCTTACTACTGCCAACGTCCGTATC
ATCAAGAACAGAACAGGCCCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCGGAAGCTCTTCGTGTGGTGAAGATCTTA
CAGAACCTTGATCCGCCATTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAGAAATGATTCTGGGGACCAT
TCTGACCACATGCATTACTATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAATTCAGACTGGTCTTCAGATACAAAT
CGACAAGGACAACAGTCATCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTATGACCCCTTGGCAGGAACTTATTATGAC
CCCAATACCCAGCAAGAAGTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAGGAAAAAAAACCCACCAGTCAAGGA
AAGTCAAGTAGCAAGAAGGAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACGAGGTTTCAGGAAAATGCCAGTGAA
GGGAAGGCCCCTGCAGAAGACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGTCCCCCTCCACCTAAAGTGGTAAAC
CCACTGATCGGCCTCTTGGGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAACAGACCCCTCCCCCACAGCCCCGC
ACAGCACAGCCCCAGAAGCGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACTGACTGGAATAAACTGGCTTGTCTGCTT
TGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAGCAAAACCTGGAAATCCACCGGAAG
ATAAAACAGTCTGAGCAGGAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGAAGAGGAAATGATCGCAGGGAAAAG
CTCCAGTCTTTTGACTCTCCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGTAAACTTGTTGATAAAGAAGATATC
GACACTAGCAGCAAAGGAGGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGATATGGCCATCCTGGATTGGCTTCA
TCAGAGGAGGCTGAAGGCCGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGACAGTCCAACGAGACTTACCGAGAT

>In-frame_SEMA3F_ENST00000002829_chr3_50214294_+_RBM6_ENST00000442092_chr3_50095161_+_2322nt
ATGCTTGTCGCCGGTCTTCTTCTCTGGGCTTCCCTACTGACCGGGGCCTGGCCATCCTTCCCCACCCAGGACCACCTCCCGGCCACGCCC
CGGGTCCGGCTCTCATTCAAAGAGCTGAAGGCCACAGGCACCGCCCACTTCTTCAACTTCCTGCTCAACACAACCGACTACCGAATCTTG
CTCAAGGACGAGGACCACGACCGCATGTACGTGGGCAGCAAGGACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTC
ATTATACACTGGGCAGCCTCCCCACAGCGCATCGAGGAATGCGTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGG
CTCATCCAGCCCTGGAACCGAACACACCTGTATGTGTGCGGGACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGC
GCCCAGGCCACACCATGGACCCAGACTCAGGCGGTCAGAGGCCGCGGCAGCAGAGCCACGGATGGTGCCCTCCGCCCGATGCCCACAGCC
CCACGCCAGGATTACATCTTCTACCTGGAGCCTGAGCGACTCGAGTCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCA
TCGGCCCTCATCATGACAGAGGCCAAGCAAGAATTAATAACCTACCCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAG
CCCAACCAGCCCCTAAGACCAGCTGATAAGGAACCTGAACCCAGGAAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGA
GAAGCAGAAAGGTATCTGCCTCCTTCTCGAAGGGAAGGGCCAACTTTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGC
CAGGATGGAGAGAGCAAAACTATCATGCTAAAGCGTATCTATCGTTCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTC
CGCCTTACTACTGCCAACGTCCGTATCATCAAGAACAGAACAGGCCCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCG
GAAGCTCTTCGTGTGGTGAAGATCTTACAGAACCTTGATCCGCCATTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGA
AAACGAAGAAATGATTCTGGGGACCATTCTGACCACATGCATTACTATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGA
AATTCAGACTGGTCTTCAGATACAAATCGACAAGGACAACAGTCATCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTAT
GACCCCTTGGCAGGAACTTATTATGACCCCAATACCCAGCAAGAAGTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATC
AAGGAAAAAAAACCCACCAGTCAAGGAAAGTCAAGTAGCAAGAAGGAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTG
ACGAGGTTTCAGGAAAATGCCAGTGAAGGGAAGGCCCCTGCAGAAGACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAG
AGTCCCCCTCCACCTAAAGTGGTAAACCCACTGATCGGCCTCTTGGGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAG
GAACAGACCCCTCCCCCACAGCCCCGCACAGCACAGCCCCAGAAGCGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACT
GACTGGAATAAACTGGCTTGTCTGCTTTGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCAC
AAGCAAAACCTGGAAATCCACCGGAAGATAAAACAGTCTGAGCAGGAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAA
GGAAGAGGAAATGATCGCAGGGAAAAGCTCCAGTCTTTTGACTCTCCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGAT
CGTAAACTTGTTGATAAAGAAGATATCGACACTAGCAGCAAAGGAGGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTG
GGATATGGCCATCCTGGATTGGCTTCATCAGAGGAGGCTGAAGGCCGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAA

>In-frame_SEMA3F_ENST00000002829_chr3_50214294_+_RBM6_ENST00000266022_chr3_50095161_+_2322nt
ATGCTTGTCGCCGGTCTTCTTCTCTGGGCTTCCCTACTGACCGGGGCCTGGCCATCCTTCCCCACCCAGGACCACCTCCCGGCCACGCCC
CGGGTCCGGCTCTCATTCAAAGAGCTGAAGGCCACAGGCACCGCCCACTTCTTCAACTTCCTGCTCAACACAACCGACTACCGAATCTTG
CTCAAGGACGAGGACCACGACCGCATGTACGTGGGCAGCAAGGACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTC
ATTATACACTGGGCAGCCTCCCCACAGCGCATCGAGGAATGCGTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGG
CTCATCCAGCCCTGGAACCGAACACACCTGTATGTGTGCGGGACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGC
GCCCAGGCCACACCATGGACCCAGACTCAGGCGGTCAGAGGCCGCGGCAGCAGAGCCACGGATGGTGCCCTCCGCCCGATGCCCACAGCC
CCACGCCAGGATTACATCTTCTACCTGGAGCCTGAGCGACTCGAGTCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCA
TCGGCCCTCATCATGACAGAGGCCAAGCAAGAATTAATAACCTACCCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAG
CCCAACCAGCCCCTAAGACCAGCTGATAAGGAACCTGAACCCAGGAAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGA
GAAGCAGAAAGGTATCTGCCTCCTTCTCGAAGGGAAGGGCCAACTTTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGC
CAGGATGGAGAGAGCAAAACTATCATGCTAAAGCGTATCTATCGTTCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTC
CGCCTTACTACTGCCAACGTCCGTATCATCAAGAACAGAACAGGCCCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCG
GAAGCTCTTCGTGTGGTGAAGATCTTACAGAACCTTGATCCGCCATTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGA
AAACGAAGAAATGATTCTGGGGACCATTCTGACCACATGCATTACTATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGA
AATTCAGACTGGTCTTCAGATACAAATCGACAAGGACAACAGTCATCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTAT
GACCCCTTGGCAGGAACTTATTATGACCCCAATACCCAGCAAGAAGTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATC
AAGGAAAAAAAACCCACCAGTCAAGGAAAGTCAAGTAGCAAGAAGGAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTG
ACGAGGTTTCAGGAAAATGCCAGTGAAGGGAAGGCCCCTGCAGAAGACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAG
AGTCCCCCTCCACCTAAAGTGGTAAACCCACTGATCGGCCTCTTGGGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAG
GAACAGACCCCTCCCCCACAGCCCCGCACAGCACAGCCCCAGAAGCGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACT
GACTGGAATAAACTGGCTTGTCTGCTTTGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCAC
AAGCAAAACCTGGAAATCCACCGGAAGATAAAACAGTCTGAGCAGGAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAA
GGAAGAGGAAATGATCGCAGGGAAAAGCTCCAGTCTTTTGACTCTCCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGAT
CGTAAACTTGTTGATAAAGAAGATATCGACACTAGCAGCAAAGGAGGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTG
GGATATGGCCATCCTGGATTGGCTTCATCAGAGGAGGCTGAAGGCCGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAA

>In-frame_SEMA3F_ENST00000002829_chr3_50214294_+_RBM6_ENST00000443081_chr3_50095161_+_2322nt
ATGCTTGTCGCCGGTCTTCTTCTCTGGGCTTCCCTACTGACCGGGGCCTGGCCATCCTTCCCCACCCAGGACCACCTCCCGGCCACGCCC
CGGGTCCGGCTCTCATTCAAAGAGCTGAAGGCCACAGGCACCGCCCACTTCTTCAACTTCCTGCTCAACACAACCGACTACCGAATCTTG
CTCAAGGACGAGGACCACGACCGCATGTACGTGGGCAGCAAGGACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTC
ATTATACACTGGGCAGCCTCCCCACAGCGCATCGAGGAATGCGTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGG
CTCATCCAGCCCTGGAACCGAACACACCTGTATGTGTGCGGGACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGC
GCCCAGGCCACACCATGGACCCAGACTCAGGCGGTCAGAGGCCGCGGCAGCAGAGCCACGGATGGTGCCCTCCGCCCGATGCCCACAGCC
CCACGCCAGGATTACATCTTCTACCTGGAGCCTGAGCGACTCGAGTCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCA
TCGGCCCTCATCATGACAGAGGCCAAGCAAGAATTAATAACCTACCCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAG
CCCAACCAGCCCCTAAGACCAGCTGATAAGGAACCTGAACCCAGGAAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGA
GAAGCAGAAAGGTATCTGCCTCCTTCTCGAAGGGAAGGGCCAACTTTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGC
CAGGATGGAGAGAGCAAAACTATCATGCTAAAGCGTATCTATCGTTCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTC
CGCCTTACTACTGCCAACGTCCGTATCATCAAGAACAGAACAGGCCCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCG
GAAGCTCTTCGTGTGGTGAAGATCTTACAGAACCTTGATCCGCCATTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGA
AAACGAAGAAATGATTCTGGGGACCATTCTGACCACATGCATTACTATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGA
AATTCAGACTGGTCTTCAGATACAAATCGACAAGGACAACAGTCATCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTAT
GACCCCTTGGCAGGAACTTATTATGACCCCAATACCCAGCAAGAAGTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATC
AAGGAAAAAAAACCCACCAGTCAAGGAAAGTCAAGTAGCAAGAAGGAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTG
ACGAGGTTTCAGGAAAATGCCAGTGAAGGGAAGGCCCCTGCAGAAGACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAG
AGTCCCCCTCCACCTAAAGTGGTAAACCCACTGATCGGCCTCTTGGGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAG
GAACAGACCCCTCCCCCACAGCCCCGCACAGCACAGCCCCAGAAGCGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACT
GACTGGAATAAACTGGCTTGTCTGCTTTGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCAC
AAGCAAAACCTGGAAATCCACCGGAAGATAAAACAGTCTGAGCAGGAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAA
GGAAGAGGAAATGATCGCAGGGAAAAGCTCCAGTCTTTTGACTCTCCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGAT
CGTAAACTTGTTGATAAAGAAGATATCGACACTAGCAGCAAAGGAGGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTG
GGATATGGCCATCCTGGATTGGCTTCATCAGAGGAGGCTGAAGGCCGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAA

>In-frame_SEMA3F_ENST00000434342_chr3_50214294_+_RBM6_ENST00000442092_chr3_50095161_+_2229nt
ATGCTTGTCGCCGGTCTTCTTCTCTGGGCTTCCCTACTGACCGGGGCCTGGCCATCCTTCCCCACCCAGGACCACCTCCCGGCCACGCCC
CGGGTCCGGCTCTCATTCAAAGAGCTGAAGGCCACAGGCACCGCCCACTTCTTCAACTTCCTGCTCAACACAACCGACTACCGAATCTTG
CTCAAGGACGAGGACCACGACCGCATGTACGTGGGCAGCAAGGACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTC
ATTATACACTGGGCAGCCTCCCCACAGCGCATCGAGGAATGCGTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGG
CTCATCCAGCCCTGGAACCGAACACACCTGTATGTGTGCGGGACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGC
GCCCAGGATTACATCTTCTACCTGGAGCCTGAGCGACTCGAGTCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCG
GCCCTCATCATGACAGAGGCCAAGCAAGAATTAATAACCTACCCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAGCCC
AACCAGCCCCTAAGACCAGCTGATAAGGAACCTGAACCCAGGAAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAA
GCAGAAAGGTATCTGCCTCCTTCTCGAAGGGAAGGGCCAACTTTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAG
GATGGAGAGAGCAAAACTATCATGCTAAAGCGTATCTATCGTTCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGC
CTTACTACTGCCAACGTCCGTATCATCAAGAACAGAACAGGCCCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCGGAA
GCTCTTCGTGTGGTGAAGATCTTACAGAACCTTGATCCGCCATTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAA
CGAAGAAATGATTCTGGGGACCATTCTGACCACATGCATTACTATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAAT
TCAGACTGGTCTTCAGATACAAATCGACAAGGACAACAGTCATCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTATGAC
CCCTTGGCAGGAACTTATTATGACCCCAATACCCAGCAAGAAGTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAG
GAAAAAAAACCCACCAGTCAAGGAAAGTCAAGTAGCAAGAAGGAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACG
AGGTTTCAGGAAAATGCCAGTGAAGGGAAGGCCCCTGCAGAAGACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGT
CCCCCTCCACCTAAAGTGGTAAACCCACTGATCGGCCTCTTGGGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAA
CAGACCCCTCCCCCACAGCCCCGCACAGCACAGCCCCAGAAGCGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACTGAC
TGGAATAAACTGGCTTGTCTGCTTTGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAG
CAAAACCTGGAAATCCACCGGAAGATAAAACAGTCTGAGCAGGAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGA
AGAGGAAATGATCGCAGGGAAAAGCTCCAGTCTTTTGACTCTCCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGT
AAACTTGTTGATAAAGAAGATATCGACACTAGCAGCAAAGGAGGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGA
TATGGCCATCCTGGATTGGCTTCATCAGAGGAGGCTGAAGGCCGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGA

>In-frame_SEMA3F_ENST00000434342_chr3_50214294_+_RBM6_ENST00000266022_chr3_50095161_+_2229nt
ATGCTTGTCGCCGGTCTTCTTCTCTGGGCTTCCCTACTGACCGGGGCCTGGCCATCCTTCCCCACCCAGGACCACCTCCCGGCCACGCCC
CGGGTCCGGCTCTCATTCAAAGAGCTGAAGGCCACAGGCACCGCCCACTTCTTCAACTTCCTGCTCAACACAACCGACTACCGAATCTTG
CTCAAGGACGAGGACCACGACCGCATGTACGTGGGCAGCAAGGACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTC
ATTATACACTGGGCAGCCTCCCCACAGCGCATCGAGGAATGCGTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGG
CTCATCCAGCCCTGGAACCGAACACACCTGTATGTGTGCGGGACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGC
GCCCAGGATTACATCTTCTACCTGGAGCCTGAGCGACTCGAGTCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCG
GCCCTCATCATGACAGAGGCCAAGCAAGAATTAATAACCTACCCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAGCCC
AACCAGCCCCTAAGACCAGCTGATAAGGAACCTGAACCCAGGAAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAA
GCAGAAAGGTATCTGCCTCCTTCTCGAAGGGAAGGGCCAACTTTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAG
GATGGAGAGAGCAAAACTATCATGCTAAAGCGTATCTATCGTTCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGC
CTTACTACTGCCAACGTCCGTATCATCAAGAACAGAACAGGCCCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCGGAA
GCTCTTCGTGTGGTGAAGATCTTACAGAACCTTGATCCGCCATTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAA
CGAAGAAATGATTCTGGGGACCATTCTGACCACATGCATTACTATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAAT
TCAGACTGGTCTTCAGATACAAATCGACAAGGACAACAGTCATCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTATGAC
CCCTTGGCAGGAACTTATTATGACCCCAATACCCAGCAAGAAGTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAG
GAAAAAAAACCCACCAGTCAAGGAAAGTCAAGTAGCAAGAAGGAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACG
AGGTTTCAGGAAAATGCCAGTGAAGGGAAGGCCCCTGCAGAAGACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGT
CCCCCTCCACCTAAAGTGGTAAACCCACTGATCGGCCTCTTGGGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAA
CAGACCCCTCCCCCACAGCCCCGCACAGCACAGCCCCAGAAGCGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACTGAC
TGGAATAAACTGGCTTGTCTGCTTTGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAG
CAAAACCTGGAAATCCACCGGAAGATAAAACAGTCTGAGCAGGAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGA
AGAGGAAATGATCGCAGGGAAAAGCTCCAGTCTTTTGACTCTCCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGT
AAACTTGTTGATAAAGAAGATATCGACACTAGCAGCAAAGGAGGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGA
TATGGCCATCCTGGATTGGCTTCATCAGAGGAGGCTGAAGGCCGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGA

>In-frame_SEMA3F_ENST00000434342_chr3_50214294_+_RBM6_ENST00000443081_chr3_50095161_+_2229nt
ATGCTTGTCGCCGGTCTTCTTCTCTGGGCTTCCCTACTGACCGGGGCCTGGCCATCCTTCCCCACCCAGGACCACCTCCCGGCCACGCCC
CGGGTCCGGCTCTCATTCAAAGAGCTGAAGGCCACAGGCACCGCCCACTTCTTCAACTTCCTGCTCAACACAACCGACTACCGAATCTTG
CTCAAGGACGAGGACCACGACCGCATGTACGTGGGCAGCAAGGACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTC
ATTATACACTGGGCAGCCTCCCCACAGCGCATCGAGGAATGCGTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGG
CTCATCCAGCCCTGGAACCGAACACACCTGTATGTGTGCGGGACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGC
GCCCAGGATTACATCTTCTACCTGGAGCCTGAGCGACTCGAGTCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCG
GCCCTCATCATGACAGAGGCCAAGCAAGAATTAATAACCTACCCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAGCCC
AACCAGCCCCTAAGACCAGCTGATAAGGAACCTGAACCCAGGAAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAA
GCAGAAAGGTATCTGCCTCCTTCTCGAAGGGAAGGGCCAACTTTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAG
GATGGAGAGAGCAAAACTATCATGCTAAAGCGTATCTATCGTTCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGC
CTTACTACTGCCAACGTCCGTATCATCAAGAACAGAACAGGCCCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCGGAA
GCTCTTCGTGTGGTGAAGATCTTACAGAACCTTGATCCGCCATTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAA
CGAAGAAATGATTCTGGGGACCATTCTGACCACATGCATTACTATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAAT
TCAGACTGGTCTTCAGATACAAATCGACAAGGACAACAGTCATCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTATGAC
CCCTTGGCAGGAACTTATTATGACCCCAATACCCAGCAAGAAGTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAG
GAAAAAAAACCCACCAGTCAAGGAAAGTCAAGTAGCAAGAAGGAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACG
AGGTTTCAGGAAAATGCCAGTGAAGGGAAGGCCCCTGCAGAAGACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGT
CCCCCTCCACCTAAAGTGGTAAACCCACTGATCGGCCTCTTGGGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAA
CAGACCCCTCCCCCACAGCCCCGCACAGCACAGCCCCAGAAGCGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACTGAC
TGGAATAAACTGGCTTGTCTGCTTTGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAG
CAAAACCTGGAAATCCACCGGAAGATAAAACAGTCTGAGCAGGAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGA
AGAGGAAATGATCGCAGGGAAAAGCTCCAGTCTTTTGACTCTCCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGT
AAACTTGTTGATAAAGAAGATATCGACACTAGCAGCAAAGGAGGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGA
TATGGCCATCCTGGATTGGCTTCATCAGAGGAGGCTGAAGGCCGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_SEMA3F_ENST00000413852_chr3_50214294_+_RBM6_ENST00000442092_chr3_50095161_+_2333nt
GAGCGAGCGAACGAACCGCGGCGGTCCGGAGAGCCCCGAGCGCAGCGCAGGACCTGGGACCACCTCCCGGCCACGCCCCGGGTCCGGCTC
TCATTCAAAGAGCTGAAGGCCACAGGCACCGCCCACTTCTTCAACTTCCTGCTCAACACAACCGACTACCGAATCTTGCTCAAGGACGAG
GACCACGACCGCATGTACGTGGGCAGCAAGGACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTCATTATACACTGG
GCAGCCTCCCCACAGCGCATCGAGGAATGCGTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGGCTCATCCAGCCC
TGGAACCGAACACACCTGTATGTGTGCGGGACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGCGCCCAGGATTAC
ATCTTCTACCTGGAGCCTGAGCGACTCGAGTCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCGGCCCTCATCATG
ACAGAGGCCAAGCAAGAATTAATAACCTACCCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAGCCCAACCAGCCCCTA
AGACCAGCTGATAAGGAACCTGAACCCAGGAAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAAGCAGAAAGGTAT
CTGCCTCCTTCTCGAAGGGAAGGGCCAACTTTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAGGATGGAGAGAGC
AAAACTATCATGCTAAAGCGTATCTATCGTTCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGCCTTACTACTGCC
AACGTCCGTATCATCAAGAACAGAACAGGCCCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCGGAAGCTCTTCGTGTG
GTGAAGATCTTACAGAACCTTGATCCGCCATTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAGAAATGAT
TCTGGGGACCATTCTGACCACATGCATTACTATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAATTCAGACTGGTCT
TCAGATACAAATCGACAAGGACAACAGTCATCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTATGACCCCTTGGCAGGA
ACTTATTATGACCCCAATACCCAGCAAGAAGTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAGGAAAAAAAACCC
ACCAGTCAAGGAAAGTCAAGTAGCAAGAAGGAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACGAGGTTTCAGGAA
AATGCCAGTGAAGGGAAGGCCCCTGCAGAAGACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGTCCCCCTCCACCT
AAAGTGGTAAACCCACTGATCGGCCTCTTGGGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAACAGACCCCTCCC
CCACAGCCCCGCACAGCACAGCCCCAGAAGCGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACTGACTGGAATAAACTG
GCTTGTCTGCTTTGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAGCAAAACCTGGAA
ATCCACCGGAAGATAAAACAGTCTGAGCAGGAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGAAGAGGAAATGAT
CGCAGGGAAAAGCTCCAGTCTTTTGACTCTCCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGTAAACTTGTTGAT
AAAGAAGATATCGACACTAGCAGCAAAGGAGGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGATATGGCCATCCT
GGATTGGCTTCATCAGAGGAGGCTGAAGGCCGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGACAGTCCAACGAG
ACTTACCGAGATGCTGTTCGAAGAGTCATGTTTGCTCGATATAAAGAACTCGATTAAGAAAGGAGACAAGTTCCATGGGATACAACCTCC

>In-frame_SEMA3F_ENST00000413852_chr3_50214294_+_RBM6_ENST00000266022_chr3_50095161_+_2334nt
GAGCGAGCGAACGAACCGCGGCGGTCCGGAGAGCCCCGAGCGCAGCGCAGGACCTGGGACCACCTCCCGGCCACGCCCCGGGTCCGGCTC
TCATTCAAAGAGCTGAAGGCCACAGGCACCGCCCACTTCTTCAACTTCCTGCTCAACACAACCGACTACCGAATCTTGCTCAAGGACGAG
GACCACGACCGCATGTACGTGGGCAGCAAGGACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTCATTATACACTGG
GCAGCCTCCCCACAGCGCATCGAGGAATGCGTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGGCTCATCCAGCCC
TGGAACCGAACACACCTGTATGTGTGCGGGACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGCGCCCAGGATTAC
ATCTTCTACCTGGAGCCTGAGCGACTCGAGTCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCGGCCCTCATCATG
ACAGAGGCCAAGCAAGAATTAATAACCTACCCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAGCCCAACCAGCCCCTA
AGACCAGCTGATAAGGAACCTGAACCCAGGAAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAAGCAGAAAGGTAT
CTGCCTCCTTCTCGAAGGGAAGGGCCAACTTTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAGGATGGAGAGAGC
AAAACTATCATGCTAAAGCGTATCTATCGTTCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGCCTTACTACTGCC
AACGTCCGTATCATCAAGAACAGAACAGGCCCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCGGAAGCTCTTCGTGTG
GTGAAGATCTTACAGAACCTTGATCCGCCATTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAGAAATGAT
TCTGGGGACCATTCTGACCACATGCATTACTATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAATTCAGACTGGTCT
TCAGATACAAATCGACAAGGACAACAGTCATCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTATGACCCCTTGGCAGGA
ACTTATTATGACCCCAATACCCAGCAAGAAGTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAGGAAAAAAAACCC
ACCAGTCAAGGAAAGTCAAGTAGCAAGAAGGAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACGAGGTTTCAGGAA
AATGCCAGTGAAGGGAAGGCCCCTGCAGAAGACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGTCCCCCTCCACCT
AAAGTGGTAAACCCACTGATCGGCCTCTTGGGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAACAGACCCCTCCC
CCACAGCCCCGCACAGCACAGCCCCAGAAGCGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACTGACTGGAATAAACTG
GCTTGTCTGCTTTGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAGCAAAACCTGGAA
ATCCACCGGAAGATAAAACAGTCTGAGCAGGAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGAAGAGGAAATGAT
CGCAGGGAAAAGCTCCAGTCTTTTGACTCTCCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGTAAACTTGTTGAT
AAAGAAGATATCGACACTAGCAGCAAAGGAGGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGATATGGCCATCCT
GGATTGGCTTCATCAGAGGAGGCTGAAGGCCGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGACAGTCCAACGAG
ACTTACCGAGATGCTGTTCGAAGAGTCATGTTTGCTCGATATAAAGAACTCGATTAAGAAAGGAGACAAGTTCCATGGGATACAACCTCC

>In-frame_SEMA3F_ENST00000413852_chr3_50214294_+_RBM6_ENST00000443081_chr3_50095161_+_2332nt
GAGCGAGCGAACGAACCGCGGCGGTCCGGAGAGCCCCGAGCGCAGCGCAGGACCTGGGACCACCTCCCGGCCACGCCCCGGGTCCGGCTC
TCATTCAAAGAGCTGAAGGCCACAGGCACCGCCCACTTCTTCAACTTCCTGCTCAACACAACCGACTACCGAATCTTGCTCAAGGACGAG
GACCACGACCGCATGTACGTGGGCAGCAAGGACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTCATTATACACTGG
GCAGCCTCCCCACAGCGCATCGAGGAATGCGTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGGCTCATCCAGCCC
TGGAACCGAACACACCTGTATGTGTGCGGGACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGCGCCCAGGATTAC
ATCTTCTACCTGGAGCCTGAGCGACTCGAGTCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCGGCCCTCATCATG
ACAGAGGCCAAGCAAGAATTAATAACCTACCCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAGCCCAACCAGCCCCTA
AGACCAGCTGATAAGGAACCTGAACCCAGGAAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAAGCAGAAAGGTAT
CTGCCTCCTTCTCGAAGGGAAGGGCCAACTTTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAGGATGGAGAGAGC
AAAACTATCATGCTAAAGCGTATCTATCGTTCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGCCTTACTACTGCC
AACGTCCGTATCATCAAGAACAGAACAGGCCCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCGGAAGCTCTTCGTGTG
GTGAAGATCTTACAGAACCTTGATCCGCCATTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAGAAATGAT
TCTGGGGACCATTCTGACCACATGCATTACTATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAATTCAGACTGGTCT
TCAGATACAAATCGACAAGGACAACAGTCATCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTATGACCCCTTGGCAGGA
ACTTATTATGACCCCAATACCCAGCAAGAAGTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAGGAAAAAAAACCC
ACCAGTCAAGGAAAGTCAAGTAGCAAGAAGGAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACGAGGTTTCAGGAA
AATGCCAGTGAAGGGAAGGCCCCTGCAGAAGACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGTCCCCCTCCACCT
AAAGTGGTAAACCCACTGATCGGCCTCTTGGGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAACAGACCCCTCCC
CCACAGCCCCGCACAGCACAGCCCCAGAAGCGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACTGACTGGAATAAACTG
GCTTGTCTGCTTTGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAGCAAAACCTGGAA
ATCCACCGGAAGATAAAACAGTCTGAGCAGGAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGAAGAGGAAATGAT
CGCAGGGAAAAGCTCCAGTCTTTTGACTCTCCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGTAAACTTGTTGAT
AAAGAAGATATCGACACTAGCAGCAAAGGAGGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGATATGGCCATCCT
GGATTGGCTTCATCAGAGGAGGCTGAAGGCCGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGACAGTCCAACGAG
ACTTACCGAGATGCTGTTCGAAGAGTCATGTTTGCTCGATATAAAGAACTCGATTAAGAAAGGAGACAAGTTCCATGGGATACAACCTCC

>In-frame_SEMA3F_ENST00000002829_chr3_50214294_+_RBM6_ENST00000442092_chr3_50095161_+_2922nt
AGCGCAGCGCAGGACCTGGGTACGCCGCGAGGAACCGTGCAGCCCAGCGCGGCCGCCCGGCCCGGGTCCAGCAGCCAGGAGAGCGCAGCG
CTTCGAAGCCGAGTGCGCGCCACCGCCCGCGCCCCGCGCTGGGGAATGCGCCCTCGGCGCGCCGGCCAGGGGGCGCCCGCAGCCCACCCC
AGGGGAGGCGGCCCCGAGCGCCCCTGAGCCTTCCCATGGCCCGGGCTGGGGCCCGGGCCCTCGGCTGCTGACGCGCCCGAAGCCCGCGGA
ACCGGTTAAGCCGCGGCCGCGGCGCCGATCCCGGCTGAGGCGCAGCGGCGAGAGGTCGCGGGCAGGGCCATGGCCCCGGGGGGCCGCTAG
CGCGGACCGGCCCAACGGGAGCCGCTCCGTGCCGCCGCCGCCGCCCGGGCGCCCAGGCCCCGCCGCTGCGGAAGAGGTTTCTAGAGAGTG
GAGCCTGCTTCCTGGGCCCTAGGCCCCTCCCACAATGCTTGTCGCCGGTCTTCTTCTCTGGGCTTCCCTACTGACCGGGGCCTGGCCATC
CTTCCCCACCCAGGACCACCTCCCGGCCACGCCCCGGGTCCGGCTCTCATTCAAAGAGCTGAAGGCCACAGGCACCGCCCACTTCTTCAA
CTTCCTGCTCAACACAACCGACTACCGAATCTTGCTCAAGGACGAGGACCACGACCGCATGTACGTGGGCAGCAAGGACTACGTGCTGTC
CCTGGACCTGCACGACATCAACCGCGAGCCCCTCATTATACACTGGGCAGCCTCCCCACAGCGCATCGAGGAATGCGTGCTCTCAGGCAA
GGATGTCAACGGCGAGTGTGGGAACTTCGTCAGGCTCATCCAGCCCTGGAACCGAACACACCTGTATGTGTGCGGGACAGGTGCCTACAA
CCCCATGTGCACCTATGTGAACCGCGGACGCCGCGCCCAGGCCACACCATGGACCCAGACTCAGGCGGTCAGAGGCCGCGGCAGCAGAGC
CACGGATGGTGCCCTCCGCCCGATGCCCACAGCCCCACGCCAGGATTACATCTTCTACCTGGAGCCTGAGCGACTCGAGTCAGGGAAGGG
CAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCGGCCCTCATCATGACAGAGGCCAAGCAAGAATTAATAACCTACCCTCAGCCTCA
GAAAACATCCATACCAGCACCATTGGAAAAACAGCCCAACCAGCCCCTAAGACCAGCTGATAAGGAACCTGAACCCAGGAAGAGGGAAGA
AGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAAGCAGAAAGGTATCTGCCTCCTTCTCGAAGGGAAGGGCCAACTTTCCGAAGAGA
CCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAGGATGGAGAGAGCAAAACTATCATGCTAAAGCGTATCTATCGTTCCACACCACC
TGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGCCTTACTACTGCCAACGTCCGTATCATCAAGAACAGAACAGGCCCTATGGGGCA
TACCTATGGCTTTATTGACCTCGACTCCCATGCGGAAGCTCTTCGTGTGGTGAAGATCTTACAGAACCTTGATCCGCCATTTAGCATTGA
TGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAGAAATGATTCTGGGGACCATTCTGACCACATGCATTACTATCAGGGTAA
AAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAATTCAGACTGGTCTTCAGATACAAATCGACAAGGACAACAGTCATCATCTGACTG
CTACATATATGATTCTGCTACTGGCTACTATTATGACCCCTTGGCAGGAACTTATTATGACCCCAATACCCAGCAAGAAGTCTATGTGCC
CCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAGGAAAAAAAACCCACCAGTCAAGGAAAGTCAAGTAGCAAGAAGGAAATGTCTAA
AAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACGAGGTTTCAGGAAAATGCCAGTGAAGGGAAGGCCCCTGCAGAAGACGTCTTTAA
GAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGTCCCCCTCCACCTAAAGTGGTAAACCCACTGATCGGCCTCTTGGGTGAATATGG
AGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAACAGACCCCTCCCCCACAGCCCCGCACAGCACAGCCCCAGAAGCGAGAGGAGCA
AACCAAGAAGGAGAATGAAGAAGACAAACTCACTGACTGGAATAAACTGGCTTGTCTGCTTTGCAGAAGGCAGTTTCCCAATAAAGAAGT
TCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAGCAAAACCTGGAAATCCACCGGAAGATAAAACAGTCTGAGCAGGAGCTAGCCTA
TCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGAAGAGGAAATGATCGCAGGGAAAAGCTCCAGTCTTTTGACTCTCCAGAAAGGAA
ACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGTAAACTTGTTGATAAAGAAGATATCGACACTAGCAGCAAAGGAGGCTGTGTCCA
ACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGATATGGCCATCCTGGATTGGCTTCATCAGAGGAGGCTGAAGGCCGGATGAGGGG
CCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGACAGTCCAACGAGACTTACCGAGATGCTGTTCGAAGAGTCATGTTTGCTCGATA
TAAAGAACTCGATTAAGAAAGGAGACAAGTTCCATGGGATACAACCTCCCTCTTGTTTTGTTTGTCTCTCCTTTTCTTTTGTTACTGTTC

>In-frame_SEMA3F_ENST00000002829_chr3_50214294_+_RBM6_ENST00000266022_chr3_50095161_+_2923nt
AGCGCAGCGCAGGACCTGGGTACGCCGCGAGGAACCGTGCAGCCCAGCGCGGCCGCCCGGCCCGGGTCCAGCAGCCAGGAGAGCGCAGCG
CTTCGAAGCCGAGTGCGCGCCACCGCCCGCGCCCCGCGCTGGGGAATGCGCCCTCGGCGCGCCGGCCAGGGGGCGCCCGCAGCCCACCCC
AGGGGAGGCGGCCCCGAGCGCCCCTGAGCCTTCCCATGGCCCGGGCTGGGGCCCGGGCCCTCGGCTGCTGACGCGCCCGAAGCCCGCGGA
ACCGGTTAAGCCGCGGCCGCGGCGCCGATCCCGGCTGAGGCGCAGCGGCGAGAGGTCGCGGGCAGGGCCATGGCCCCGGGGGGCCGCTAG
CGCGGACCGGCCCAACGGGAGCCGCTCCGTGCCGCCGCCGCCGCCCGGGCGCCCAGGCCCCGCCGCTGCGGAAGAGGTTTCTAGAGAGTG
GAGCCTGCTTCCTGGGCCCTAGGCCCCTCCCACAATGCTTGTCGCCGGTCTTCTTCTCTGGGCTTCCCTACTGACCGGGGCCTGGCCATC
CTTCCCCACCCAGGACCACCTCCCGGCCACGCCCCGGGTCCGGCTCTCATTCAAAGAGCTGAAGGCCACAGGCACCGCCCACTTCTTCAA
CTTCCTGCTCAACACAACCGACTACCGAATCTTGCTCAAGGACGAGGACCACGACCGCATGTACGTGGGCAGCAAGGACTACGTGCTGTC
CCTGGACCTGCACGACATCAACCGCGAGCCCCTCATTATACACTGGGCAGCCTCCCCACAGCGCATCGAGGAATGCGTGCTCTCAGGCAA
GGATGTCAACGGCGAGTGTGGGAACTTCGTCAGGCTCATCCAGCCCTGGAACCGAACACACCTGTATGTGTGCGGGACAGGTGCCTACAA
CCCCATGTGCACCTATGTGAACCGCGGACGCCGCGCCCAGGCCACACCATGGACCCAGACTCAGGCGGTCAGAGGCCGCGGCAGCAGAGC
CACGGATGGTGCCCTCCGCCCGATGCCCACAGCCCCACGCCAGGATTACATCTTCTACCTGGAGCCTGAGCGACTCGAGTCAGGGAAGGG
CAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCGGCCCTCATCATGACAGAGGCCAAGCAAGAATTAATAACCTACCCTCAGCCTCA
GAAAACATCCATACCAGCACCATTGGAAAAACAGCCCAACCAGCCCCTAAGACCAGCTGATAAGGAACCTGAACCCAGGAAGAGGGAAGA
AGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAAGCAGAAAGGTATCTGCCTCCTTCTCGAAGGGAAGGGCCAACTTTCCGAAGAGA
CCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAGGATGGAGAGAGCAAAACTATCATGCTAAAGCGTATCTATCGTTCCACACCACC
TGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGCCTTACTACTGCCAACGTCCGTATCATCAAGAACAGAACAGGCCCTATGGGGCA
TACCTATGGCTTTATTGACCTCGACTCCCATGCGGAAGCTCTTCGTGTGGTGAAGATCTTACAGAACCTTGATCCGCCATTTAGCATTGA
TGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAGAAATGATTCTGGGGACCATTCTGACCACATGCATTACTATCAGGGTAA
AAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAATTCAGACTGGTCTTCAGATACAAATCGACAAGGACAACAGTCATCATCTGACTG
CTACATATATGATTCTGCTACTGGCTACTATTATGACCCCTTGGCAGGAACTTATTATGACCCCAATACCCAGCAAGAAGTCTATGTGCC
CCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAGGAAAAAAAACCCACCAGTCAAGGAAAGTCAAGTAGCAAGAAGGAAATGTCTAA
AAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACGAGGTTTCAGGAAAATGCCAGTGAAGGGAAGGCCCCTGCAGAAGACGTCTTTAA
GAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGTCCCCCTCCACCTAAAGTGGTAAACCCACTGATCGGCCTCTTGGGTGAATATGG
AGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAACAGACCCCTCCCCCACAGCCCCGCACAGCACAGCCCCAGAAGCGAGAGGAGCA
AACCAAGAAGGAGAATGAAGAAGACAAACTCACTGACTGGAATAAACTGGCTTGTCTGCTTTGCAGAAGGCAGTTTCCCAATAAAGAAGT
TCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAGCAAAACCTGGAAATCCACCGGAAGATAAAACAGTCTGAGCAGGAGCTAGCCTA
TCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGAAGAGGAAATGATCGCAGGGAAAAGCTCCAGTCTTTTGACTCTCCAGAAAGGAA
ACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGTAAACTTGTTGATAAAGAAGATATCGACACTAGCAGCAAAGGAGGCTGTGTCCA
ACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGATATGGCCATCCTGGATTGGCTTCATCAGAGGAGGCTGAAGGCCGGATGAGGGG
CCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGACAGTCCAACGAGACTTACCGAGATGCTGTTCGAAGAGTCATGTTTGCTCGATA
TAAAGAACTCGATTAAGAAAGGAGACAAGTTCCATGGGATACAACCTCCCTCTTGTTTTGTTTGTCTCTCCTTTTCTTTTGTTACTGTTC

>In-frame_SEMA3F_ENST00000002829_chr3_50214294_+_RBM6_ENST00000443081_chr3_50095161_+_2921nt
AGCGCAGCGCAGGACCTGGGTACGCCGCGAGGAACCGTGCAGCCCAGCGCGGCCGCCCGGCCCGGGTCCAGCAGCCAGGAGAGCGCAGCG
CTTCGAAGCCGAGTGCGCGCCACCGCCCGCGCCCCGCGCTGGGGAATGCGCCCTCGGCGCGCCGGCCAGGGGGCGCCCGCAGCCCACCCC
AGGGGAGGCGGCCCCGAGCGCCCCTGAGCCTTCCCATGGCCCGGGCTGGGGCCCGGGCCCTCGGCTGCTGACGCGCCCGAAGCCCGCGGA
ACCGGTTAAGCCGCGGCCGCGGCGCCGATCCCGGCTGAGGCGCAGCGGCGAGAGGTCGCGGGCAGGGCCATGGCCCCGGGGGGCCGCTAG
CGCGGACCGGCCCAACGGGAGCCGCTCCGTGCCGCCGCCGCCGCCCGGGCGCCCAGGCCCCGCCGCTGCGGAAGAGGTTTCTAGAGAGTG
GAGCCTGCTTCCTGGGCCCTAGGCCCCTCCCACAATGCTTGTCGCCGGTCTTCTTCTCTGGGCTTCCCTACTGACCGGGGCCTGGCCATC
CTTCCCCACCCAGGACCACCTCCCGGCCACGCCCCGGGTCCGGCTCTCATTCAAAGAGCTGAAGGCCACAGGCACCGCCCACTTCTTCAA
CTTCCTGCTCAACACAACCGACTACCGAATCTTGCTCAAGGACGAGGACCACGACCGCATGTACGTGGGCAGCAAGGACTACGTGCTGTC
CCTGGACCTGCACGACATCAACCGCGAGCCCCTCATTATACACTGGGCAGCCTCCCCACAGCGCATCGAGGAATGCGTGCTCTCAGGCAA
GGATGTCAACGGCGAGTGTGGGAACTTCGTCAGGCTCATCCAGCCCTGGAACCGAACACACCTGTATGTGTGCGGGACAGGTGCCTACAA
CCCCATGTGCACCTATGTGAACCGCGGACGCCGCGCCCAGGCCACACCATGGACCCAGACTCAGGCGGTCAGAGGCCGCGGCAGCAGAGC
CACGGATGGTGCCCTCCGCCCGATGCCCACAGCCCCACGCCAGGATTACATCTTCTACCTGGAGCCTGAGCGACTCGAGTCAGGGAAGGG
CAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCGGCCCTCATCATGACAGAGGCCAAGCAAGAATTAATAACCTACCCTCAGCCTCA
GAAAACATCCATACCAGCACCATTGGAAAAACAGCCCAACCAGCCCCTAAGACCAGCTGATAAGGAACCTGAACCCAGGAAGAGGGAAGA
AGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAAGCAGAAAGGTATCTGCCTCCTTCTCGAAGGGAAGGGCCAACTTTCCGAAGAGA
CCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAGGATGGAGAGAGCAAAACTATCATGCTAAAGCGTATCTATCGTTCCACACCACC
TGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGCCTTACTACTGCCAACGTCCGTATCATCAAGAACAGAACAGGCCCTATGGGGCA
TACCTATGGCTTTATTGACCTCGACTCCCATGCGGAAGCTCTTCGTGTGGTGAAGATCTTACAGAACCTTGATCCGCCATTTAGCATTGA
TGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAGAAATGATTCTGGGGACCATTCTGACCACATGCATTACTATCAGGGTAA
AAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAATTCAGACTGGTCTTCAGATACAAATCGACAAGGACAACAGTCATCATCTGACTG
CTACATATATGATTCTGCTACTGGCTACTATTATGACCCCTTGGCAGGAACTTATTATGACCCCAATACCCAGCAAGAAGTCTATGTGCC
CCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAGGAAAAAAAACCCACCAGTCAAGGAAAGTCAAGTAGCAAGAAGGAAATGTCTAA
AAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACGAGGTTTCAGGAAAATGCCAGTGAAGGGAAGGCCCCTGCAGAAGACGTCTTTAA
GAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGTCCCCCTCCACCTAAAGTGGTAAACCCACTGATCGGCCTCTTGGGTGAATATGG
AGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAACAGACCCCTCCCCCACAGCCCCGCACAGCACAGCCCCAGAAGCGAGAGGAGCA
AACCAAGAAGGAGAATGAAGAAGACAAACTCACTGACTGGAATAAACTGGCTTGTCTGCTTTGCAGAAGGCAGTTTCCCAATAAAGAAGT
TCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAGCAAAACCTGGAAATCCACCGGAAGATAAAACAGTCTGAGCAGGAGCTAGCCTA
TCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGAAGAGGAAATGATCGCAGGGAAAAGCTCCAGTCTTTTGACTCTCCAGAAAGGAA
ACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGTAAACTTGTTGATAAAGAAGATATCGACACTAGCAGCAAAGGAGGCTGTGTCCA
ACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGATATGGCCATCCTGGATTGGCTTCATCAGAGGAGGCTGAAGGCCGGATGAGGGG
CCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGACAGTCCAACGAGACTTACCGAGATGCTGTTCGAAGAGTCATGTTTGCTCGATA
TAAAGAACTCGATTAAGAAAGGAGACAAGTTCCATGGGATACAACCTCCCTCTTGTTTTGTTTGTCTCTCCTTTTCTTTTGTTACTGTTC

>In-frame_SEMA3F_ENST00000434342_chr3_50214294_+_RBM6_ENST00000442092_chr3_50095161_+_2663nt
CTGACTGGTGCTCCCTCTCTTCCATCTTGGGCTGTCTGCATGTGTCTCATTCCCCCACTCTCTCCTGTGCCTCCCCTCTACCGTAATAAT
CAGGTCCAGGTTTCTCTGTACTGGGAGAAGACCTGTGGCTGGAGCAGGCAGGGATGCACCCTATCTGTTCCCCATTCCTCCAGGTGGGAG
GGAGAAGGAGTAACCCACTTTATTGGCCACAGATGCAGGGGAGAAAGGAGAAAGCATGCTGGGAGCTGGAAAGAGCCCTAAGATCACCTG
GTTTCTAGAGAGTGGAGCCTGCTTCCTGGGCCCTAGGCCCCTCCCACAATGCTTGTCGCCGGTCTTCTTCTCTGGGCTTCCCTACTGACC
GGGGCCTGGCCATCCTTCCCCACCCAGGACCACCTCCCGGCCACGCCCCGGGTCCGGCTCTCATTCAAAGAGCTGAAGGCCACAGGCACC
GCCCACTTCTTCAACTTCCTGCTCAACACAACCGACTACCGAATCTTGCTCAAGGACGAGGACCACGACCGCATGTACGTGGGCAGCAAG
GACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTCATTATACACTGGGCAGCCTCCCCACAGCGCATCGAGGAATGC
GTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGGCTCATCCAGCCCTGGAACCGAACACACCTGTATGTGTGCGGG
ACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGCGCCCAGGATTACATCTTCTACCTGGAGCCTGAGCGACTCGAG
TCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCGGCCCTCATCATGACAGAGGCCAAGCAAGAATTAATAACCTAC
CCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAGCCCAACCAGCCCCTAAGACCAGCTGATAAGGAACCTGAACCCAGG
AAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAAGCAGAAAGGTATCTGCCTCCTTCTCGAAGGGAAGGGCCAACT
TTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAGGATGGAGAGAGCAAAACTATCATGCTAAAGCGTATCTATCGT
TCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGCCTTACTACTGCCAACGTCCGTATCATCAAGAACAGAACAGGC
CCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCGGAAGCTCTTCGTGTGGTGAAGATCTTACAGAACCTTGATCCGCCA
TTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAGAAATGATTCTGGGGACCATTCTGACCACATGCATTAC
TATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAATTCAGACTGGTCTTCAGATACAAATCGACAAGGACAACAGTCA
TCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTATGACCCCTTGGCAGGAACTTATTATGACCCCAATACCCAGCAAGAA
GTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAGGAAAAAAAACCCACCAGTCAAGGAAAGTCAAGTAGCAAGAAG
GAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACGAGGTTTCAGGAAAATGCCAGTGAAGGGAAGGCCCCTGCAGAA
GACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGTCCCCCTCCACCTAAAGTGGTAAACCCACTGATCGGCCTCTTG
GGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAACAGACCCCTCCCCCACAGCCCCGCACAGCACAGCCCCAGAAG
CGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACTGACTGGAATAAACTGGCTTGTCTGCTTTGCAGAAGGCAGTTTCCC
AATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAGCAAAACCTGGAAATCCACCGGAAGATAAAACAGTCTGAGCAG
GAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGAAGAGGAAATGATCGCAGGGAAAAGCTCCAGTCTTTTGACTCT
CCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGTAAACTTGTTGATAAAGAAGATATCGACACTAGCAGCAAAGGA
GGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGATATGGCCATCCTGGATTGGCTTCATCAGAGGAGGCTGAAGGC
CGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGACAGTCCAACGAGACTTACCGAGATGCTGTTCGAAGAGTCATG
TTTGCTCGATATAAAGAACTCGATTAAGAAAGGAGACAAGTTCCATGGGATACAACCTCCCTCTTGTTTTGTTTGTCTCTCCTTTTCTTT

>In-frame_SEMA3F_ENST00000434342_chr3_50214294_+_RBM6_ENST00000266022_chr3_50095161_+_2664nt
CTGACTGGTGCTCCCTCTCTTCCATCTTGGGCTGTCTGCATGTGTCTCATTCCCCCACTCTCTCCTGTGCCTCCCCTCTACCGTAATAAT
CAGGTCCAGGTTTCTCTGTACTGGGAGAAGACCTGTGGCTGGAGCAGGCAGGGATGCACCCTATCTGTTCCCCATTCCTCCAGGTGGGAG
GGAGAAGGAGTAACCCACTTTATTGGCCACAGATGCAGGGGAGAAAGGAGAAAGCATGCTGGGAGCTGGAAAGAGCCCTAAGATCACCTG
GTTTCTAGAGAGTGGAGCCTGCTTCCTGGGCCCTAGGCCCCTCCCACAATGCTTGTCGCCGGTCTTCTTCTCTGGGCTTCCCTACTGACC
GGGGCCTGGCCATCCTTCCCCACCCAGGACCACCTCCCGGCCACGCCCCGGGTCCGGCTCTCATTCAAAGAGCTGAAGGCCACAGGCACC
GCCCACTTCTTCAACTTCCTGCTCAACACAACCGACTACCGAATCTTGCTCAAGGACGAGGACCACGACCGCATGTACGTGGGCAGCAAG
GACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTCATTATACACTGGGCAGCCTCCCCACAGCGCATCGAGGAATGC
GTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGGCTCATCCAGCCCTGGAACCGAACACACCTGTATGTGTGCGGG
ACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGCGCCCAGGATTACATCTTCTACCTGGAGCCTGAGCGACTCGAG
TCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCGGCCCTCATCATGACAGAGGCCAAGCAAGAATTAATAACCTAC
CCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAGCCCAACCAGCCCCTAAGACCAGCTGATAAGGAACCTGAACCCAGG
AAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAAGCAGAAAGGTATCTGCCTCCTTCTCGAAGGGAAGGGCCAACT
TTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAGGATGGAGAGAGCAAAACTATCATGCTAAAGCGTATCTATCGT
TCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGCCTTACTACTGCCAACGTCCGTATCATCAAGAACAGAACAGGC
CCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCGGAAGCTCTTCGTGTGGTGAAGATCTTACAGAACCTTGATCCGCCA
TTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAGAAATGATTCTGGGGACCATTCTGACCACATGCATTAC
TATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAATTCAGACTGGTCTTCAGATACAAATCGACAAGGACAACAGTCA
TCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTATGACCCCTTGGCAGGAACTTATTATGACCCCAATACCCAGCAAGAA
GTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAGGAAAAAAAACCCACCAGTCAAGGAAAGTCAAGTAGCAAGAAG
GAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACGAGGTTTCAGGAAAATGCCAGTGAAGGGAAGGCCCCTGCAGAA
GACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGTCCCCCTCCACCTAAAGTGGTAAACCCACTGATCGGCCTCTTG
GGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAACAGACCCCTCCCCCACAGCCCCGCACAGCACAGCCCCAGAAG
CGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACTGACTGGAATAAACTGGCTTGTCTGCTTTGCAGAAGGCAGTTTCCC
AATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAGCAAAACCTGGAAATCCACCGGAAGATAAAACAGTCTGAGCAG
GAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGAAGAGGAAATGATCGCAGGGAAAAGCTCCAGTCTTTTGACTCT
CCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGTAAACTTGTTGATAAAGAAGATATCGACACTAGCAGCAAAGGA
GGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGATATGGCCATCCTGGATTGGCTTCATCAGAGGAGGCTGAAGGC
CGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGACAGTCCAACGAGACTTACCGAGATGCTGTTCGAAGAGTCATG
TTTGCTCGATATAAAGAACTCGATTAAGAAAGGAGACAAGTTCCATGGGATACAACCTCCCTCTTGTTTTGTTTGTCTCTCCTTTTCTTT

>In-frame_SEMA3F_ENST00000434342_chr3_50214294_+_RBM6_ENST00000443081_chr3_50095161_+_2662nt
CTGACTGGTGCTCCCTCTCTTCCATCTTGGGCTGTCTGCATGTGTCTCATTCCCCCACTCTCTCCTGTGCCTCCCCTCTACCGTAATAAT
CAGGTCCAGGTTTCTCTGTACTGGGAGAAGACCTGTGGCTGGAGCAGGCAGGGATGCACCCTATCTGTTCCCCATTCCTCCAGGTGGGAG
GGAGAAGGAGTAACCCACTTTATTGGCCACAGATGCAGGGGAGAAAGGAGAAAGCATGCTGGGAGCTGGAAAGAGCCCTAAGATCACCTG
GTTTCTAGAGAGTGGAGCCTGCTTCCTGGGCCCTAGGCCCCTCCCACAATGCTTGTCGCCGGTCTTCTTCTCTGGGCTTCCCTACTGACC
GGGGCCTGGCCATCCTTCCCCACCCAGGACCACCTCCCGGCCACGCCCCGGGTCCGGCTCTCATTCAAAGAGCTGAAGGCCACAGGCACC
GCCCACTTCTTCAACTTCCTGCTCAACACAACCGACTACCGAATCTTGCTCAAGGACGAGGACCACGACCGCATGTACGTGGGCAGCAAG
GACTACGTGCTGTCCCTGGACCTGCACGACATCAACCGCGAGCCCCTCATTATACACTGGGCAGCCTCCCCACAGCGCATCGAGGAATGC
GTGCTCTCAGGCAAGGATGTCAACGGCGAGTGTGGGAACTTCGTCAGGCTCATCCAGCCCTGGAACCGAACACACCTGTATGTGTGCGGG
ACAGGTGCCTACAACCCCATGTGCACCTATGTGAACCGCGGACGCCGCGCCCAGGATTACATCTTCTACCTGGAGCCTGAGCGACTCGAG
TCAGGGAAGGGCAAGTGTCCGTACGATCCCAAGCTGGACACAGCATCGGCCCTCATCATGACAGAGGCCAAGCAAGAATTAATAACCTAC
CCTCAGCCTCAGAAAACATCCATACCAGCACCATTGGAAAAACAGCCCAACCAGCCCCTAAGACCAGCTGATAAGGAACCTGAACCCAGG
AAGAGGGAAGAAGGCCAAGAGTCACGCTTAGGACATCAAAAGAGAGAAGCAGAAAGGTATCTGCCTCCTTCTCGAAGGGAAGGGCCAACT
TTCCGAAGAGACCGAGAGAGGGAGTCATGGTCTGGAGAGACACGCCAGGATGGAGAGAGCAAAACTATCATGCTAAAGCGTATCTATCGT
TCCACACCACCTGAGGTGATAGTGGAAGTGCTGGAGCCCTATGTCCGCCTTACTACTGCCAACGTCCGTATCATCAAGAACAGAACAGGC
CCTATGGGGCATACCTATGGCTTTATTGACCTCGACTCCCATGCGGAAGCTCTTCGTGTGGTGAAGATCTTACAGAACCTTGATCCGCCA
TTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAGAAATGATTCTGGGGACCATTCTGACCACATGCATTAC
TATCAGGGTAAAAAATATTTCCGAGATAGGAGGGGAGGTGGCAGAAATTCAGACTGGTCTTCAGATACAAATCGACAAGGACAACAGTCA
TCATCTGACTGCTACATATATGATTCTGCTACTGGCTACTATTATGACCCCTTGGCAGGAACTTATTATGACCCCAATACCCAGCAAGAA
GTCTATGTGCCCCAGGATCCTGGATTACCTGAGGAAGAAGAGATCAAGGAAAAAAAACCCACCAGTCAAGGAAAGTCAAGTAGCAAGAAG
GAAATGTCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAGTGACGAGGTTTCAGGAAAATGCCAGTGAAGGGAAGGCCCCTGCAGAA
GACGTCTTTAAGAAGCCCCTGCCTCCTACTGTGAAGAAGGAAGAGAGTCCCCCTCCACCTAAAGTGGTAAACCCACTGATCGGCCTCTTG
GGTGAATATGGAGGAGACAGTGACTATGAGGAGGAAGAAGAGGAGGAACAGACCCCTCCCCCACAGCCCCGCACAGCACAGCCCCAGAAG
CGAGAGGAGCAAACCAAGAAGGAGAATGAAGAAGACAAACTCACTGACTGGAATAAACTGGCTTGTCTGCTTTGCAGAAGGCAGTTTCCC
AATAAAGAAGTTCTGATCAAACACCAGCAGCTGTCAGACCTGCACAAGCAAAACCTGGAAATCCACCGGAAGATAAAACAGTCTGAGCAG
GAGCTAGCCTATCTGGAAAGGAGAGAACGAGAGGGAAAGTTTAAAGGAAGAGGAAATGATCGCAGGGAAAAGCTCCAGTCTTTTGACTCT
CCAGAAAGGAAACGGATTAAGTACTCCAGGGAAACTGACAGTGATCGTAAACTTGTTGATAAAGAAGATATCGACACTAGCAGCAAAGGA
GGCTGTGTCCAACAGGCTACTGGCTGGAGGAAAGGGACAGGCCTGGGATATGGCCATCCTGGATTGGCTTCATCAGAGGAGGCTGAAGGC
CGGATGAGGGGCCCCAGTGTTGGAGCCTCAGGAAGAACCAGCAAAAGACAGTCCAACGAGACTTACCGAGATGCTGTTCGAAGAGTCATG
TTTGCTCGATATAAAGAACTCGATTAAGAAAGGAGACAAGTTCCATGGGATACAACCTCCCTCTTGTTTTGTTTGTCTCTCCTTTTCTTT


Top

FusionGenePPI for SEMA3F_RBM6


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SEMA3FSHBG, UBC, MOV10, NXF1RBM6SIRT7, TAF7, SF3B3, ASB12, ASB18, EEF1G, SHMT2, NXF1, FGL1, HNRNPA1, PPP1CB, EMC2, MATR3, PAPD5, MMGT1, NAGK, MITF, CEPT1, ALS2, ZC3H18, PAK7, TRIM25, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SEMA3F_RBM6


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SEMA3F_RBM6


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSEMA3FC0014170Endometrial Neoplasms1CTD_human