FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32905

FusionGeneSummary for SCYL1_FRMD8

check button Fusion gene summary
Fusion gene informationFusion gene name: SCYL1_FRMD8
Fusion gene ID: 32905
HgeneTgene
Gene symbol

SCYL1

FRMD8

Gene ID

57410

83786

Gene nameSCY1 like pseudokinase 1FERM domain containing 8
SynonymsGKLP|HT019|NKTL|NTKL|P105|SCAR21|TAPK|TEIF|TRAPFKSG44
Cytomap

11q13.1

11q13.1

Type of geneprotein-codingprotein-coding
DescriptionN-terminal kinase-like proteinSCY1-like protein 1SCY1-like, kinase-like 1coated vesicle-associated kinase of 90 kDalikely ortholog of mouse N-terminal kinase-like proteintelomerase regulation-associated proteintelomerase transcriptional elements-intFERM domain-containing protein 8
Modification date2018052220180519
UniProtAcc

Q96KG9

Q9BZ67

Ensembl transtripts involved in fusion geneENST00000525364, ENST00000270176, 
ENST00000420247, ENST00000533862, 
ENST00000279270, ENST00000524944, 
ENST00000527009, ENST00000534462, 
ENST00000317568, ENST00000531296, 
ENST00000355991, ENST00000416776, 
Fusion gene scores* DoF score4 X 4 X 6=967 X 5 X 9=315
# samples 811
** MAII scorelog2(8/96*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/315*10)=-1.51784830486262
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SCYL1 [Title/Abstract] AND FRMD8 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSCYL1

GO:0006890

retrograde vesicle-mediated transport, Golgi to ER

18556652


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-BH-A0B7-01ASCYL1chr11

65294588

+FRMD8chr11

65172335

+
TCGALDLUADTCGA-44-4112-01ASCYL1chr11

65300276

+FRMD8chr11

65172335

+
TCGALDLUADTCGA-55-8510-01ASCYL1chr11

65300276

+FRMD8chr11

65178713

+
TCGALDOVTCGA-24-1431-01ASCYL1chr11

65300276

+FRMD8chr11

65172335

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000525364ENST00000317568SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000525364ENST00000531296SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000525364ENST00000355991SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000525364ENST00000416776SCYL1chr11

65294588

+FRMD8chr11

65172335

+
In-frameENST00000270176ENST00000317568SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000270176ENST00000531296SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000270176ENST00000355991SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000270176ENST00000416776SCYL1chr11

65294588

+FRMD8chr11

65172335

+
In-frameENST00000420247ENST00000317568SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000420247ENST00000531296SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000420247ENST00000355991SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000420247ENST00000416776SCYL1chr11

65294588

+FRMD8chr11

65172335

+
In-frameENST00000533862ENST00000317568SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000533862ENST00000531296SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000533862ENST00000355991SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000533862ENST00000416776SCYL1chr11

65294588

+FRMD8chr11

65172335

+
In-frameENST00000279270ENST00000317568SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000279270ENST00000531296SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000279270ENST00000355991SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000279270ENST00000416776SCYL1chr11

65294588

+FRMD8chr11

65172335

+
In-frameENST00000524944ENST00000317568SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000524944ENST00000531296SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000524944ENST00000355991SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000524944ENST00000416776SCYL1chr11

65294588

+FRMD8chr11

65172335

+
In-frameENST00000527009ENST00000317568SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000527009ENST00000531296SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000527009ENST00000355991SCYL1chr11

65294588

+FRMD8chr11

65172335

+
5CDS-intronENST00000527009ENST00000416776SCYL1chr11

65294588

+FRMD8chr11

65172335

+
intron-3CDSENST00000534462ENST00000317568SCYL1chr11

65294588

+FRMD8chr11

65172335

+
intron-intronENST00000534462ENST00000531296SCYL1chr11

65294588

+FRMD8chr11

65172335

+
intron-intronENST00000534462ENST00000355991SCYL1chr11

65294588

+FRMD8chr11

65172335

+
intron-intronENST00000534462ENST00000416776SCYL1chr11

65294588

+FRMD8chr11

65172335

+
In-frameENST00000525364ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000525364ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000525364ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000525364ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65172335

+
In-frameENST00000270176ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000270176ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000270176ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000270176ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65172335

+
In-frameENST00000420247ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000420247ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000420247ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000420247ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65172335

+
In-frameENST00000533862ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000533862ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000533862ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000533862ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65172335

+
In-frameENST00000279270ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000279270ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000279270ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000279270ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65172335

+
In-frameENST00000524944ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000524944ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000524944ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000524944ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65172335

+
In-frameENST00000527009ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000527009ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000527009ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65172335

+
5CDS-intronENST00000527009ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65172335

+
intron-3CDSENST00000534462ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65172335

+
intron-intronENST00000534462ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65172335

+
intron-intronENST00000534462ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65172335

+
intron-intronENST00000534462ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65172335

+
Frame-shiftENST00000525364ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000525364ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000525364ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000525364ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65178713

+
Frame-shiftENST00000270176ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000270176ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000270176ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000270176ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65178713

+
Frame-shiftENST00000420247ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000420247ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000420247ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000420247ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65178713

+
Frame-shiftENST00000533862ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000533862ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000533862ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000533862ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65178713

+
Frame-shiftENST00000279270ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000279270ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000279270ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000279270ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65178713

+
Frame-shiftENST00000524944ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000524944ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000524944ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000524944ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65178713

+
Frame-shiftENST00000527009ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000527009ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000527009ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65178713

+
5CDS-intronENST00000527009ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65178713

+
intron-3CDSENST00000534462ENST00000317568SCYL1chr11

65300276

+FRMD8chr11

65178713

+
intron-intronENST00000534462ENST00000531296SCYL1chr11

65300276

+FRMD8chr11

65178713

+
intron-intronENST00000534462ENST00000355991SCYL1chr11

65300276

+FRMD8chr11

65178713

+
intron-intronENST00000534462ENST00000416776SCYL1chr11

65300276

+FRMD8chr11

65178713

+

Top

FusionProtFeatures for SCYL1_FRMD8


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SCYL1

Q96KG9

FRMD8

Q9BZ67

Regulates COPI-mediated retrograde protein traffic atthe interface between the Golgi apparatus and the endoplasmicreticulum (PubMed:18556652). Involved in the maintenance of theGolgi apparatus morphology (PubMed:26581903). Has no detectablekinase activity in vitro (PubMed:18556652).{ECO:0000269|PubMed:18556652, ECO:0000269|PubMed:26581903}. Isoform 6 acts as transcriptional activator. It binds tothree different types of GC-rich DNA binding sites (box-A, -B and-C) in the beta-polymerase promoter region. It also binds to theTERT promoter region. {ECO:0000269|PubMed:18556652}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSCYL1chr11:65300276chr11:65172335ENST00000270176+91814_314410809DomainProtein kinase
HgeneSCYL1chr11:65300276chr11:65172335ENST00000279270+91714_314410782DomainProtein kinase
HgeneSCYL1chr11:65300276chr11:65172335ENST00000420247+91814_314410792DomainProtein kinase
HgeneSCYL1chr11:65300276chr11:65172335ENST00000533862+91814_314410788DomainProtein kinase
HgeneSCYL1chr11:65300276chr11:65172335ENST00000270176+918350_388410809RepeatNote=HEAT 1
HgeneSCYL1chr11:65300276chr11:65172335ENST00000279270+917350_388410782RepeatNote=HEAT 1
HgeneSCYL1chr11:65300276chr11:65172335ENST00000420247+918350_388410792RepeatNote=HEAT 1
HgeneSCYL1chr11:65300276chr11:65172335ENST00000533862+918350_388410788RepeatNote=HEAT 1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSCYL1chr11:65294588chr11:65172335ENST00000270176+618761_797283809Coiled coilOntology_term=ECO:0000255
HgeneSCYL1chr11:65294588chr11:65172335ENST00000279270+617761_797283782Coiled coilOntology_term=ECO:0000255
HgeneSCYL1chr11:65294588chr11:65172335ENST00000420247+618761_797283792Coiled coilOntology_term=ECO:0000255
HgeneSCYL1chr11:65294588chr11:65172335ENST00000533862+618761_797283788Coiled coilOntology_term=ECO:0000255
HgeneSCYL1chr11:65300276chr11:65172335ENST00000270176+918761_797410809Coiled coilOntology_term=ECO:0000255
HgeneSCYL1chr11:65300276chr11:65172335ENST00000279270+917761_797410782Coiled coilOntology_term=ECO:0000255
HgeneSCYL1chr11:65300276chr11:65172335ENST00000420247+918761_797410792Coiled coilOntology_term=ECO:0000255
HgeneSCYL1chr11:65300276chr11:65172335ENST00000533862+918761_797410788Coiled coilOntology_term=ECO:0000255
HgeneSCYL1chr11:65294588chr11:65172335ENST00000270176+618589_619283809Compositional biasNote=Pro-rich
HgeneSCYL1chr11:65294588chr11:65172335ENST00000279270+617589_619283782Compositional biasNote=Pro-rich
HgeneSCYL1chr11:65294588chr11:65172335ENST00000420247+618589_619283792Compositional biasNote=Pro-rich
HgeneSCYL1chr11:65294588chr11:65172335ENST00000533862+618589_619283788Compositional biasNote=Pro-rich
HgeneSCYL1chr11:65300276chr11:65172335ENST00000270176+918589_619410809Compositional biasNote=Pro-rich
HgeneSCYL1chr11:65300276chr11:65172335ENST00000279270+917589_619410782Compositional biasNote=Pro-rich
HgeneSCYL1chr11:65300276chr11:65172335ENST00000420247+918589_619410792Compositional biasNote=Pro-rich
HgeneSCYL1chr11:65300276chr11:65172335ENST00000533862+918589_619410788Compositional biasNote=Pro-rich
HgeneSCYL1chr11:65294588chr11:65172335ENST00000270176+61814_314283809DomainProtein kinase
HgeneSCYL1chr11:65294588chr11:65172335ENST00000279270+61714_314283782DomainProtein kinase
HgeneSCYL1chr11:65294588chr11:65172335ENST00000420247+61814_314283792DomainProtein kinase
HgeneSCYL1chr11:65294588chr11:65172335ENST00000533862+61814_314283788DomainProtein kinase
HgeneSCYL1chr11:65294588chr11:65172335ENST00000270176+618350_388283809RepeatNote=HEAT 1
HgeneSCYL1chr11:65294588chr11:65172335ENST00000270176+618389_427283809RepeatNote=HEAT 2
HgeneSCYL1chr11:65294588chr11:65172335ENST00000270176+618507_545283809RepeatNote=HEAT 3
HgeneSCYL1chr11:65294588chr11:65172335ENST00000279270+617350_388283782RepeatNote=HEAT 1
HgeneSCYL1chr11:65294588chr11:65172335ENST00000279270+617389_427283782RepeatNote=HEAT 2
HgeneSCYL1chr11:65294588chr11:65172335ENST00000279270+617507_545283782RepeatNote=HEAT 3
HgeneSCYL1chr11:65294588chr11:65172335ENST00000420247+618350_388283792RepeatNote=HEAT 1
HgeneSCYL1chr11:65294588chr11:65172335ENST00000420247+618389_427283792RepeatNote=HEAT 2
HgeneSCYL1chr11:65294588chr11:65172335ENST00000420247+618507_545283792RepeatNote=HEAT 3
HgeneSCYL1chr11:65294588chr11:65172335ENST00000533862+618350_388283788RepeatNote=HEAT 1
HgeneSCYL1chr11:65294588chr11:65172335ENST00000533862+618389_427283788RepeatNote=HEAT 2
HgeneSCYL1chr11:65294588chr11:65172335ENST00000533862+618507_545283788RepeatNote=HEAT 3
HgeneSCYL1chr11:65300276chr11:65172335ENST00000270176+918389_427410809RepeatNote=HEAT 2
HgeneSCYL1chr11:65300276chr11:65172335ENST00000270176+918507_545410809RepeatNote=HEAT 3
HgeneSCYL1chr11:65300276chr11:65172335ENST00000279270+917389_427410782RepeatNote=HEAT 2
HgeneSCYL1chr11:65300276chr11:65172335ENST00000279270+917507_545410782RepeatNote=HEAT 3
HgeneSCYL1chr11:65300276chr11:65172335ENST00000420247+918389_427410792RepeatNote=HEAT 2
HgeneSCYL1chr11:65300276chr11:65172335ENST00000420247+918507_545410792RepeatNote=HEAT 3
HgeneSCYL1chr11:65300276chr11:65172335ENST00000533862+918389_427410788RepeatNote=HEAT 2
HgeneSCYL1chr11:65300276chr11:65172335ENST00000533862+918507_545410788RepeatNote=HEAT 3
TgeneFRMD8chr11:65294588chr11:65172335ENST00000317568+81130_376357465DomainFERM
TgeneFRMD8chr11:65294588chr11:65172335ENST00000355991+71030_376301409DomainFERM
TgeneFRMD8chr11:65300276chr11:65172335ENST00000317568+81130_376357465DomainFERM
TgeneFRMD8chr11:65300276chr11:65172335ENST00000355991+71030_376301409DomainFERM


Top

FusionGeneSequence for SCYL1_FRMD8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SCYL1_ENST00000525364_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_391aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKP

>In-frame_SCYL1_ENST00000270176_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_391aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKP

>In-frame_SCYL1_ENST00000420247_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_391aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKP

>In-frame_SCYL1_ENST00000533862_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_391aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKP

>In-frame_SCYL1_ENST00000279270_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_391aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKP

>In-frame_SCYL1_ENST00000524944_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_391aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKP

>In-frame_SCYL1_ENST00000527009_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_248aa
MAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIP
KTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAP

>In-frame_SCYL1_ENST00000525364_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_518aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSS
TDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAP

>In-frame_SCYL1_ENST00000270176_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_518aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSS
TDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAP

>In-frame_SCYL1_ENST00000420247_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_518aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSS
TDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAP

>In-frame_SCYL1_ENST00000533862_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_518aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSS
TDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAP

>In-frame_SCYL1_ENST00000279270_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_518aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSS
TDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAP

>In-frame_SCYL1_ENST00000524944_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_518aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSS
TDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAP

>In-frame_SCYL1_ENST00000527009_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_375aa
MAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIP
KTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEF
GNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAEL
MSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKPKRTTSFFSRQLSLGQG

>In-frame_SCYL1_ENST00000525364_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_518aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSS
TDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAP

>In-frame_SCYL1_ENST00000270176_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_518aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSS
TDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAP

>In-frame_SCYL1_ENST00000420247_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_518aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSS
TDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAP

>In-frame_SCYL1_ENST00000533862_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_518aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSS
TDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAP

>In-frame_SCYL1_ENST00000279270_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_518aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSS
TDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAP

>In-frame_SCYL1_ENST00000524944_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_518aa
MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLH
VVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPE
LEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSN
RFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSS
TDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAP

>In-frame_SCYL1_ENST00000527009_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_375aa
MAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIP
KTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEF
GNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKAEL
MSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKPKRTTSFFSRQLSLGQG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SCYL1_ENST00000525364_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_1173nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCG
GCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGG
AGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCG
AAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGC

>In-frame_SCYL1_ENST00000270176_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_1173nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCG
GCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGG
AGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCG
AAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGC

>In-frame_SCYL1_ENST00000420247_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_1173nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCG
GCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGG
AGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCG
AAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGC

>In-frame_SCYL1_ENST00000533862_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_1173nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCG
GCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGG
AGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCG
AAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGC

>In-frame_SCYL1_ENST00000279270_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_1173nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCG
GCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGG
AGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCG
AAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGC

>In-frame_SCYL1_ENST00000524944_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_1173nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCG
GCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGG
AGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCG
AAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGC

>In-frame_SCYL1_ENST00000527009_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_744nt
ATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCT
CCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCA
GACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCC
AAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCA
CCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGGCCGAACTGATGAGCAGTCTCATTGAGTAC
TGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCT
GTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAG
GGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCC

>In-frame_SCYL1_ENST00000525364_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1554nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGC
CTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTC
CTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCC
ACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTC
CCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTAC
TGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCT
GTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAG
GGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCC

>In-frame_SCYL1_ENST00000270176_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1554nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGC
CTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTC
CTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCC
ACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTC
CCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTAC
TGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCT
GTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAG
GGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCC

>In-frame_SCYL1_ENST00000420247_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1554nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGC
CTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTC
CTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCC
ACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTC
CCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTAC
TGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCT
GTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAG
GGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCC

>In-frame_SCYL1_ENST00000533862_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1554nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGC
CTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTC
CTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCC
ACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTC
CCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTAC
TGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCT
GTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAG
GGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCC

>In-frame_SCYL1_ENST00000279270_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1554nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGC
CTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTC
CTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCC
ACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTC
CCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTAC
TGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCT
GTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAG
GGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCC

>In-frame_SCYL1_ENST00000524944_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1554nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGC
CTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTC
CTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCC
ACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTC
CCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTAC
TGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCT
GTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAG
GGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCC

>In-frame_SCYL1_ENST00000527009_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1125nt
ATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCT
CCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCA
GACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCC
AAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCA
CCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTC
TTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTC
GGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTG
GTGGTCAAGATGTTCTCATCCACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCA
ACAGTCAACACCCAGATCTTCCCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTG
ATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGAC
CCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATC
GACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGG

>In-frame_SCYL1_ENST00000525364_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1554nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGC
CTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTC
CTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCC
ACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTC
CCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTAC
TGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCT
GTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAG
GGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCC

>In-frame_SCYL1_ENST00000270176_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1554nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGC
CTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTC
CTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCC
ACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTC
CCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTAC
TGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCT
GTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAG
GGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCC

>In-frame_SCYL1_ENST00000420247_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1554nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGC
CTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTC
CTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCC
ACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTC
CCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTAC
TGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCT
GTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAG
GGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCC

>In-frame_SCYL1_ENST00000533862_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1554nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGC
CTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTC
CTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCC
ACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTC
CCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTAC
TGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCT
GTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAG
GGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCC

>In-frame_SCYL1_ENST00000279270_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1554nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGC
CTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTC
CTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCC
ACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTC
CCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTAC
TGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCT
GTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAG
GGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCC

>In-frame_SCYL1_ENST00000524944_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1554nt
ATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCC
CTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTG
GCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCAC
GTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGG
CTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGAC
CGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAG
CTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGC
CTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTAC
TGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAAC
CGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGC
CTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTC
CTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCC
ACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTC
CCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTAC
TGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCT
GTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAG
GGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCC

>In-frame_SCYL1_ENST00000527009_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_1125nt
ATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCT
CCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCA
GACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCC
AAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCA
CCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTC
TTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTC
GGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTG
GTGGTCAAGATGTTCTCATCCACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCA
ACAGTCAACACCCAGATCTTCCCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTG
ATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGAC
CCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATC
GACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SCYL1_ENST00000525364_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_3415nt
CTCTCCGCCCCGCCCCGGCTCGGGCGGCCGGAGGACCCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTG
CCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCC
GCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCT
TCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGG
CTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCG
TGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGT
GGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATG
ACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAG
TCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGG
GAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAA
CCAACCTCTTCCTGGAGGAGATTCAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAG
GCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTG
TGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACAT
CCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCA
CCCGGCAGGAGGAGGGCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCAC
GTGGGGAGGGCTGCCTCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAG
GGCCTCCTGTAGGGCTCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCA
GCTGCCACCCTCACCTAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGG
TAGAGGACCAAGGATTGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTC
CTCCTGCTAGTGCTCCACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCC
ACCACTCTGAGGAGGGTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATC
AGGAATGGAGGGAGCCAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCA
TGCCTTTCTGATAGCCTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTG
AAAAACTGAAAATCCCCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCT
GGGTCTTCAGGTTTTAGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCC
TTCCCAGGTGGCGCCATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGAC
ACTTGGAAAGGTGACTGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGC
TGAGAGCCCCTGAGAGGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTG
GCTGCACAGGGCTTGGCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTC
ACCCTCCTCCCTTTGGTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGC
GGAAAGAAGAGGCCTGGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTG
GAGTTGCTCGGTCTTGCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTA
TTTTTTTTATTTTTTTATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCT
CTGTCTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAG
TAGAGATAGGGTTTCACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATT
ATAGGCGTGAGCCACCGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGT
GTGTGTCTGAGTACACAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCT

>In-frame_SCYL1_ENST00000270176_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_3415nt
CTCTCCGCCCCGCCCCGGCTCGGGCGGCCGGAGGACCCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTG
CCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCC
GCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCT
TCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGG
CTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCG
TGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGT
GGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATG
ACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAG
TCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGG
GAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAA
CCAACCTCTTCCTGGAGGAGATTCAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAG
GCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTG
TGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACAT
CCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCA
CCCGGCAGGAGGAGGGCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCAC
GTGGGGAGGGCTGCCTCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAG
GGCCTCCTGTAGGGCTCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCA
GCTGCCACCCTCACCTAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGG
TAGAGGACCAAGGATTGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTC
CTCCTGCTAGTGCTCCACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCC
ACCACTCTGAGGAGGGTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATC
AGGAATGGAGGGAGCCAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCA
TGCCTTTCTGATAGCCTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTG
AAAAACTGAAAATCCCCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCT
GGGTCTTCAGGTTTTAGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCC
TTCCCAGGTGGCGCCATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGAC
ACTTGGAAAGGTGACTGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGC
TGAGAGCCCCTGAGAGGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTG
GCTGCACAGGGCTTGGCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTC
ACCCTCCTCCCTTTGGTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGC
GGAAAGAAGAGGCCTGGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTG
GAGTTGCTCGGTCTTGCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTA
TTTTTTTTATTTTTTTATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCT
CTGTCTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAG
TAGAGATAGGGTTTCACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATT
ATAGGCGTGAGCCACCGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGT
GTGTGTCTGAGTACACAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCT

>In-frame_SCYL1_ENST00000420247_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_3407nt
CCCGCCCCGGCTCGGGCGGCCGGAGGACCCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTGCCCGGGAC
CCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCCGCAAGAAG
GCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGC
TTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACC
CCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCC
CTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTT
GGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCG
GAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAAT
GGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAAC
CCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTC
TTCCTGGAGGAGATTCAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAG
GACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCC
AGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTC
AGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCACCCGGCAG
GAGGAGGGCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCACGTGGGGAG
GGCTGCCTCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAGGGCCTCCT
GTAGGGCTCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCAGCTGCCAC
CCTCACCTAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGGTAGAGGAC
CAAGGATTGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTCCTCCTGCT
AGTGCTCCACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCCACCACTCT
GAGGAGGGTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATCAGGAATGG
AGGGAGCCAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCATGCCTTTC
TGATAGCCTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTGAAAAACTG
AAAATCCCCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCTGGGTCTTC
AGGTTTTAGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCCTTCCCAGG
TGGCGCCATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGACACTTGGAA
AGGTGACTGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGCTGAGAGCC
CCTGAGAGGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTGGCTGCACA
GGGCTTGGCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTCACCCTCCT
CCCTTTGGTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGCGGAAAGAA
GAGGCCTGGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTGGAGTTGCT
CGGTCTTGCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTATTTTTTTT
ATTTTTTTATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCTCTGTCTCA
AGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAGTAGAGATA
GGGTTTCACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATTATAGGCGT
GAGCCACCGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGTGTGTGTCT
GAGTACACAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCTTTGGGACA

>In-frame_SCYL1_ENST00000533862_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_3380nt
CCCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTC
ATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTC
GTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATC
CTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGA
GTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGC
CTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCC
CAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTG
GTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTA
CGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGC
TTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGGCCGAACTG
ATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGAC
CCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATC
GACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGG
AGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAGGGCGACTGGGGGCCCTGGCCC
GGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCACGTGGGGAGGGCTGCCTCAGCAGGTTTCTCAGACCA
CGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGGCTCCTCTGCAGCCTGCCCTCC
CTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCAGCTGCCACCCTCACCTAGAAACATGCCTTTGTGCC
CACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGATTGAGGTTTGGGACCTGAAGC
TCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCTCCACCCCCCGGACTTGGATGA
CCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCCACCACTCTGAGGAGGGTAGGAGGGGCCTCCCTGGA
TTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATCAGGAATGGAGGGAGCCAGGCAGGGCCCTACCTGGG
GTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCATGCCTTTCTGATAGCCTTTGGTGATGTCACTGCTG
GGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTGAAAAACTGAAAATCCCCTGGTGGGCACTCCCTGGA
GCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTTTAGTTTGGTCTTTGTTCATCT
GAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGCCATGGATTCCTCTGGGGGCTG
GCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGACTGATATGGGTGCTTGGCTTC
TCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAGAGGAGGGCTTTCCCAGCCCTG
GGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTTGGCTTTGTCTTCGTTCCCGGT
GGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTTGGTAGCTTGTGAATGTGCCAG
GTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCCTGGGAAGGGCCCCCAGTCTTT
TGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCTTGCGGAGCTGCCCGCCTGCCT
GTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTATTTTTTTTATTTTTTTATTTTTTTTGAGACGGAGT
CTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCTCTGTCTCAAGCGATTCTCCTGCCTCAGCCTCCTGA
GTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTTCACCATGTTGGTCAGGCTGGT
CGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCACCGCCCCCAGCTGATTCCAGG
CGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTACACAGATGATGTGTTTTCCCTT
CAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAGTATTTTACTCATTCTTTGAAT

>In-frame_SCYL1_ENST00000279270_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_3379nt
CCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCA
TCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCG
TCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCC
TGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAG
TGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCC
TCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCC
AGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGG
TCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTAC
GCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCT
TCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGGCCGAACTGA
TGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACC
CCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCG
ACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGA
GCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAGGGCGACTGGGGGCCCTGGCCCG
GCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCACGTGGGGAGGGCTGCCTCAGCAGGTTTCTCAGACCAC
GGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGGCTCCTCTGCAGCCTGCCCTCCC
TTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCAGCTGCCACCCTCACCTAGAAACATGCCTTTGTGCCC
ACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGATTGAGGTTTGGGACCTGAAGCT
CCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCTCCACCCCCCGGACTTGGATGAC
CAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCCACCACTCTGAGGAGGGTAGGAGGGGCCTCCCTGGAT
TGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATCAGGAATGGAGGGAGCCAGGCAGGGCCCTACCTGGGG
TCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCATGCCTTTCTGATAGCCTTTGGTGATGTCACTGCTGG
GAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTGAAAAACTGAAAATCCCCTGGTGGGCACTCCCTGGAG
CCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTTTAGTTTGGTCTTTGTTCATCTG
AGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGCCATGGATTCCTCTGGGGGCTGG
CGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGACTGATATGGGTGCTTGGCTTCT
CTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAGAGGAGGGCTTTCCCAGCCCTGG
GACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTTGGCTTTGTCTTCGTTCCCGGTG
GAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTTGGTAGCTTGTGAATGTGCCAGG
TGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCCTGGGAAGGGCCCCCAGTCTTTT
GGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCTTGCGGAGCTGCCCGCCTGCCTG
TTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTATTTTTTTTATTTTTTTATTTTTTTTGAGACGGAGTC
TTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCTCTGTCTCAAGCGATTCTCCTGCCTCAGCCTCCTGAG
TAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTTCACCATGTTGGTCAGGCTGGTC
GTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCACCGCCCCCAGCTGATTCCAGGC
GAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTACACAGATGATGTGTTTTCCCTTC
AGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAGTATTTTACTCATTCTTTGAATG

>In-frame_SCYL1_ENST00000524944_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_3371nt
AAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAG
CCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGAT
GTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTAC
ATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCT
GGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCAC
AACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAAC
GGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAG
AAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCT
GGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAG
AACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGGCCGAACTGATGAGCAGT
CTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCC
TCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTG
GAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACC
GTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAGGGCGACTGGGGGCCCTGGCCCGGCACTGTC
CTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCACGTGGGGAGGGCTGCCTCAGCAGGTTTCTCAGACCACGGAGAAGT
GACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGGCTCCTCTGCAGCCTGCCCTCCCTTCCCCCG
GATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCAGCTGCCACCCTCACCTAGAAACATGCCTTTGTGCCCACCTCAAG
ATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGATTGAGGTTTGGGACCTGAAGCTCCAGTGTG
TGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCTCCACCCCCCGGACTTGGATGACCAGTTTCC
CACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCCACCACTCTGAGGAGGGTAGGAGGGGCCTCCCTGGATTGAACCGG
GACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATCAGGAATGGAGGGAGCCAGGCAGGGCCCTACCTGGGGTCCTGTGC
CCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCATGCCTTTCTGATAGCCTTTGGTGATGTCACTGCTGGGAGGTGGC
TATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTGAAAAACTGAAAATCCCCTGGTGGGCACTCCCTGGAGCCCAAGCA
GCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTTTAGTTTGGTCTTTGTTCATCTGAGTTGTGC
TGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGCCATGGATTCCTCTGGGGGCTGGCGCATGCC
CAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGACTGATATGGGTGCTTGGCTTCTCTGGTCCC
AGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAGAGGAGGGCTTTCCCAGCCCTGGGACCCTCC
GAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTTGGCTTTGTCTTCGTTCCCGGTGGAAAACCG
TGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTTGGTAGCTTGTGAATGTGCCAGGTGTTTCGA
GGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCCTGGGAAGGGCCCCCAGTCTTTTGGAATGTC
CTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCTTGCGGAGCTGCCCGCCTGCCTGTTCTGGCG
GCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTATTTTTTTTATTTTTTTATTTTTTTTGAGACGGAGTCTTGCTCTG
TTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCTCTGTCTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGG
ATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTTCACCATGTTGGTCAGGCTGGTCGTGAACTC
CTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCACCGCCCCCAGCTGATTCCAGGCGAATTCTT
CTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTACACAGATGATGTGTTTTCCCTTCAGCTTCTT
ACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAGTATTTTACTCATTCTTTGAATGTTCTCATT

>In-frame_SCYL1_ENST00000527009_chr11_65294588_+_FRMD8_ENST00000317568_chr11_65172335_+_3388nt
GGCGGAGGGACCGAGGGACCGACAGGCGGACAGGGCCGGGGTCACGTGGGCCCGGCGAAGTGTCCCTAAGGCTGACCTGGGGAGAGACCT
GGCTGCGGGCCCTTGTCTTCCGGCCACACAACAGCTCTGGGACCATCTCAGGCCCCGCTGCCCTCCCCTAGGCCACAGGCAGCCCCGTGT
CCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACC
CCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCA
AGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACG
ACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGT
ATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTG
GCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAG
CAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACC
CAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGG
CCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGC
CCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCT
CCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGG
GCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAGGGCGACTGGGGGC
CCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCACGTGGGGAGGGCTGCCTCAGCAGGTTTC
TCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGGCTCCTCTGCAGCC
TGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCAGCTGCCACCCTCACCTAGAAACATGCC
TTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGATTGAGGTTTGGGA
CCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCTCCACCCCCCGGAC
TTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCCACCACTCTGAGGAGGGTAGGAGGGGCC
TCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATCAGGAATGGAGGGAGCCAGGCAGGGCCC
TACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCATGCCTTTCTGATAGCCTTTGGTGATGT
CACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTGAAAAACTGAAAATCCCCTGGTGGGCAC
TCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTTTAGTTTGGTCTTT
GTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGCCATGGATTCCTCT
GGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGACTGATATGGGTGC
TTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAGAGGAGGGCTTTCC
CAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTTGGCTTTGTCTTCG
TTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTTGGTAGCTTGTGAA
TGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCCTGGGAAGGGCCCC
CAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCTTGCGGAGCTGCCC
GCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTATTTTTTTTATTTTTTTATTTTTTTTGA
GACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCTCTGTCTCAAGCGATTCTCCTGCCTCAG
CCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTTCACCATGTTGGTC
AGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCACCGCCCCCAGCTG
ATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTACACAGATGATGTGT
TTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAGTATTTTACTCATT

>In-frame_SCYL1_ENST00000525364_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3796nt
CTCTCCGCCCCGCCCCGGCTCGGGCGGCCGGAGGACCCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTG
CCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCC
GCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCT
TCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGG
CTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCG
TGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGT
GGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATG
ACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAG
TCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGG
GAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAA
CCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCC
CTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCT
TCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCA
TGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTAC
ATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGA
GCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCA
AGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAG
TGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGG
AGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAGGGCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGC
AACAGTCTCATGGGTCACCACGTGGGGAGGGCTGCCTCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCC
GGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGGCTCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCA
GGACCATCCGATCAAGCTGCAGCTGCCACCCTCACCTAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGT
GCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGATTGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTT
GGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCTCCACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCAT
CCCCCAATACCAGGCTGGGCCACCACTCTGAGGAGGGTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCA
CCACACCTCCCTGGTTGAATCAGGAATGGAGGGAGCCAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGG
CACGAGATACCAGAAAGAGCATGCCTTTCTGATAGCCTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCA
GACCCACACTCACAGTCTGTGAAAAACTGAAAATCCCCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACC
TGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTTTAGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTG
GGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGCCATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGAC
ACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGACTGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGC
TCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAGAGGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGG
TGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTTGGCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTAC
TCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTTGGTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATG
GACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCCTGGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGC
CAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCTTGCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTG
CTTTGATTCCAGGTGATTTTATTTTTTTTATTTTTTTATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCG
CATCTCGGCTCACTGCAACCTCTGTCTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCC
CGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTTCACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCA
ACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCACCGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGT
TCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTACACAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCC
TTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAGTATTTTACTCATTCTTTGAATGTTCTCATTCTTTTGTATCATGTGACTTATTAAA

>In-frame_SCYL1_ENST00000270176_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3796nt
CTCTCCGCCCCGCCCCGGCTCGGGCGGCCGGAGGACCCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTG
CCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCC
GCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCT
TCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGG
CTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCG
TGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGT
GGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATG
ACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAG
TCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGG
GAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAA
CCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCC
CTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCT
TCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCA
TGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTAC
ATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGA
GCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCA
AGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAG
TGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGG
AGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAGGGCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGC
AACAGTCTCATGGGTCACCACGTGGGGAGGGCTGCCTCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCC
GGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGGCTCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCA
GGACCATCCGATCAAGCTGCAGCTGCCACCCTCACCTAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGT
GCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGATTGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTT
GGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCTCCACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCAT
CCCCCAATACCAGGCTGGGCCACCACTCTGAGGAGGGTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCA
CCACACCTCCCTGGTTGAATCAGGAATGGAGGGAGCCAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGG
CACGAGATACCAGAAAGAGCATGCCTTTCTGATAGCCTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCA
GACCCACACTCACAGTCTGTGAAAAACTGAAAATCCCCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACC
TGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTTTAGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTG
GGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGCCATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGAC
ACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGACTGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGC
TCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAGAGGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGG
TGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTTGGCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTAC
TCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTTGGTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATG
GACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCCTGGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGC
CAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCTTGCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTG
CTTTGATTCCAGGTGATTTTATTTTTTTTATTTTTTTATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCG
CATCTCGGCTCACTGCAACCTCTGTCTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCC
CGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTTCACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCA
ACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCACCGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGT
TCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTACACAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCC
TTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAGTATTTTACTCATTCTTTGAATGTTCTCATTCTTTTGTATCATGTGACTTATTAAA

>In-frame_SCYL1_ENST00000420247_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3788nt
CCCGCCCCGGCTCGGGCGGCCGGAGGACCCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTGCCCGGGAC
CCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCCGCAAGAAG
GCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGC
TTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACC
CCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCC
CTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTT
GGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCG
GAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAAT
GGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAAC
CCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTC
TTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCCCTGAGGAT
TTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCTTCAAGGTG
GGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCATGCGCATC
CGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTACATGGCTTC
CTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCG
GCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGG
AGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCG
AAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGC
TGAGGACGCTGCACCCGGCAGGAGGAGGGCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCT
CATGGGTCACCACGTGGGGAGGGCTGCCTCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTG
CAAAGCTGGCCAGGGCCTCCTGTAGGGCTCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATC
CGATCAAGCTGCAGCTGCCACCCTCACCTAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTG
GCAGCTCCAGTGGTAGAGGACCAAGGATTGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACC
AGTCTCCGTCTTCCTCCTGCTAGTGCTCCACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAAT
ACCAGGCTGGGCCACCACTCTGAGGAGGGTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCT
CCCTGGTTGAATCAGGAATGGAGGGAGCCAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGAT
ACCAGAAAGAGCATGCCTTTCTGATAGCCTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACA
CTCACAGTCTGTGAAAAACTGAAAATCCCCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCC
CCTCCCTGTGTCTGGGTCTTCAGGTTTTAGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTC
TGCTGTGCGCTCCTTCCCAGGTGGCGCCATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTT
CTTTATCGAGGACACTTGGAAAGGTGACTGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTT
GTCCCAGATGAGCTGAGAGCCCCTGAGAGGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCT
GGGACTTCCTGTGGCTGCACAGGGCTTGGCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTA
TCAGAGCCTGTTCACCCTCCTCCCTTTGGTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGT
TAAAATAATAGGCGGAAAGAAGAGGCCTGGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTC
GTCTCCCGTCCTGGAGTTGCTCGGTCTTGCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATT
CCAGGTGATTTTATTTTTTTTATTTTTTTATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGG
CTCACTGCAACCTCTGTCTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATT
TTTGTATTTTTAGTAGAGATAGGGTTTCACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCA
AAGTGCTGGGATTATAGGCGTGAGCCACCGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGA
TGGGTTGGAGTGTGTGTGTCTGAGTACACAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATT
TTCTGCTTGTCCTTTGGGACAAAGCAGTATTTTACTCATTCTTTGAATGTTCTCATTCTTTTGTATCATGTGACTTATTAAAATCAGTTT

>In-frame_SCYL1_ENST00000533862_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3761nt
CCCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTC
ATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTC
GTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATC
CTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGA
GTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGC
CTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCC
CAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTG
GTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTA
CGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGC
TTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAG
CCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAG
CTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTAT
CAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTC
ATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAG
CAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGT
GCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGG
ATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGG
CAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAG
GGCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCACGTGGGGAGGGCTGC
CTCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGG
CTCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCAGCTGCCACCCTCAC
CTAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGA
TTGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCT
CCACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCCACCACTCTGAGGAG
GGTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATCAGGAATGGAGGGAG
CCAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCATGCCTTTCTGATAG
CCTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTGAAAAACTGAAAATC
CCCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTT
TAGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGC
CATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGA
CTGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAG
AGGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTT
GGCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTT
GGTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCC
TGGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCT
TGCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTATTTTTTTTATTTTT
TTATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCTCTGTCTCAAGCGAT
TCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTT
CACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCA
CCGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTAC
ACAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAG

>In-frame_SCYL1_ENST00000279270_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3760nt
CCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCA
TCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCG
TCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCC
TGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAG
TGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCC
TCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCC
AGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGG
TCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTAC
GCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCT
TCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGC
CAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGC
TGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATC
AGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCA
TCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGC
AGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTG
CGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGA
TCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGC
AGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAGG
GCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCACGTGGGGAGGGCTGCC
TCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGGC
TCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCAGCTGCCACCCTCACC
TAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGAT
TGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCTC
CACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCCACCACTCTGAGGAGG
GTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATCAGGAATGGAGGGAGC
CAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCATGCCTTTCTGATAGC
CTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTGAAAAACTGAAAATCC
CCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTTT
AGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGCC
ATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGAC
TGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAGA
GGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTTG
GCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTTG
GTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCCT
GGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCTT
GCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTATTTTTTTTATTTTTT
TATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCTCTGTCTCAAGCGATT
CTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTTC
ACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCAC
CGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTACA
CAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAGT

>In-frame_SCYL1_ENST00000524944_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3752nt
AAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAG
CCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGAT
GTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTAC
ATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCT
GGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCAC
AACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAAC
GGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAG
AAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCT
GGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAG
AACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAG
AAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACC
GCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAG
ATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTAC
CTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTC
AAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGC
TCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCAT
CTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCC
TTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAGGGCGACTGG
GGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCACGTGGGGAGGGCTGCCTCAGCAGG
TTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGGCTCCTCTGC
AGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCAGCTGCCACCCTCACCTAGAAACA
TGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGATTGAGGTTT
GGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCTCCACCCCCC
GGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCCACCACTCTGAGGAGGGTAGGAGG
GGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATCAGGAATGGAGGGAGCCAGGCAGG
GCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCATGCCTTTCTGATAGCCTTTGGTG
ATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTGAAAAACTGAAAATCCCCTGGTGG
GCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTTTAGTTTGGT
CTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGCCATGGATTC
CTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGACTGATATGG
GTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAGAGGAGGGCT
TTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTTGGCTTTGTC
TTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTTGGTAGCTTG
TGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCCTGGGAAGGG
CCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCTTGCGGAGCT
GCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTATTTTTTTTATTTTTTTATTTTTT
TTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCTCTGTCTCAAGCGATTCTCCTGCC
TCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTTCACCATGTT
GGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCACCGCCCCCA
GCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTACACAGATGAT
GTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAGTATTTTACT

>In-frame_SCYL1_ENST00000527009_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3769nt
GGCGGAGGGACCGAGGGACCGACAGGCGGACAGGGCCGGGGTCACGTGGGCCCGGCGAAGTGTCCCTAAGGCTGACCTGGGGAGAGACCT
GGCTGCGGGCCCTTGTCTTCCGGCCACACAACAGCTCTGGGACCATCTCAGGCCCCGCTGCCCTCCCCTAGGCCACAGGCAGCCCCGTGT
CCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACC
CCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCA
AGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACG
ACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGT
ATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTG
GCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAG
CAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACC
CAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGA
TCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGC
TGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTG
AGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGG
AGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCA
TCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCC
AGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGT
CCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCT
TCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCACCCGGC
AGGAGGAGGGCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCACGTGGGG
AGGGCTGCCTCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAGGGCCTC
CTGTAGGGCTCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCAGCTGCC
ACCCTCACCTAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGGTAGAGG
ACCAAGGATTGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTCCTCCTG
CTAGTGCTCCACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCCACCACT
CTGAGGAGGGTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATCAGGAAT
GGAGGGAGCCAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCATGCCTT
TCTGATAGCCTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTGAAAAAC
TGAAAATCCCCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCTGGGTCT
TCAGGTTTTAGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCCTTCCCA
GGTGGCGCCATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGACACTTGG
AAAGGTGACTGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGCTGAGAG
CCCCTGAGAGGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTGGCTGCA
CAGGGCTTGGCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTCACCCTC
CTCCCTTTGGTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGCGGAAAG
AAGAGGCCTGGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTGGAGTTG
CTCGGTCTTGCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTATTTTTT
TTATTTTTTTATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCTCTGTCT
CAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAGTAGAGA
TAGGGTTTCACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATTATAGGC
GTGAGCCACCGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGTGTGTGT
CTGAGTACACAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCTTTGGGA

>In-frame_SCYL1_ENST00000525364_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3796nt
CTCTCCGCCCCGCCCCGGCTCGGGCGGCCGGAGGACCCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTG
CCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCC
GCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCT
TCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGG
CTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCG
TGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGT
GGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATG
ACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAG
TCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGG
GAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAA
CCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCC
CTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCT
TCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCA
TGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTAC
ATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGA
GCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCA
AGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAG
TGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGG
AGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAGGGCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGC
AACAGTCTCATGGGTCACCACGTGGGGAGGGCTGCCTCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCC
GGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGGCTCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCA
GGACCATCCGATCAAGCTGCAGCTGCCACCCTCACCTAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGT
GCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGATTGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTT
GGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCTCCACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCAT
CCCCCAATACCAGGCTGGGCCACCACTCTGAGGAGGGTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCA
CCACACCTCCCTGGTTGAATCAGGAATGGAGGGAGCCAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGG
CACGAGATACCAGAAAGAGCATGCCTTTCTGATAGCCTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCA
GACCCACACTCACAGTCTGTGAAAAACTGAAAATCCCCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACC
TGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTTTAGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTG
GGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGCCATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGAC
ACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGACTGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGC
TCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAGAGGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGG
TGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTTGGCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTAC
TCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTTGGTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATG
GACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCCTGGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGC
CAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCTTGCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTG
CTTTGATTCCAGGTGATTTTATTTTTTTTATTTTTTTATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCG
CATCTCGGCTCACTGCAACCTCTGTCTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCC
CGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTTCACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCA
ACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCACCGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGT
TCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTACACAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCC
TTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAGTATTTTACTCATTCTTTGAATGTTCTCATTCTTTTGTATCATGTGACTTATTAAA

>In-frame_SCYL1_ENST00000270176_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3796nt
CTCTCCGCCCCGCCCCGGCTCGGGCGGCCGGAGGACCCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTG
CCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCC
GCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCT
TCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGG
CTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCG
TGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGT
GGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATG
ACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAG
TCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGG
GAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAA
CCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCC
CTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCT
TCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCA
TGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTAC
ATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGA
GCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCA
AGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAG
TGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGG
AGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAGGGCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGC
AACAGTCTCATGGGTCACCACGTGGGGAGGGCTGCCTCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCC
GGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGGCTCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCA
GGACCATCCGATCAAGCTGCAGCTGCCACCCTCACCTAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGT
GCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGATTGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTT
GGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCTCCACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCAT
CCCCCAATACCAGGCTGGGCCACCACTCTGAGGAGGGTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCA
CCACACCTCCCTGGTTGAATCAGGAATGGAGGGAGCCAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGG
CACGAGATACCAGAAAGAGCATGCCTTTCTGATAGCCTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCA
GACCCACACTCACAGTCTGTGAAAAACTGAAAATCCCCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACC
TGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTTTAGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTG
GGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGCCATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGAC
ACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGACTGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGC
TCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAGAGGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGG
TGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTTGGCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTAC
TCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTTGGTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATG
GACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCCTGGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGC
CAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCTTGCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTG
CTTTGATTCCAGGTGATTTTATTTTTTTTATTTTTTTATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCG
CATCTCGGCTCACTGCAACCTCTGTCTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCC
CGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTTCACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCA
ACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCACCGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGT
TCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTACACAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCC
TTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAGTATTTTACTCATTCTTTGAATGTTCTCATTCTTTTGTATCATGTGACTTATTAAA

>In-frame_SCYL1_ENST00000420247_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3788nt
CCCGCCCCGGCTCGGGCGGCCGGAGGACCCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTGCCCGGGAC
CCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCCGCAAGAAG
GCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGC
TTCAAAACTCTACGGCACCCCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACC
CCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCC
CTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTT
GGGGGCCTGGACTACATGTATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCG
GAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAAT
GGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAAC
CCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTC
TTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCCCTGAGGAT
TTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCTTCAAGGTG
GGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCATGCGCATC
CGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTACATGGCTTC
CTGGACACCAACCCTGCCATCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCG
GCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGG
AGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCG
AAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGC
TGAGGACGCTGCACCCGGCAGGAGGAGGGCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCT
CATGGGTCACCACGTGGGGAGGGCTGCCTCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTG
CAAAGCTGGCCAGGGCCTCCTGTAGGGCTCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATC
CGATCAAGCTGCAGCTGCCACCCTCACCTAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTG
GCAGCTCCAGTGGTAGAGGACCAAGGATTGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACC
AGTCTCCGTCTTCCTCCTGCTAGTGCTCCACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAAT
ACCAGGCTGGGCCACCACTCTGAGGAGGGTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCT
CCCTGGTTGAATCAGGAATGGAGGGAGCCAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGAT
ACCAGAAAGAGCATGCCTTTCTGATAGCCTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACA
CTCACAGTCTGTGAAAAACTGAAAATCCCCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCC
CCTCCCTGTGTCTGGGTCTTCAGGTTTTAGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTC
TGCTGTGCGCTCCTTCCCAGGTGGCGCCATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTT
CTTTATCGAGGACACTTGGAAAGGTGACTGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTT
GTCCCAGATGAGCTGAGAGCCCCTGAGAGGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCT
GGGACTTCCTGTGGCTGCACAGGGCTTGGCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTA
TCAGAGCCTGTTCACCCTCCTCCCTTTGGTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGT
TAAAATAATAGGCGGAAAGAAGAGGCCTGGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTC
GTCTCCCGTCCTGGAGTTGCTCGGTCTTGCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATT
CCAGGTGATTTTATTTTTTTTATTTTTTTATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGG
CTCACTGCAACCTCTGTCTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATT
TTTGTATTTTTAGTAGAGATAGGGTTTCACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCA
AAGTGCTGGGATTATAGGCGTGAGCCACCGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGA
TGGGTTGGAGTGTGTGTGTCTGAGTACACAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATT
TTCTGCTTGTCCTTTGGGACAAAGCAGTATTTTACTCATTCTTTGAATGTTCTCATTCTTTTGTATCATGTGACTTATTAAAATCAGTTT

>In-frame_SCYL1_ENST00000533862_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3761nt
CCCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTC
ATCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTC
GTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATC
CTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGA
GTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGC
CTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCC
CAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTG
GTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTA
CGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGC
TTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAG
CCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAG
CTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTAT
CAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTC
ATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAG
CAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGT
GCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGG
ATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGG
CAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAG
GGCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCACGTGGGGAGGGCTGC
CTCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGG
CTCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCAGCTGCCACCCTCAC
CTAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGA
TTGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCT
CCACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCCACCACTCTGAGGAG
GGTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATCAGGAATGGAGGGAG
CCAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCATGCCTTTCTGATAG
CCTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTGAAAAACTGAAAATC
CCCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTT
TAGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGC
CATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGA
CTGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAG
AGGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTT
GGCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTT
GGTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCC
TGGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCT
TGCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTATTTTTTTTATTTTT
TTATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCTCTGTCTCAAGCGAT
TCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTT
CACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCA
CCGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTAC
ACAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAG

>In-frame_SCYL1_ENST00000279270_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3760nt
CCGGAGCTAAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCA
TCCCGGAGCCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCG
TCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCC
TGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAG
TGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCC
TCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCC
AGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGG
TCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTAC
GCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCT
TCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGC
CAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGC
TGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATC
AGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCA
TCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGC
AGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTG
CGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGA
TCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGC
AGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAGG
GCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCACGTGGGGAGGGCTGCC
TCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGGC
TCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCAGCTGCCACCCTCACC
TAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGAT
TGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCTC
CACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCCACCACTCTGAGGAGG
GTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATCAGGAATGGAGGGAGC
CAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCATGCCTTTCTGATAGC
CTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTGAAAAACTGAAAATCC
CCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTTT
AGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGCC
ATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGAC
TGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAGA
GGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTTG
GCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTTG
GTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCCT
GGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCTT
GCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTATTTTTTTTATTTTTT
TATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCTCTGTCTCAAGCGATT
CTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTTC
ACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCAC
CGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTACA
CAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAGT

>In-frame_SCYL1_ENST00000524944_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3752nt
AAGGCGCCCGAACCCGCGGCGGCGGTGGGGACGATGTGGTTCTTTGCCCGGGACCCGGTCCGGGACTTTCCGTTCGAGCTCATCCCGGAG
CCCCCAGAGGGCGGCCTGCCCGGGCCCTGGGCCCTGCACCGCGGCCGCAAGAAGGCCACAGGCAGCCCCGTGTCCATCTTCGTCTATGAT
GTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACCCCAACATCCTGGCTTAC
ATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCAAGGCGAGAGTGGAGGCT
GGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACGACTGCAGCCTCATCCAC
AACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGTATTCGGCCCAGGGCAAC
GGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTGGCAGAGTGGTCAGAGAG
AAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAGCAGCCCTACGCAACCCT
GGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACCCAGCCCGCTTCCTGCAG
AACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGATCAAAGAGCCAGCCGAG
AAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGCTGCCCCAGCTGCTGACC
GCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTGAGGAGTATCAGCAGAAG
ATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGGAGCAGTTCATCCAGTAC
CTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCATCCGGGAGCAGACGGTC
AAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCCAGGACAGTGCGACTGGC
TCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGTCCAGCCGGATCCAGCAT
CTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCTTCAGCCGGCAGCTGTCC
TTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCACCCGGCAGGAGGAGGGCGACTGG
GGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCACGTGGGGAGGGCTGCCTCAGCAGG
TTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAGGGCCTCCTGTAGGGCTCCTCTGC
AGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCAGCTGCCACCCTCACCTAGAAACA
TGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGGTAGAGGACCAAGGATTGAGGTTT
GGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTCCTCCTGCTAGTGCTCCACCCCCC
GGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCCACCACTCTGAGGAGGGTAGGAGG
GGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATCAGGAATGGAGGGAGCCAGGCAGG
GCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCATGCCTTTCTGATAGCCTTTGGTG
ATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTGAAAAACTGAAAATCCCCTGGTGG
GCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCTGGGTCTTCAGGTTTTAGTTTGGT
CTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCCTTCCCAGGTGGCGCCATGGATTC
CTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGACACTTGGAAAGGTGACTGATATGG
GTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGCTGAGAGCCCCTGAGAGGAGGGCT
TTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTGGCTGCACAGGGCTTGGCTTTGTC
TTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTCACCCTCCTCCCTTTGGTAGCTTG
TGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGCGGAAAGAAGAGGCCTGGGAAGGG
CCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTGGAGTTGCTCGGTCTTGCGGAGCT
GCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTATTTTTTTTATTTTTTTATTTTTT
TTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCTCTGTCTCAAGCGATTCTCCTGCC
TCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAGTAGAGATAGGGTTTCACCATGTT
GGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATTATAGGCGTGAGCCACCGCCCCCA
GCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGTGTGTGTCTGAGTACACAGATGAT
GTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCTTTGGGACAAAGCAGTATTTTACT

>In-frame_SCYL1_ENST00000527009_chr11_65300276_+_FRMD8_ENST00000317568_chr11_65172335_+_3769nt
GGCGGAGGGACCGAGGGACCGACAGGCGGACAGGGCCGGGGTCACGTGGGCCCGGCGAAGTGTCCCTAAGGCTGACCTGGGGAGAGACCT
GGCTGCGGGCCCTTGTCTTCCGGCCACACAACAGCTCTGGGACCATCTCAGGCCCCGCTGCCCTCCCCTAGGCCACAGGCAGCCCCGTGT
CCATCTTCGTCTATGATGTGAAGCCTGGCGCGGAAGAGCAGACCCAGGTGGCCAAAGCTGCCTTCAAGCGCTTCAAAACTCTACGGCACC
CCAACATCCTGGCTTACATCGATGGACTGGAGACAGAAAAATGCCTCCACGTCGTGACAGAGGCTGTGACCCCGTTGGGAATATACCTCA
AGGCGAGAGTGGAGGCTGGTGGCCTGAAGGAGCTGGAGATCTCCTGGGGGCTACACCAGATCGTGAAAGCCCTCAGCTTCCTGGTCAACG
ACTGCAGCCTCATCCACAACAATGTCTGCATGGCCGCCGTGTTCGTGGACCGAGCTGGCGAGTGGAAGCTTGGGGGCCTGGACTACATGT
ATTCGGCCCAGGGCAACGGTGGGGGACCTCCCCGCAAGGGGATCCCCGAGCTTGAGCAGTATGACCCCCCGGAGTTGGCTGACAGCAGTG
GCAGAGTGGTCAGAGAGAAGTGGTCAGCAGACATGTGGCGCTTGGGCTGCCTCATTTGGGAAGTCTTCAATGGGCCCCTACCTCGGGCAG
CAGCCCTACGCAACCCTGGGAAGATCCCCAAAACGCTGGTGCCCCATTACTGTGAGCTGGTGGGAGCAAACCCCAAGGTGCGTCCCAACC
CAGCCCGCTTCCTGCAGAACTGCCGGGCACCTGGTGGCTTCATGAGCAACCGCTTTGTAGAAACCAACCTCTTCCTGGAGGAGATTCAGA
TCAAAGAGCCAGCCGAGAAGCAAAAATTCTTCCAGGAGCTGAGCAAGAGCCTGGACGCATTCCCTGAGGATTTCTGTCGGCACAAGGTGC
TGCCCCAGCTGCTGACCGCCTTCGAGTTCGGCAATGCTGGGGCCGTTGTCCTCACGCCCCTCTTCAAGGTGGGCAAGTTCCTGAGCGCTG
AGGAGTATCAGCAGAAGATCATCCCTGTGGTGGTCAAGATGTTCTCATCCACTGACCGGGCCATGCGCATCCGCCTCCTGCAGCAGATGG
AGCAGTTCATCCAGTACCTTGACGAGCCAACAGTCAACACCCAGATCTTCCCCCACGTCGTACATGGCTTCCTGGACACCAACCCTGCCA
TCCGGGAGCAGACGGTCAAGGCCGAACTGATGAGCAGTCTCATTGAGTACTGCATCGAACTGAGCCAGGCGGCGGAGCCCGCAGGCCCCC
AGGACAGTGCGACTGGCTCGCCCTCGGACCCCAGCTCCTCACTGGCTCCTGTTCAGCGCCCCAAGCTGCGGAGGCAGGGCAGTGTGGTGT
CCAGCCGGATCCAGCATCTCTCCACCATCGACTACGTGGAGGACGGCAAGGGGATCAGGCGAGTGAAGCCGAAGCGCACCACATCCTTCT
TCAGCCGGCAGCTGTCCTTGGGCCAGGGGAGCTACACCGTGGTGCAGCCCGGCGACAGCCTGGAGCAGGGCTGAGGACGCTGCACCCGGC
AGGAGGAGGGCGACTGGGGGCCCTGGCCCGGCACTGTCCTCCTGAGGGGCAGGCGCCGGCTGCAACAGTCTCATGGGTCACCACGTGGGG
AGGGCTGCCTCAGCAGGTTTCTCAGACCACGGAGAAGTGACTTTTGGGCCCGGGGCCATGCCCGGGCTGTGCAAAGCTGGCCAGGGCCTC
CTGTAGGGCTCCTCTGCAGCCTGCCCTCCCTTCCCCCGGATGCTGGGCCCTGCTGCTCTCTCAGGACCATCCGATCAAGCTGCAGCTGCC
ACCCTCACCTAGAAACATGCCTTTGTGCCCACCTCAAGATGGGCAGTGTCCCTGTTCTGAAGTGCCCAGTGGCAGCTCCAGTGGTAGAGG
ACCAAGGATTGAGGTTTGGGACCTGAAGCTCCAGTGTGTGCCTTTGGCCTCTTCCCTGGACTTGGGTGACCAGTCTCCGTCTTCCTCCTG
CTAGTGCTCCACCCCCCGGACTTGGATGACCAGTTTCCCACCTTCCTCCTGCTGGTGCTCCATCCCCCAATACCAGGCTGGGCCACCACT
CTGAGGAGGGTAGGAGGGGCCTCCCTGGATTGAACCGGGACAGAAACACGGTGAGGGCCCCCACCACACCTCCCTGGTTGAATCAGGAAT
GGAGGGAGCCAGGCAGGGCCCTACCTGGGGTCCTGTGCCCCTCGTTCTGGTCTCCTTTGCAGGCACGAGATACCAGAAAGAGCATGCCTT
TCTGATAGCCTTTGGTGATGTCACTGCTGGGAGGTGGCTATCCTGTGGACCACCTGGCCTCCAGACCCACACTCACAGTCTGTGAAAAAC
TGAAAATCCCCTGGTGGGCACTCCCTGGAGCCCAAGCAGCTCCCCTAGGGGACTGACCGGACCTGACCTCCCCTCCCTGTGTCTGGGTCT
TCAGGTTTTAGTTTGGTCTTTGTTCATCTGAGTTGTGCTGGGGCAACGCCAGGAAGTGCCCTGGGTACCTCTGCTGTGCGCTCCTTCCCA
GGTGGCGCCATGGATTCCTCTGGGGGCTGGCGCATGCCCAGGAAAGCCTGGGCCACACGGGACACTCTCTTCTTTATCGAGGACACTTGG
AAAGGTGACTGATATGGGTGCTTGGCTTCTCTGGTCCCAGCTTGCCCTCCGGGGAGCAGGGGCTCTGTCTTGTCCCAGATGAGCTGAGAG
CCCCTGAGAGGAGGGCTTTCCCAGCCCTGGGACCCTCCGAGGTGGGTGTGCGGGTCTCACAGGTGCTTCCTGGGACTTCCTGTGGCTGCA
CAGGGCTTGGCTTTGTCTTCGTTCCCGGTGGAAAACCGTGGGAGAGGAAGCTTGGGCCTCTACTCCAAGTATCAGAGCCTGTTCACCCTC
CTCCCTTTGGTAGCTTGTGAATGTGCCAGGTGTTTCGAGGTAGGCTTGCCTTCTGGCAGCATGGACTTTGTTAAAATAATAGGCGGAAAG
AAGAGGCCTGGGAAGGGCCCCCAGTCTTTTGGAATGTCCTGGTCACAGGGTCATGTCAGCTGCCAGTTCTCGTCTCCCGTCCTGGAGTTG
CTCGGTCTTGCGGAGCTGCCCGCCTGCCTGTTCTGGCGGCTCCAGCGCAGGCTGTCCCTGCTGCTTTGATTCCAGGTGATTTTATTTTTT
TTATTTTTTTATTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCAGGAGTGCAGTGGCGCATCTCGGCTCACTGCAACCTCTGTCT
CAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCATGCCACCAGGCCCCGCTGATTTTTGTATTTTTAGTAGAGA
TAGGGTTTCACCATGTTGGTCAGGCTGGTCGTGAACTCCTGACCTCATGATCTGCCCGCCTCAACCTCCCAAAGTGCTGGGATTATAGGC
GTGAGCCACCGCCCCCAGCTGATTCCAGGCGAATTCTTCTCTGATGGGCGGGCGAGGGTGTGTTCGTGTGATGGGTTGGAGTGTGTGTGT
CTGAGTACACAGATGATGTGTTTTCCCTTCAGCTTCTTACGTTTTCTGAGCATCCATTGTGCCTTAACATTTTCTGCTTGTCCTTTGGGA


Top

FusionGenePPI for SCYL1_FRMD8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SCYL1MYC, COIL, APP, SPTY2D1, CWC27, CD93, CDC25A, CHD1L, GORAB, CRTC3, SEC31A, AURKA, REST, ACTR1B, POLA2, NTRK1, TMEM17, XPO1, CTDSPL2, CCNF, SMURF1, CDH1, EGFR, KLHL2, AVIL, AGPAT3, DUSP23, UBR3, NEK7, P4HA2, TESFRMD8IKBKG, ELAVL1, APP, GRAMD3, PLEKHF2, FRMD8P1, RPS14


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSCYL1chr11:65294588chr11:65172335ENST00000270176+618793_808283809COPB1
HgeneSCYL1chr11:65294588chr11:65172335ENST00000279270+617793_808283782COPB1
HgeneSCYL1chr11:65294588chr11:65172335ENST00000420247+618793_808283792COPB1
HgeneSCYL1chr11:65294588chr11:65172335ENST00000533862+618793_808283788COPB1
HgeneSCYL1chr11:65300276chr11:65172335ENST00000270176+918793_808410809COPB1
HgeneSCYL1chr11:65300276chr11:65172335ENST00000279270+917793_808410782COPB1
HgeneSCYL1chr11:65300276chr11:65172335ENST00000420247+918793_808410792COPB1
HgeneSCYL1chr11:65300276chr11:65172335ENST00000533862+918793_808410788COPB1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SCYL1_FRMD8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SCYL1_FRMD8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource