FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32900

FusionGeneSummary for SCUBE2_LDHC

check button Fusion gene summary
Fusion gene informationFusion gene name: SCUBE2_LDHC
Fusion gene ID: 32900
HgeneTgene
Gene symbol

SCUBE2

LDHC

Gene ID

57758

3948

Gene namesignal peptide, CUB domain and EGF like domain containing 2lactate dehydrogenase C
SynonymsCEGB1|CEGF1|CEGP1CT32|LDH3|LDHX
Cytomap

11p15.4

11p15.1

Type of geneprotein-codingprotein-coding
Descriptionsignal peptide, CUB and EGF-like domain-containing protein 2scube/Yousignal peptide, CUB domain, EGF-like 2L-lactate dehydrogenase C chainLDH testis subunitLDH-CLDH-Xcancer/testis antigen 32lactate dehydrogenase C4lactate dehydrogenase c variant 1lactate dehydrogenase c variant 3lactate dehydrogenase c variant 4lactate dehydrogenase c variant 5testis
Modification date2018052320180519
UniProtAcc

Q9NQ36

P07864

Ensembl transtripts involved in fusion geneENST00000457346, ENST00000309263, 
ENST00000450649, ENST00000520467, 
ENST00000534295, 
ENST00000541669, 
ENST00000280704, ENST00000544105, 
ENST00000536880, ENST00000535809, 
ENST00000537486, ENST00000546146, 
Fusion gene scores* DoF score3 X 2 X 3=182 X 2 X 2=8
# samples 32
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/8*10)=1.32192809488736
Context

PubMed: SCUBE2 [Title/Abstract] AND LDHC [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-FD-A5BV-01ASCUBE2chr11

9090917

-LDHCchr11

18451284

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000457346ENST00000541669SCUBE2chr11

9090917

-LDHCchr11

18451284

+
In-frameENST00000457346ENST00000280704SCUBE2chr11

9090917

-LDHCchr11

18451284

+
In-frameENST00000457346ENST00000544105SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000457346ENST00000536880SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000457346ENST00000535809SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000457346ENST00000537486SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000457346ENST00000546146SCUBE2chr11

9090917

-LDHCchr11

18451284

+
In-frameENST00000309263ENST00000541669SCUBE2chr11

9090917

-LDHCchr11

18451284

+
In-frameENST00000309263ENST00000280704SCUBE2chr11

9090917

-LDHCchr11

18451284

+
In-frameENST00000309263ENST00000544105SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000309263ENST00000536880SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000309263ENST00000535809SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000309263ENST00000537486SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000309263ENST00000546146SCUBE2chr11

9090917

-LDHCchr11

18451284

+
In-frameENST00000450649ENST00000541669SCUBE2chr11

9090917

-LDHCchr11

18451284

+
In-frameENST00000450649ENST00000280704SCUBE2chr11

9090917

-LDHCchr11

18451284

+
In-frameENST00000450649ENST00000544105SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000450649ENST00000536880SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000450649ENST00000535809SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000450649ENST00000537486SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000450649ENST00000546146SCUBE2chr11

9090917

-LDHCchr11

18451284

+
In-frameENST00000520467ENST00000541669SCUBE2chr11

9090917

-LDHCchr11

18451284

+
In-frameENST00000520467ENST00000280704SCUBE2chr11

9090917

-LDHCchr11

18451284

+
In-frameENST00000520467ENST00000544105SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000520467ENST00000536880SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000520467ENST00000535809SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000520467ENST00000537486SCUBE2chr11

9090917

-LDHCchr11

18451284

+
5CDS-intronENST00000520467ENST00000546146SCUBE2chr11

9090917

-LDHCchr11

18451284

+
intron-3CDSENST00000534295ENST00000541669SCUBE2chr11

9090917

-LDHCchr11

18451284

+
intron-3CDSENST00000534295ENST00000280704SCUBE2chr11

9090917

-LDHCchr11

18451284

+
intron-3CDSENST00000534295ENST00000544105SCUBE2chr11

9090917

-LDHCchr11

18451284

+
intron-intronENST00000534295ENST00000536880SCUBE2chr11

9090917

-LDHCchr11

18451284

+
intron-intronENST00000534295ENST00000535809SCUBE2chr11

9090917

-LDHCchr11

18451284

+
intron-intronENST00000534295ENST00000537486SCUBE2chr11

9090917

-LDHCchr11

18451284

+
intron-intronENST00000534295ENST00000546146SCUBE2chr11

9090917

-LDHCchr11

18451284

+

Top

FusionProtFeatures for SCUBE2_LDHC


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SCUBE2

Q9NQ36

LDHC

P07864

Lipid-binding protein required for SHH long-rangesignaling by binding to the dually lipid-modified SHH (ShhNp) andby promoting ShhNp mobilization, solubilization and release fromthe cell membrane (PubMed:22902404, PubMed:22677548). Acts byenhancing the proteolytic processing (shedding) of the lipid-modified N- and C- terminal of ShhNp at the cell surface(PubMed:24522195). Synergizes with DISP1 to increase SHH secretion(PubMed:22902404). Probable cell surface coreceptor for VEGFR2involved in VEGFR2-mediated angiogenesis (PubMed:27834687).{ECO:0000269|PubMed:22677548, ECO:0000269|PubMed:22902404,ECO:0000269|PubMed:24522195, ECO:0000269|PubMed:27834687,ECO:0000303|PubMed:26875496}. Possible role in sperm motility.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000309263-522128_1682141000DomainEGF-like 3%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000309263-522177_2132141000DomainEGF-like 4
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000309263-52245_852141000DomainEGF-like 1%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000309263-52286_1272141000DomainEGF-like 2%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000450649-518128_168214808DomainEGF-like 3%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000450649-518177_213214808DomainEGF-like 4
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000450649-51845_85214808DomainEGF-like 1%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000450649-51886_127214808DomainEGF-like 2%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000520467-522128_168214972DomainEGF-like 3%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000520467-522177_213214972DomainEGF-like 4
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000520467-52245_85214972DomainEGF-like 1%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000520467-52286_127214972DomainEGF-like 2%3B calcium-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000309263-522217_2522141000DomainEGF-like 5
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000309263-522286_3212141000DomainEGF-like 6
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000309263-522323_3632141000DomainEGF-like 7%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000309263-522364_4022141000DomainEGF-like 8%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000309263-522403_4432141000DomainEGF-like 9%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000309263-522809_9212141000DomainCUB
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000450649-518217_252214808DomainEGF-like 5
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000450649-518286_321214808DomainEGF-like 6
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000450649-518323_363214808DomainEGF-like 7%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000450649-518364_402214808DomainEGF-like 8%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000450649-518403_443214808DomainEGF-like 9%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000450649-518809_921214808DomainCUB
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000520467-522217_252214972DomainEGF-like 5
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000520467-522286_321214972DomainEGF-like 6
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000520467-522323_363214972DomainEGF-like 7%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000520467-522364_402214972DomainEGF-like 8%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000520467-522403_443214972DomainEGF-like 9%3B calcium-binding
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000520467-522809_921214972DomainCUB
TgeneLDHCchr11:9090917chr11:18451284ENST00000280704+2829_5781333Nucleotide bindingNAD
TgeneLDHCchr11:9090917chr11:18451284ENST00000541669+2829_5781333Nucleotide bindingNAD


Top

FusionGeneSequence for SCUBE2_LDHC


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SCUBE2_ENST00000457346_chr11_9090917_-_LDHC_ENST00000541669_chr11_18451284_+_466aa
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDEC
GNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCIYYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVS
NPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHW
KNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFK

>In-frame_SCUBE2_ENST00000457346_chr11_9090917_-_LDHC_ENST00000280704_chr11_18451284_+_466aa
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDEC
GNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCIYYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVS
NPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHW
KNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFK

>In-frame_SCUBE2_ENST00000457346_chr11_9090917_-_LDHC_ENST00000544105_chr11_18451284_+_375aa
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDEC
GNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCIYYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVS
NPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHW

>In-frame_SCUBE2_ENST00000309263_chr11_9090917_-_LDHC_ENST00000541669_chr11_18451284_+_466aa
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDEC
GNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCIYYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVS
NPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHW
KNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFK

>In-frame_SCUBE2_ENST00000309263_chr11_9090917_-_LDHC_ENST00000280704_chr11_18451284_+_466aa
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDEC
GNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCIYYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVS
NPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHW
KNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFK

>In-frame_SCUBE2_ENST00000309263_chr11_9090917_-_LDHC_ENST00000544105_chr11_18451284_+_375aa
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDEC
GNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCIYYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVS
NPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHW

>In-frame_SCUBE2_ENST00000450649_chr11_9090917_-_LDHC_ENST00000541669_chr11_18451284_+_466aa
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDEC
GNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCIYYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVS
NPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHW
KNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFK

>In-frame_SCUBE2_ENST00000450649_chr11_9090917_-_LDHC_ENST00000280704_chr11_18451284_+_466aa
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDEC
GNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCIYYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVS
NPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHW
KNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFK

>In-frame_SCUBE2_ENST00000450649_chr11_9090917_-_LDHC_ENST00000544105_chr11_18451284_+_375aa
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDEC
GNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCIYYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVS
NPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHW

>In-frame_SCUBE2_ENST00000520467_chr11_9090917_-_LDHC_ENST00000541669_chr11_18451284_+_466aa
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDEC
GNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCIYYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVS
NPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHW
KNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFK

>In-frame_SCUBE2_ENST00000520467_chr11_9090917_-_LDHC_ENST00000280704_chr11_18451284_+_466aa
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDEC
GNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCIYYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVS
NPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHW
KNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFK

>In-frame_SCUBE2_ENST00000520467_chr11_9090917_-_LDHC_ENST00000544105_chr11_18451284_+_375aa
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDEC
GNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCIYYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVS
NPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SCUBE2_ENST00000457346_chr11_9090917_-_LDHC_ENST00000541669_chr11_18451284_+_1398nt
ATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGG
GCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCC
CTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGT
GGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCT
CATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTAT
GAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAG
GATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAG
AGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTT
GCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCA
AATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCT
GCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGT
GTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGG
AAAAATATCCATAAACAAGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATG
GATTTGGTAGGATCCATTTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTC
TTTCTCAGTATCCCTTGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAG

>In-frame_SCUBE2_ENST00000457346_chr11_9090917_-_LDHC_ENST00000280704_chr11_18451284_+_1398nt
ATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGG
GCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCC
CTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGT
GGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCT
CATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTAT
GAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAG
GATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAG
AGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTT
GCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCA
AATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCT
GCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGT
GTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGG
AAAAATATCCATAAACAAGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATG
GATTTGGTAGGATCCATTTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTC
TTTCTCAGTATCCCTTGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAG

>In-frame_SCUBE2_ENST00000457346_chr11_9090917_-_LDHC_ENST00000544105_chr11_18451284_+_1125nt
ATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGG
GCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCC
CTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGT
GGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCT
CATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTAT
GAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAG
GATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAG
AGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTT
GCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCA
AATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCT
GCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGT
GTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGG

>In-frame_SCUBE2_ENST00000309263_chr11_9090917_-_LDHC_ENST00000541669_chr11_18451284_+_1398nt
ATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGG
GCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCC
CTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGT
GGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCT
CATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTAT
GAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAG
GATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAG
AGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTT
GCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCA
AATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCT
GCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGT
GTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGG
AAAAATATCCATAAACAAGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATG
GATTTGGTAGGATCCATTTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTC
TTTCTCAGTATCCCTTGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAG

>In-frame_SCUBE2_ENST00000309263_chr11_9090917_-_LDHC_ENST00000280704_chr11_18451284_+_1398nt
ATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGG
GCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCC
CTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGT
GGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCT
CATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTAT
GAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAG
GATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAG
AGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTT
GCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCA
AATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCT
GCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGT
GTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGG
AAAAATATCCATAAACAAGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATG
GATTTGGTAGGATCCATTTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTC
TTTCTCAGTATCCCTTGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAG

>In-frame_SCUBE2_ENST00000309263_chr11_9090917_-_LDHC_ENST00000544105_chr11_18451284_+_1125nt
ATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGG
GCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCC
CTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGT
GGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCT
CATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTAT
GAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAG
GATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAG
AGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTT
GCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCA
AATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCT
GCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGT
GTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGG

>In-frame_SCUBE2_ENST00000450649_chr11_9090917_-_LDHC_ENST00000541669_chr11_18451284_+_1398nt
ATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGG
GCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCC
CTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGT
GGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCT
CATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTAT
GAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAG
GATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAG
AGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTT
GCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCA
AATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCT
GCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGT
GTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGG
AAAAATATCCATAAACAAGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATG
GATTTGGTAGGATCCATTTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTC
TTTCTCAGTATCCCTTGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAG

>In-frame_SCUBE2_ENST00000450649_chr11_9090917_-_LDHC_ENST00000280704_chr11_18451284_+_1398nt
ATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGG
GCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCC
CTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGT
GGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCT
CATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTAT
GAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAG
GATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAG
AGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTT
GCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCA
AATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCT
GCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGT
GTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGG
AAAAATATCCATAAACAAGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATG
GATTTGGTAGGATCCATTTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTC
TTTCTCAGTATCCCTTGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAG

>In-frame_SCUBE2_ENST00000450649_chr11_9090917_-_LDHC_ENST00000544105_chr11_18451284_+_1125nt
ATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGG
GCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCC
CTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGT
GGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCT
CATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTAT
GAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAG
GATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAG
AGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTT
GCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCA
AATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCT
GCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGT
GTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGG

>In-frame_SCUBE2_ENST00000520467_chr11_9090917_-_LDHC_ENST00000541669_chr11_18451284_+_1398nt
ATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGG
GCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCC
CTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGT
GGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCT
CATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTAT
GAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAG
GATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAG
AGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTT
GCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCA
AATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCT
GCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGT
GTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGG
AAAAATATCCATAAACAAGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATG
GATTTGGTAGGATCCATTTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTC
TTTCTCAGTATCCCTTGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAG

>In-frame_SCUBE2_ENST00000520467_chr11_9090917_-_LDHC_ENST00000280704_chr11_18451284_+_1398nt
ATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGG
GCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCC
CTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGT
GGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCT
CATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTAT
GAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAG
GATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAG
AGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTT
GCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCA
AATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCT
GCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGT
GTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGG
AAAAATATCCATAAACAAGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATG
GATTTGGTAGGATCCATTTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTC
TTTCTCAGTATCCCTTGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAG

>In-frame_SCUBE2_ENST00000520467_chr11_9090917_-_LDHC_ENST00000544105_chr11_18451284_+_1125nt
ATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGG
GCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCC
CTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGT
GGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCT
CATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTAT
GAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAG
GATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAG
AGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTT
GCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCA
AATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCT
GCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGT
GTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SCUBE2_ENST00000457346_chr11_9090917_-_LDHC_ENST00000541669_chr11_18451284_+_2404nt
CCGCGCACACCTCCCCGCGCCGCCGCCGCCACCGCCCGCACTCCGCCGCCTCTGCCCGCAACCGCTGAGCCATCCATGGGGGTCGCGGGC
CGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGGGCCGTCCCGCCGGGT
CGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCCCTGTGTCAGAACACA
CCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGTGGAAATGAGCTCAAT
GGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCTCATGACGGTCATAAT
TGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTATGAGTGCTGCTGCAAG
GAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAGGATCACGGCTGTAGT
CACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAGAGAGACTGCATCTAT
TACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTTGCCCTGGTCCAACGT
AATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCAAATCCAGTGGATATT
TTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCTGCCCGTTTCCGTTAC
CTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGTGTGCCCTTATGGAGT
GGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGGAAAAATATCCATAAA
CAAGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATGGATTTGGTAGGATCC
ATTTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTCTTTCTCAGTATCCCT
TGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAGAAGAGTGCAGAAACA
CTTTGGAATATTCAAAAGGATCTAATATTTTAAATTAAAGCCTTCTAATGTTCCACTGTTTGGAGAACAGAAGATAGCAGGCTGTGTATT
TTAAATTTTGAAAGTATTTTCATTTGATCTTTAAAAAATAAAAACAAATTGGAGACCTGTGACATAACTCTAGTCTCTCAAGATTAGAAC
GAGCAAATGGTAAAGAGATTTTCCTCTTTAAGAATCATTTATAGCTCTATTCTAATGATACCCAATCTGTACAGGTGTAAGTTATACTTC
TGAGGTATGTCACATATGTTAGAGTGCCTTCAGATGTAGTAGAATATGTATAATCACTATAATACAGAGCTTTGATTCTTTTCACAAACC
AAGCCCTTTTTCTAGTATTACAATTTTATCTTGTACTTTCATCCGTTAGAGTACCAGCATATTCACTTCATTACATTAGCGTCATATGTT
TATGTATAATCATTATAAATGTGGCCGGGCACTGCAGCCTGGGTGAAAGAGTGAGGCTCTGTCTCAAAAAAAATCATTATAAATGCTTAT
TTTTAAGACCATATATATCAAAAAGAAATAAAAAGCTGAGTGCTGTGGCTCATGGCTGTAATCCCAGTGCTTTGGGAGGGTGAGGCAAGA
GGATCACATGAGTCCAGGAGTTTGAGACCAGCCTTGGCAACATAGCAACACCCCATCTCTACAAAAATAAAGAAATTAGATGTGGTGGCC
TGCATCTGTAGTCCAGCTACTTGGGAGACTGAGACCAGTAGATAACTTGAGCCCAGGAGTTCAAGGCTATGATTGTGTCACTGCACTCCA
GCCTGGGCCACAGAGGAAGACTCAGACTCAAAAGAAGAAGAAGAACACAGAAGAAAAGCAGAAACAAGAAGAAGATACAGATGTAACTTT

>In-frame_SCUBE2_ENST00000457346_chr11_9090917_-_LDHC_ENST00000280704_chr11_18451284_+_1589nt
CCGCGCACACCTCCCCGCGCCGCCGCCGCCACCGCCCGCACTCCGCCGCCTCTGCCCGCAACCGCTGAGCCATCCATGGGGGTCGCGGGC
CGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGGGCCGTCCCGCCGGGT
CGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCCCTGTGTCAGAACACA
CCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGTGGAAATGAGCTCAAT
GGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCTCATGACGGTCATAAT
TGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTATGAGTGCTGCTGCAAG
GAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAGGATCACGGCTGTAGT
CACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAGAGAGACTGCATCTAT
TACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTTGCCCTGGTCCAACGT
AATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCAAATCCAGTGGATATT
TTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCTGCCCGTTTCCGTTAC
CTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGTGTGCCCTTATGGAGT
GGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGGAAAAATATCCATAAA
CAAGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATGGATTTGGTAGGATCC
ATTTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTCTTTCTCAGTATCCCT
TGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAGAAGAGTGCAGAAACA
CTTTGGAATATTCAAAAGGATCTAATATTTTAAATTAAAGCCTTCTAATGTTCCACTGTTTGGAGAACAGAAGATAGCAGGCTGTGTATT

>In-frame_SCUBE2_ENST00000457346_chr11_9090917_-_LDHC_ENST00000544105_chr11_18451284_+_1349nt
CCGCGCACACCTCCCCGCGCCGCCGCCGCCACCGCCCGCACTCCGCCGCCTCTGCCCGCAACCGCTGAGCCATCCATGGGGGTCGCGGGC
CGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGGGCCGTCCCGCCGGGT
CGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCCCTGTGTCAGAACACA
CCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGTGGAAATGAGCTCAAT
GGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCTCATGACGGTCATAAT
TGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTATGAGTGCTGCTGCAAG
GAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAGGATCACGGCTGTAGT
CACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAGAGAGACTGCATCTAT
TACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTTGCCCTGGTCCAACGT
AATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCAAATCCAGTGGATATT
TTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCTGCCCGTTTCCGTTAC
CTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGTGTGCCCTTATGGAGT
GGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGGAAAAATATCCATAAA
CAAGTTATTCAAAGGGATTATATGGAATAAAAGAAGAACTCTTTCTCAGTATCCCTTGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTG

>In-frame_SCUBE2_ENST00000309263_chr11_9090917_-_LDHC_ENST00000541669_chr11_18451284_+_2402nt
GCGCACACCTCCCCGCGCCGCCGCCGCCACCGCCCGCACTCCGCCGCCTCTGCCCGCAACCGCTGAGCCATCCATGGGGGTCGCGGGCCG
CAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGGGCCGTCCCGCCGGGTCG
GGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCCCTGTGTCAGAACACACC
CACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGTGGAAATGAGCTCAATGG
AGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCTCATGACGGTCATAATTG
TCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTATGAGTGCTGCTGCAAGGA
GGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAGGATCACGGCTGTAGTCA
CATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAGAGAGACTGCATCTATTA
CAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTTGCCCTGGTCCAACGTAA
TGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCAAATCCAGTGGATATTTT
GACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCTGCCCGTTTCCGTTACCT
AATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGTGTGCCCTTATGGAGTGG
GGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGGAAAAATATCCATAAACA
AGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATGGATTTGGTAGGATCCAT
TTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTCTTTCTCAGTATCCCTTG
TGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAGAAGAGTGCAGAAACACT
TTGGAATATTCAAAAGGATCTAATATTTTAAATTAAAGCCTTCTAATGTTCCACTGTTTGGAGAACAGAAGATAGCAGGCTGTGTATTTT
AAATTTTGAAAGTATTTTCATTTGATCTTTAAAAAATAAAAACAAATTGGAGACCTGTGACATAACTCTAGTCTCTCAAGATTAGAACGA
GCAAATGGTAAAGAGATTTTCCTCTTTAAGAATCATTTATAGCTCTATTCTAATGATACCCAATCTGTACAGGTGTAAGTTATACTTCTG
AGGTATGTCACATATGTTAGAGTGCCTTCAGATGTAGTAGAATATGTATAATCACTATAATACAGAGCTTTGATTCTTTTCACAAACCAA
GCCCTTTTTCTAGTATTACAATTTTATCTTGTACTTTCATCCGTTAGAGTACCAGCATATTCACTTCATTACATTAGCGTCATATGTTTA
TGTATAATCATTATAAATGTGGCCGGGCACTGCAGCCTGGGTGAAAGAGTGAGGCTCTGTCTCAAAAAAAATCATTATAAATGCTTATTT
TTAAGACCATATATATCAAAAAGAAATAAAAAGCTGAGTGCTGTGGCTCATGGCTGTAATCCCAGTGCTTTGGGAGGGTGAGGCAAGAGG
ATCACATGAGTCCAGGAGTTTGAGACCAGCCTTGGCAACATAGCAACACCCCATCTCTACAAAAATAAAGAAATTAGATGTGGTGGCCTG
CATCTGTAGTCCAGCTACTTGGGAGACTGAGACCAGTAGATAACTTGAGCCCAGGAGTTCAAGGCTATGATTGTGTCACTGCACTCCAGC
CTGGGCCACAGAGGAAGACTCAGACTCAAAAGAAGAAGAAGAACACAGAAGAAAAGCAGAAACAAGAAGAAGATACAGATGTAACTTTAC

>In-frame_SCUBE2_ENST00000309263_chr11_9090917_-_LDHC_ENST00000280704_chr11_18451284_+_1587nt
GCGCACACCTCCCCGCGCCGCCGCCGCCACCGCCCGCACTCCGCCGCCTCTGCCCGCAACCGCTGAGCCATCCATGGGGGTCGCGGGCCG
CAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGGGCCGTCCCGCCGGGTCG
GGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCCCTGTGTCAGAACACACC
CACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGTGGAAATGAGCTCAATGG
AGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCTCATGACGGTCATAATTG
TCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTATGAGTGCTGCTGCAAGGA
GGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAGGATCACGGCTGTAGTCA
CATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAGAGAGACTGCATCTATTA
CAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTTGCCCTGGTCCAACGTAA
TGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCAAATCCAGTGGATATTTT
GACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCTGCCCGTTTCCGTTACCT
AATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGTGTGCCCTTATGGAGTGG
GGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGGAAAAATATCCATAAACA
AGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATGGATTTGGTAGGATCCAT
TTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTCTTTCTCAGTATCCCTTG
TGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAGAAGAGTGCAGAAACACT
TTGGAATATTCAAAAGGATCTAATATTTTAAATTAAAGCCTTCTAATGTTCCACTGTTTGGAGAACAGAAGATAGCAGGCTGTGTATTTT

>In-frame_SCUBE2_ENST00000309263_chr11_9090917_-_LDHC_ENST00000544105_chr11_18451284_+_1347nt
GCGCACACCTCCCCGCGCCGCCGCCGCCACCGCCCGCACTCCGCCGCCTCTGCCCGCAACCGCTGAGCCATCCATGGGGGTCGCGGGCCG
CAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGGGCCGTCCCGCCGGGTCG
GGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCCCTGTGTCAGAACACACC
CACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGTGGAAATGAGCTCAATGG
AGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCTCATGACGGTCATAATTG
TCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTATGAGTGCTGCTGCAAGGA
GGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAGGATCACGGCTGTAGTCA
CATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAGAGAGACTGCATCTATTA
CAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTTGCCCTGGTCCAACGTAA
TGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCAAATCCAGTGGATATTTT
GACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCTGCCCGTTTCCGTTACCT
AATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGTGTGCCCTTATGGAGTGG
GGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGGAAAAATATCCATAAACA
AGTTATTCAAAGGGATTATATGGAATAAAAGAAGAACTCTTTCTCAGTATCCCTTGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTG

>In-frame_SCUBE2_ENST00000450649_chr11_9090917_-_LDHC_ENST00000541669_chr11_18451284_+_2347nt
GCAACCGCTGAGCCATCCATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCA
CTGCTGCTGCTGGCGGGGGCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGAT
GACTGCCATGCCGACGCCCTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGT
GAGGACATCGATGAATGTGGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTT
GATGGCTTCATGTTGGCTCATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTC
AACGTCATGGGGAGCTATGAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGC
CTGAGCTGCATGAATAAGGATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTT
GAGCTGGCCAAGAACCAGAGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAG
GAGGGAGAAACTCGCCTTGCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGT
AAAATTCTTGTTGTTTCAAATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGT
GGTTGTAATCTAGACTCTGCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGA
GAACATGGTGATTCTAGTGTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGAT
TCAGATAAGGAACACTGGAAAAATATCCATAAACAAGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCT
ATTGGACTGTCTGTGATGGATTTGGTAGGATCCATTTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATAT
GGAATAAAAGAAGAACTCTTTCTCAGTATCCCTTGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAG
GAGGAGGCCCTTTTCAAGAAGAGTGCAGAAACACTTTGGAATATTCAAAAGGATCTAATATTTTAAATTAAAGCCTTCTAATGTTCCACT
GTTTGGAGAACAGAAGATAGCAGGCTGTGTATTTTAAATTTTGAAAGTATTTTCATTTGATCTTTAAAAAATAAAAACAAATTGGAGACC
TGTGACATAACTCTAGTCTCTCAAGATTAGAACGAGCAAATGGTAAAGAGATTTTCCTCTTTAAGAATCATTTATAGCTCTATTCTAATG
ATACCCAATCTGTACAGGTGTAAGTTATACTTCTGAGGTATGTCACATATGTTAGAGTGCCTTCAGATGTAGTAGAATATGTATAATCAC
TATAATACAGAGCTTTGATTCTTTTCACAAACCAAGCCCTTTTTCTAGTATTACAATTTTATCTTGTACTTTCATCCGTTAGAGTACCAG
CATATTCACTTCATTACATTAGCGTCATATGTTTATGTATAATCATTATAAATGTGGCCGGGCACTGCAGCCTGGGTGAAAGAGTGAGGC
TCTGTCTCAAAAAAAATCATTATAAATGCTTATTTTTAAGACCATATATATCAAAAAGAAATAAAAAGCTGAGTGCTGTGGCTCATGGCT
GTAATCCCAGTGCTTTGGGAGGGTGAGGCAAGAGGATCACATGAGTCCAGGAGTTTGAGACCAGCCTTGGCAACATAGCAACACCCCATC
TCTACAAAAATAAAGAAATTAGATGTGGTGGCCTGCATCTGTAGTCCAGCTACTTGGGAGACTGAGACCAGTAGATAACTTGAGCCCAGG
AGTTCAAGGCTATGATTGTGTCACTGCACTCCAGCCTGGGCCACAGAGGAAGACTCAGACTCAAAAGAAGAAGAAGAACACAGAAGAAAA
GCAGAAACAAGAAGAAGATACAGATGTAACTTTACGATGTAAAAAATCTAAATAAGATTGTATTCAACTCTGCAAGTATTATACTAGTCA

>In-frame_SCUBE2_ENST00000450649_chr11_9090917_-_LDHC_ENST00000280704_chr11_18451284_+_1532nt
GCAACCGCTGAGCCATCCATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCA
CTGCTGCTGCTGGCGGGGGCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGAT
GACTGCCATGCCGACGCCCTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGT
GAGGACATCGATGAATGTGGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTT
GATGGCTTCATGTTGGCTCATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTC
AACGTCATGGGGAGCTATGAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGC
CTGAGCTGCATGAATAAGGATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTT
GAGCTGGCCAAGAACCAGAGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAG
GAGGGAGAAACTCGCCTTGCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGT
AAAATTCTTGTTGTTTCAAATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGT
GGTTGTAATCTAGACTCTGCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGA
GAACATGGTGATTCTAGTGTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGAT
TCAGATAAGGAACACTGGAAAAATATCCATAAACAAGTTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCT
ATTGGACTGTCTGTGATGGATTTGGTAGGATCCATTTTGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATAT
GGAATAAAAGAAGAACTCTTTCTCAGTATCCCTTGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAG
GAGGAGGCCCTTTTCAAGAAGAGTGCAGAAACACTTTGGAATATTCAAAAGGATCTAATATTTTAAATTAAAGCCTTCTAATGTTCCACT
GTTTGGAGAACAGAAGATAGCAGGCTGTGTATTTTAAATTTTGAAAGTATTTTCATTTGATCTTTAAAAAATAAAAACAAATTGGAGACC

>In-frame_SCUBE2_ENST00000450649_chr11_9090917_-_LDHC_ENST00000544105_chr11_18451284_+_1292nt
GCAACCGCTGAGCCATCCATGGGGGTCGCGGGCCGCAACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCA
CTGCTGCTGCTGGCGGGGGCCGTCCCGCCGGGTCGGGGCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGAT
GACTGCCATGCCGACGCCCTGTGTCAGAACACACCCACCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGT
GAGGACATCGATGAATGTGGAAATGAGCTCAATGGAGGCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTT
GATGGCTTCATGTTGGCTCATGACGGTCATAATTGTCTTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTC
AACGTCATGGGGAGCTATGAGTGCTGCTGCAAGGAGGGGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGC
CTGAGCTGCATGAATAAGGATCACGGCTGTAGTCACATCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTT
GAGCTGGCCAAGAACCAGAGAGACTGCATCTATTACAGTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAG
GAGGGAGAAACTCGCCTTGCCCTGGTCCAACGTAATGTGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGT
AAAATTCTTGTTGTTTCAAATCCAGTGGATATTTTGACATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGT
GGTTGTAATCTAGACTCTGCCCGTTTCCGTTACCTAATTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGA
GAACATGGTGATTCTAGTGTGCCCTTATGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGAT
TCAGATAAGGAACACTGGAAAAATATCCATAAACAAGTTATTCAAAGGGATTATATGGAATAAAAGAAGAACTCTTTCTCAGTATCCCTT
GTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAGAAGAGTGCAGAAACAC

>In-frame_SCUBE2_ENST00000520467_chr11_9090917_-_LDHC_ENST00000541669_chr11_18451284_+_2400nt
GCACACCTCCCCGCGCCGCCGCCGCCACCGCCCGCACTCCGCCGCCTCTGCCCGCAACCGCTGAGCCATCCATGGGGGTCGCGGGCCGCA
ACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGGGCCGTCCCGCCGGGTCGGG
GCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCCCTGTGTCAGAACACACCCA
CCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGTGGAAATGAGCTCAATGGAG
GCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCTCATGACGGTCATAATTGTC
TTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTATGAGTGCTGCTGCAAGGAGG
GGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAGGATCACGGCTGTAGTCACA
TCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAGAGAGACTGCATCTATTACA
GTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTTGCCCTGGTCCAACGTAATG
TGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCAAATCCAGTGGATATTTTGA
CATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCTGCCCGTTTCCGTTACCTAA
TTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGTGTGCCCTTATGGAGTGGGG
TGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGGAAAAATATCCATAAACAAG
TTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATGGATTTGGTAGGATCCATTT
TGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTCTTTCTCAGTATCCCTTGTG
TCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAGAAGAGTGCAGAAACACTTT
GGAATATTCAAAAGGATCTAATATTTTAAATTAAAGCCTTCTAATGTTCCACTGTTTGGAGAACAGAAGATAGCAGGCTGTGTATTTTAA
ATTTTGAAAGTATTTTCATTTGATCTTTAAAAAATAAAAACAAATTGGAGACCTGTGACATAACTCTAGTCTCTCAAGATTAGAACGAGC
AAATGGTAAAGAGATTTTCCTCTTTAAGAATCATTTATAGCTCTATTCTAATGATACCCAATCTGTACAGGTGTAAGTTATACTTCTGAG
GTATGTCACATATGTTAGAGTGCCTTCAGATGTAGTAGAATATGTATAATCACTATAATACAGAGCTTTGATTCTTTTCACAAACCAAGC
CCTTTTTCTAGTATTACAATTTTATCTTGTACTTTCATCCGTTAGAGTACCAGCATATTCACTTCATTACATTAGCGTCATATGTTTATG
TATAATCATTATAAATGTGGCCGGGCACTGCAGCCTGGGTGAAAGAGTGAGGCTCTGTCTCAAAAAAAATCATTATAAATGCTTATTTTT
AAGACCATATATATCAAAAAGAAATAAAAAGCTGAGTGCTGTGGCTCATGGCTGTAATCCCAGTGCTTTGGGAGGGTGAGGCAAGAGGAT
CACATGAGTCCAGGAGTTTGAGACCAGCCTTGGCAACATAGCAACACCCCATCTCTACAAAAATAAAGAAATTAGATGTGGTGGCCTGCA
TCTGTAGTCCAGCTACTTGGGAGACTGAGACCAGTAGATAACTTGAGCCCAGGAGTTCAAGGCTATGATTGTGTCACTGCACTCCAGCCT
GGGCCACAGAGGAAGACTCAGACTCAAAAGAAGAAGAAGAACACAGAAGAAAAGCAGAAACAAGAAGAAGATACAGATGTAACTTTACGA

>In-frame_SCUBE2_ENST00000520467_chr11_9090917_-_LDHC_ENST00000280704_chr11_18451284_+_1585nt
GCACACCTCCCCGCGCCGCCGCCGCCACCGCCCGCACTCCGCCGCCTCTGCCCGCAACCGCTGAGCCATCCATGGGGGTCGCGGGCCGCA
ACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGGGCCGTCCCGCCGGGTCGGG
GCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCCCTGTGTCAGAACACACCCA
CCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGTGGAAATGAGCTCAATGGAG
GCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCTCATGACGGTCATAATTGTC
TTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTATGAGTGCTGCTGCAAGGAGG
GGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAGGATCACGGCTGTAGTCACA
TCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAGAGAGACTGCATCTATTACA
GTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTTGCCCTGGTCCAACGTAATG
TGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCAAATCCAGTGGATATTTTGA
CATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCTGCCCGTTTCCGTTACCTAA
TTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGTGTGCCCTTATGGAGTGGGG
TGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGGAAAAATATCCATAAACAAG
TTATTCAAAGTGCCTATGAAATTATCAAGCTGAAGGGGTATACCTCTTGGGCTATTGGACTGTCTGTGATGGATTTGGTAGGATCCATTT
TGAAAAATCTTAGGAGAGTGCACCCAGTTTCCACCATGGTTAAGGGATTATATGGAATAAAAGAAGAACTCTTTCTCAGTATCCCTTGTG
TCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAAAATTAACTTGAATTCTGAGGAGGAGGCCCTTTTCAAGAAGAGTGCAGAAACACTTT
GGAATATTCAAAAGGATCTAATATTTTAAATTAAAGCCTTCTAATGTTCCACTGTTTGGAGAACAGAAGATAGCAGGCTGTGTATTTTAA

>In-frame_SCUBE2_ENST00000520467_chr11_9090917_-_LDHC_ENST00000544105_chr11_18451284_+_1345nt
GCACACCTCCCCGCGCCGCCGCCGCCACCGCCCGCACTCCGCCGCCTCTGCCCGCAACCGCTGAGCCATCCATGGGGGTCGCGGGCCGCA
ACCGTCCCGGGGCGGCCTGGGCGGTGCTGCTGCTGCTGCTGCTGCTGCCGCCACTGCTGCTGCTGGCGGGGGCCGTCCCGCCGGGTCGGG
GCCGTGCCGCGGGGCCGCAGGAGGATGTAGATGAGTGTGCCCAAGGGCTAGATGACTGCCATGCCGACGCCCTGTGTCAGAACACACCCA
CCTCCTACAAGTGCTCCTGCAAGCCTGGCTACCAAGGGGAAGGCAGGCAGTGTGAGGACATCGATGAATGTGGAAATGAGCTCAATGGAG
GCTGTGTCCATGACTGTTTGAATATTCCAGGCAATTATCGTTGCACTTGTTTTGATGGCTTCATGTTGGCTCATGACGGTCATAATTGTC
TTGATGTGGACGAGTGCCTGGAGAACAATGGCGGCTGCCAGCATACCTGTGTCAACGTCATGGGGAGCTATGAGTGCTGCTGCAAGGAGG
GGTTTTTCCTGAGTGACAATCAGCACACCTGCATTCACCGCTCGGAAGAGGGCCTGAGCTGCATGAATAAGGATCACGGCTGTAGTCACA
TCTGCAAGGAGGCCCCAAGGGGCAGCGTCGCCTGTGAGTGCAGGCCTGGTTTTGAGCTGGCCAAGAACCAGAGAGACTGCATCTATTACA
GTGTATCTGCAAACTCCAGAATAGTTATTGTCACAGCAGGTGCAAGGCAGCAGGAGGGAGAAACTCGCCTTGCCCTGGTCCAACGTAATG
TGGCTATAATGAAATCAATCATTCCTGCCATAGTCCATTATAGTCCTGATTGTAAAATTCTTGTTGTTTCAAATCCAGTGGATATTTTGA
CATATATAGTCTGGAAGATAAGTGGCTTACCTGTAACTCGTGTAATTGGAAGTGGTTGTAATCTAGACTCTGCCCGTTTCCGTTACCTAA
TTGGAGAAAAGTTGGGTGTCCACCCCACAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGTGTGCCCTTATGGAGTGGGG
TGAATGTTGCTGGTGTTGCTCTGAAGACTCTGGACCCTAAATTAGGAACGGATTCAGATAAGGAACACTGGAAAAATATCCATAAACAAG
TTATTCAAAGGGATTATATGGAATAAAAGAAGAACTCTTTCTCAGTATCCCTTGTGTCTTGGGGCGGAATGGTGTCTCAGATGTTGTGAA


Top

FusionGenePPI for SCUBE2_LDHC


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SCUBE2LDHCBRD4, RBL2, BRCA1, LIG4, MAPK7, ARF4, ARF5, ARF1, RAB1A, RAB1B, SOD1, WDR1, MDH1, NME1-NME2, NME2, TALDO1, TPI1, UBE2N, SRPK2, LDHA, LDHB, TLE3, TSSC1, ELMOD1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000309263-522847_8562141000the cholesterol-anchor of SHH
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000450649-518847_856214808the cholesterol-anchor of SHH
HgeneSCUBE2chr11:9090917chr11:18451284ENST00000520467-522847_856214972the cholesterol-anchor of SHH


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SCUBE2_LDHC


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SCUBE2_LDHC


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneLDHCC0021364Male infertility2CTD_human
TgeneLDHCC0024115Lung diseases1CTD_human