FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32813

FusionGeneSummary for SCD_SEC61A2

check button Fusion gene summary
Fusion gene informationFusion gene name: SCD_SEC61A2
Fusion gene ID: 32813
HgeneTgene
Gene symbol

SCD

SEC61A2

Gene ID

6319

55176

Gene namestearoyl-CoA desaturaseSec61 translocon alpha 2 subunit
SynonymsFADS5|MSTP008|SCD1|SCDOS|hSCD1-
Cytomap

10q24.31

10p14

Type of geneprotein-codingprotein-coding
Descriptionacyl-CoA desaturasedelta(9)-desaturasefatty acid desaturasepredicted protein of HQ0998stearoyl-CoA desaturase (delta-9-desaturase)stearoyl-CoA desaturase opposite strandprotein transport protein Sec61 subunit alpha isoform 2Sec61 alpha 2 subunitSec61 alpha form 2protein transport protein Sec61 subunit alphasec61 alpha-2
Modification date2018052320180523
UniProtAcc

O00767

Q9H9S3

Ensembl transtripts involved in fusion geneENST00000370355, ENST00000379051, 
ENST00000379033, ENST00000298428, 
ENST00000495368, ENST00000304267, 
ENST00000379020, ENST00000379017, 
Fusion gene scores* DoF score4 X 4 X 3=483 X 4 X 2=24
# samples 43
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/24*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: SCD [Title/Abstract] AND SEC61A2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSCD

GO:0006636

unsaturated fatty acid biosynthetic process

15907797|18765284


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-TM-A84J-01ASCDchr10

102116521

+SEC61A2chr10

12191594

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000370355ENST00000379051SCDchr10

102116521

+SEC61A2chr10

12191594

+
In-frameENST00000370355ENST00000379033SCDchr10

102116521

+SEC61A2chr10

12191594

+
In-frameENST00000370355ENST00000298428SCDchr10

102116521

+SEC61A2chr10

12191594

+
5CDS-3UTRENST00000370355ENST00000495368SCDchr10

102116521

+SEC61A2chr10

12191594

+
5CDS-3UTRENST00000370355ENST00000304267SCDchr10

102116521

+SEC61A2chr10

12191594

+
5CDS-3UTRENST00000370355ENST00000379020SCDchr10

102116521

+SEC61A2chr10

12191594

+
5CDS-3UTRENST00000370355ENST00000379017SCDchr10

102116521

+SEC61A2chr10

12191594

+

Top

FusionProtFeatures for SCD_SEC61A2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SCD

O00767

SEC61A2

Q9H9S3

Appears to play a crucial role in the insertion ofsecretory and membrane polypeptides into the ER. It is requiredfor assembly of membrane and secretory proteins. Found to betightly associated with membrane-bound ribosomes, either directlyor through adaptor proteins (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSCDchr10:102116521chr10:12191594ENST00000370355+56120_125293360MotifHistidine box-1
HgeneSCDchr10:102116521chr10:12191594ENST00000370355+56157_161293360MotifHistidine box-2
HgeneSCDchr10:102116521chr10:12191594ENST00000370355+56119_217293360Topological domainCytoplasmic
HgeneSCDchr10:102116521chr10:12191594ENST00000370355+561_72293360Topological domainCytoplasmic
HgeneSCDchr10:102116521chr10:12191594ENST00000370355+56238_241293360Topological domainLumenal
HgeneSCDchr10:102116521chr10:12191594ENST00000370355+5694_97293360Topological domainLumenal
HgeneSCDchr10:102116521chr10:12191594ENST00000370355+56218_237293360TransmembraneHelical
HgeneSCDchr10:102116521chr10:12191594ENST00000370355+56242_263293360TransmembraneHelical
HgeneSCDchr10:102116521chr10:12191594ENST00000370355+5673_93293360TransmembraneHelical
HgeneSCDchr10:102116521chr10:12191594ENST00000370355+5698_118293360TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312139_14473477Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312166_17273477Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312194_24073477Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312262_28873477Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312310_35473477Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312376_42073477Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312442_44573477Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312463_47673477Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+31297_11773477Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312139_14473438Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312166_17273438Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312194_24073438Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312262_28873438Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312310_35473438Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312376_42073438Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312442_44573438Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312463_47673438Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+31297_11773438Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211139_14451455Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211166_17251455Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211194_24051455Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211262_28851455Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211310_35451455Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211376_42051455Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211442_44551455Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211463_47651455Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+21154_7651455Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+21197_11751455Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312118_13873477TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312145_16573477TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312173_19373477TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312241_26173477TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312289_30973477TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312355_37573477TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312421_44173477TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+312446_46273477TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+31277_9673477TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312118_13873438TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312145_16573438TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312173_19373438TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312241_26173438TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312289_30973438TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312355_37573438TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312421_44173438TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+312446_46273438TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+31277_9673438TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211118_13851455TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211145_16551455TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211173_19351455TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211241_26151455TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211289_30951455TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211355_37551455TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211421_44151455TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+211446_46251455TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+21177_9651455TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSCDchr10:102116521chr10:12191594ENST00000370355+56298_302293360MotifHistidine box-3
HgeneSCDchr10:102116521chr10:12191594ENST00000370355+56264_359293360Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+3121_3373477Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+31254_7673477Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+3121_3373438Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+31254_7673438Topological domainLumenal
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+2111_3351455Topological domainCytoplasmic
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000298428+31234_5373477TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000304267+31234_5373438TransmembraneHelical
TgeneSEC61A2chr10:102116521chr10:12191594ENST00000379033+21134_5351455TransmembraneHelical


Top

FusionGeneSequence for SCD_SEC61A2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SCD_ENST00000370355_chr10_102116521_+_SEC61A2_ENST00000379051_chr10_12191594_+_380aa
MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYVWRNIILMSLLHLGALYGI
TLIPTCKFYTWLWGVFYYFVSALGITAGAHRLWSHRSYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWGETFQNSVFVATFLRYAVVLNATWLVNSAAHL
FGYRPYDKNISPRENILVSLGAVGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDP

>In-frame_SCD_ENST00000370355_chr10_102116521_+_SEC61A2_ENST00000379033_chr10_12191594_+_697aa
MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYVWRNIILMSLLHLGALYGI
TLIPTCKFYTWLWGVFYYFVSALGITAGAHRLWSHRSYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWGETFQNSVFVATFLRYAVVLNATWLVNSAAHL
FGYRPYDKNISPRENILVSLGAVGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDP
AEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRAL
REAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNL
LGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMV

>In-frame_SCD_ENST00000370355_chr10_102116521_+_SEC61A2_ENST00000298428_chr10_12191594_+_697aa
MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYVWRNIILMSLLHLGALYGI
TLIPTCKFYTWLWGVFYYFVSALGITAGAHRLWSHRSYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWGETFQNSVFVATFLRYAVVLNATWLVNSAAHL
FGYRPYDKNISPRENILVSLGAVGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDP
AEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRAL
REAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNL
LGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SCD_ENST00000370355_chr10_102116521_+_SEC61A2_ENST00000379051_chr10_12191594_+_1140nt
ATGCCGGCCCACTTGCTGCAGGACGATATCTCTAGCTCCTATACCACCACCACCACCATTACAGCGCCTCCCTCCAGGGTCCTGCAGAAT
GGAGGAGATAAGTTGGAGACGATGCCCCTCTACTTGGAAGACGACATTCGCCCTGATATAAAAGATGATATATATGACCCCACCTACAAG
GATAAGGAAGGCCCAAGCCCCAAGGTTGAATATGTCTGGAGAAACATCATCCTTATGTCTCTGCTACACTTGGGAGCCCTGTATGGGATC
ACTTTGATTCCTACCTGCAAGTTCTACACCTGGCTTTGGGGGGTATTCTACTATTTTGTCAGTGCCCTGGGCATAACAGCAGGAGCTCAT
CGTCTGTGGAGCCACCGCTCTTACAAAGCTCGGCTGCCCCTACGGCTCTTTCTGATCATTGCCAACACAATGGCATTCCAGAATGATGTC
TATGAATGGGCTCGTGACCACCGTGCCCACCACAAGTTTTCAGAAACACATGCTGATCCTCATAATTCCCGACGTGGCTTTTTCTTCTCT
CACGTGGGTTGGCTGCTTGTGCGCAAACACCCAGCTGTCAAAGAGAAGGGGAGTACGCTAGACTTGTCTGACCTAGAAGCTGAGAAACTG
GTGATGTTCCAGAGGAGGTACTACAAACCTGGCTTGCTGATGATGTGCTTCATCCTGCCCACGCTTGTGCCCTGGTATTTCTGGGGTGAA
ACTTTTCAAAACAGTGTGTTCGTTGCCACTTTCTTGCGATATGCTGTGGTGCTTAATGCCACCTGGCTGGTGAACAGTGCTGCCCACCTC
TTCGGATATCGTCCTTATGACAAGAACATTAGCCCCCGGGAGAATATCCTGGTTTCACTTGGAGCTGTGGGAACTTTAATGGAATTGGGT
ATCTCCCCAATTGTAACATCTGGTTTGATTATGCAGTTGTTAGCTGGAGCCAAAATCATTGAAGTTGGAGATACACCGAAAGATAGAGCT
TTATTCAATGGAGCCCAGAAACTGTTTGGTATGATCATTACCATTGGGCAAGCCATTGTGTATGTCATGACGGGGATGTATGGGGACCCT

>In-frame_SCD_ENST00000370355_chr10_102116521_+_SEC61A2_ENST00000379033_chr10_12191594_+_2091nt
ATGCCGGCCCACTTGCTGCAGGACGATATCTCTAGCTCCTATACCACCACCACCACCATTACAGCGCCTCCCTCCAGGGTCCTGCAGAAT
GGAGGAGATAAGTTGGAGACGATGCCCCTCTACTTGGAAGACGACATTCGCCCTGATATAAAAGATGATATATATGACCCCACCTACAAG
GATAAGGAAGGCCCAAGCCCCAAGGTTGAATATGTCTGGAGAAACATCATCCTTATGTCTCTGCTACACTTGGGAGCCCTGTATGGGATC
ACTTTGATTCCTACCTGCAAGTTCTACACCTGGCTTTGGGGGGTATTCTACTATTTTGTCAGTGCCCTGGGCATAACAGCAGGAGCTCAT
CGTCTGTGGAGCCACCGCTCTTACAAAGCTCGGCTGCCCCTACGGCTCTTTCTGATCATTGCCAACACAATGGCATTCCAGAATGATGTC
TATGAATGGGCTCGTGACCACCGTGCCCACCACAAGTTTTCAGAAACACATGCTGATCCTCATAATTCCCGACGTGGCTTTTTCTTCTCT
CACGTGGGTTGGCTGCTTGTGCGCAAACACCCAGCTGTCAAAGAGAAGGGGAGTACGCTAGACTTGTCTGACCTAGAAGCTGAGAAACTG
GTGATGTTCCAGAGGAGGTACTACAAACCTGGCTTGCTGATGATGTGCTTCATCCTGCCCACGCTTGTGCCCTGGTATTTCTGGGGTGAA
ACTTTTCAAAACAGTGTGTTCGTTGCCACTTTCTTGCGATATGCTGTGGTGCTTAATGCCACCTGGCTGGTGAACAGTGCTGCCCACCTC
TTCGGATATCGTCCTTATGACAAGAACATTAGCCCCCGGGAGAATATCCTGGTTTCACTTGGAGCTGTGGGAACTTTAATGGAATTGGGT
ATCTCCCCAATTGTAACATCTGGTTTGATTATGCAGTTGTTAGCTGGAGCCAAAATCATTGAAGTTGGAGATACACCGAAAGATAGAGCT
TTATTCAATGGAGCCCAGAAACTGTTTGGTATGATCATTACCATTGGGCAAGCCATTGTGTATGTCATGACGGGGATGTATGGGGACCCT
GCAGAAATGGGTGCCGGAATCTGTCTCCTGATCATCATTCAGTTGTTTGTTGCTGGTTTGATTGTGCTGCTGTTAGATGAGCTGCTACAG
AAGGGTTACGGCTTGGGGTCTGGGATTTCCCTCTTTATTGCCACCAACATCTGTGAGACCATTGTCTGGAAGGCCTTTAGTCCCACTACC
ATTAACACTGGCAGAGGTACTGAGTTTGAGGGTGCAGTCATAGCTCTGTTCCATTTGTTGGCCACCAGGACGGACAAAGTCCGAGCTTTA
CGGGAGGCTTTTTATCGGCAGAACTTACCCAATCTCATGAACCTCATTGCTACAGTTTTTGTGTTTGCTGTTGTTATATATTTCCAAGGA
TTTCGCGTTGATCTGCCCATTAAGTCGGCCCGTTACCGAGGACAGTACAGCAGCTACCCCATCAAACTCTTCTACACCTCCAACATCCCC
ATCATCCTCCAGTCGGCCCTGGTGTCCAACCTGTATGTTATTTCCCAGATGCTGTCTGTTCGATTTAGTGGCAACTTTTTAGTAAATTTA
CTAGGACAGTGGGCCGATGTCAGTGGGGGAGGACCCGCACGTTCTTACCCAGTTGGAGGCCTTTGTTACTATCTTTCTCCTCCTGAGTCC
ATGGGCGCCATCTTTGAGGATCCTGTCCATGTCGTTGTTTATATCATCTTCATGTTGGGGTCATGTGCATTCTTCTCTAAGACATGGATT
GAAGTGTCTGGTTCCTCAGCCAAAGATGTAGCTAAACAGCTGAAAGAACAGCAGATGGTAATGAGGGGCCACCGAGATACCTCTATGGTT
CATGAGCTTAATAGGTACATCCCCACCGCAGCTGCGTTTGGCGGTTTGTGCATTGGCGCCCTGTCAGTGCTGGCTGACTTCCTGGGGGCC
ATTGGATCTGGCACTGGAATTCTGCTAGCAGTCACTATTATTTACCAGTATTTTGAAATATTTGTTAAAGAACAGGCCGAAGTTGGTGGG

>In-frame_SCD_ENST00000370355_chr10_102116521_+_SEC61A2_ENST00000298428_chr10_12191594_+_2091nt
ATGCCGGCCCACTTGCTGCAGGACGATATCTCTAGCTCCTATACCACCACCACCACCATTACAGCGCCTCCCTCCAGGGTCCTGCAGAAT
GGAGGAGATAAGTTGGAGACGATGCCCCTCTACTTGGAAGACGACATTCGCCCTGATATAAAAGATGATATATATGACCCCACCTACAAG
GATAAGGAAGGCCCAAGCCCCAAGGTTGAATATGTCTGGAGAAACATCATCCTTATGTCTCTGCTACACTTGGGAGCCCTGTATGGGATC
ACTTTGATTCCTACCTGCAAGTTCTACACCTGGCTTTGGGGGGTATTCTACTATTTTGTCAGTGCCCTGGGCATAACAGCAGGAGCTCAT
CGTCTGTGGAGCCACCGCTCTTACAAAGCTCGGCTGCCCCTACGGCTCTTTCTGATCATTGCCAACACAATGGCATTCCAGAATGATGTC
TATGAATGGGCTCGTGACCACCGTGCCCACCACAAGTTTTCAGAAACACATGCTGATCCTCATAATTCCCGACGTGGCTTTTTCTTCTCT
CACGTGGGTTGGCTGCTTGTGCGCAAACACCCAGCTGTCAAAGAGAAGGGGAGTACGCTAGACTTGTCTGACCTAGAAGCTGAGAAACTG
GTGATGTTCCAGAGGAGGTACTACAAACCTGGCTTGCTGATGATGTGCTTCATCCTGCCCACGCTTGTGCCCTGGTATTTCTGGGGTGAA
ACTTTTCAAAACAGTGTGTTCGTTGCCACTTTCTTGCGATATGCTGTGGTGCTTAATGCCACCTGGCTGGTGAACAGTGCTGCCCACCTC
TTCGGATATCGTCCTTATGACAAGAACATTAGCCCCCGGGAGAATATCCTGGTTTCACTTGGAGCTGTGGGAACTTTAATGGAATTGGGT
ATCTCCCCAATTGTAACATCTGGTTTGATTATGCAGTTGTTAGCTGGAGCCAAAATCATTGAAGTTGGAGATACACCGAAAGATAGAGCT
TTATTCAATGGAGCCCAGAAACTGTTTGGTATGATCATTACCATTGGGCAAGCCATTGTGTATGTCATGACGGGGATGTATGGGGACCCT
GCAGAAATGGGTGCCGGAATCTGTCTCCTGATCATCATTCAGTTGTTTGTTGCTGGTTTGATTGTGCTGCTGTTAGATGAGCTGCTACAG
AAGGGTTACGGCTTGGGGTCTGGGATTTCCCTCTTTATTGCCACCAACATCTGTGAGACCATTGTCTGGAAGGCCTTTAGTCCCACTACC
ATTAACACTGGCAGAGGTACTGAGTTTGAGGGTGCAGTCATAGCTCTGTTCCATTTGTTGGCCACCAGGACGGACAAAGTCCGAGCTTTA
CGGGAGGCTTTTTATCGGCAGAACTTACCCAATCTCATGAACCTCATTGCTACAGTTTTTGTGTTTGCTGTTGTTATATATTTCCAAGGA
TTTCGCGTTGATCTGCCCATTAAGTCGGCCCGTTACCGAGGACAGTACAGCAGCTACCCCATCAAACTCTTCTACACCTCCAACATCCCC
ATCATCCTCCAGTCGGCCCTGGTGTCCAACCTGTATGTTATTTCCCAGATGCTGTCTGTTCGATTTAGTGGCAACTTTTTAGTAAATTTA
CTAGGACAGTGGGCCGATGTCAGTGGGGGAGGACCCGCACGTTCTTACCCAGTTGGAGGCCTTTGTTACTATCTTTCTCCTCCTGAGTCC
ATGGGCGCCATCTTTGAGGATCCTGTCCATGTCGTTGTTTATATCATCTTCATGTTGGGGTCATGTGCATTCTTCTCTAAGACATGGATT
GAAGTGTCTGGTTCCTCAGCCAAAGATGTAGCTAAACAGCTGAAAGAACAGCAGATGGTAATGAGGGGCCACCGAGATACCTCTATGGTT
CATGAGCTTAATAGGTACATCCCCACCGCAGCTGCGTTTGGCGGTTTGTGCATTGGCGCCCTGTCAGTGCTGGCTGACTTCCTGGGGGCC
ATTGGATCTGGCACTGGAATTCTGCTAGCAGTCACTATTATTTACCAGTATTTTGAAATATTTGTTAAAGAACAGGCCGAAGTTGGTGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SCD_ENST00000370355_chr10_102116521_+_SEC61A2_ENST00000379051_chr10_12191594_+_1597nt
GTGGTGTCGGTGTCGGCAGCATCCCCGGCGCCCTGCTGCGGTCGCCGCGAGCCTCGGCCTCTGTCTCCTCCCCCTCCCGCCCTTACCTCC
ACGCGGGACCGCCCGCGCCAGTCAACTCCTCGCACTTTGCCCCTGCTTGGCAGCGGATAAAAGGGGGCTGAGGAAATACCGGACACGGTC
ACCCGTTGCCAGCTCTAGCCTTTAAATTCCCGGCTCGGGGACCTCCACGCACCGCGGCTAGCGCCGACAACCAGCTAGCGTGCAAGGCGC
CGCGGCTCAGCGCGTACCGGCGGGCTTCGAAACCGCAGTCCTCCGGCGACCCCGAACTCCGCTCCGGAGCCTCAGCCCCCTGGAAAGTGA
TCCCGGCATCCGAGAGCCAAGATGCCGGCCCACTTGCTGCAGGACGATATCTCTAGCTCCTATACCACCACCACCACCATTACAGCGCCT
CCCTCCAGGGTCCTGCAGAATGGAGGAGATAAGTTGGAGACGATGCCCCTCTACTTGGAAGACGACATTCGCCCTGATATAAAAGATGAT
ATATATGACCCCACCTACAAGGATAAGGAAGGCCCAAGCCCCAAGGTTGAATATGTCTGGAGAAACATCATCCTTATGTCTCTGCTACAC
TTGGGAGCCCTGTATGGGATCACTTTGATTCCTACCTGCAAGTTCTACACCTGGCTTTGGGGGGTATTCTACTATTTTGTCAGTGCCCTG
GGCATAACAGCAGGAGCTCATCGTCTGTGGAGCCACCGCTCTTACAAAGCTCGGCTGCCCCTACGGCTCTTTCTGATCATTGCCAACACA
ATGGCATTCCAGAATGATGTCTATGAATGGGCTCGTGACCACCGTGCCCACCACAAGTTTTCAGAAACACATGCTGATCCTCATAATTCC
CGACGTGGCTTTTTCTTCTCTCACGTGGGTTGGCTGCTTGTGCGCAAACACCCAGCTGTCAAAGAGAAGGGGAGTACGCTAGACTTGTCT
GACCTAGAAGCTGAGAAACTGGTGATGTTCCAGAGGAGGTACTACAAACCTGGCTTGCTGATGATGTGCTTCATCCTGCCCACGCTTGTG
CCCTGGTATTTCTGGGGTGAAACTTTTCAAAACAGTGTGTTCGTTGCCACTTTCTTGCGATATGCTGTGGTGCTTAATGCCACCTGGCTG
GTGAACAGTGCTGCCCACCTCTTCGGATATCGTCCTTATGACAAGAACATTAGCCCCCGGGAGAATATCCTGGTTTCACTTGGAGCTGTG
GGAACTTTAATGGAATTGGGTATCTCCCCAATTGTAACATCTGGTTTGATTATGCAGTTGTTAGCTGGAGCCAAAATCATTGAAGTTGGA
GATACACCGAAAGATAGAGCTTTATTCAATGGAGCCCAGAAACTGTTTGGTATGATCATTACCATTGGGCAAGCCATTGTGTATGTCATG
ACGGGGATGTATGGGGACCCTGCAGAAATGGGTGCCGGAATCTGTCTCCTGATCATCATTCAGGATCAACACAGCCCTTAGACTTATCCT

>In-frame_SCD_ENST00000370355_chr10_102116521_+_SEC61A2_ENST00000379033_chr10_12191594_+_3422nt
GTGGTGTCGGTGTCGGCAGCATCCCCGGCGCCCTGCTGCGGTCGCCGCGAGCCTCGGCCTCTGTCTCCTCCCCCTCCCGCCCTTACCTCC
ACGCGGGACCGCCCGCGCCAGTCAACTCCTCGCACTTTGCCCCTGCTTGGCAGCGGATAAAAGGGGGCTGAGGAAATACCGGACACGGTC
ACCCGTTGCCAGCTCTAGCCTTTAAATTCCCGGCTCGGGGACCTCCACGCACCGCGGCTAGCGCCGACAACCAGCTAGCGTGCAAGGCGC
CGCGGCTCAGCGCGTACCGGCGGGCTTCGAAACCGCAGTCCTCCGGCGACCCCGAACTCCGCTCCGGAGCCTCAGCCCCCTGGAAAGTGA
TCCCGGCATCCGAGAGCCAAGATGCCGGCCCACTTGCTGCAGGACGATATCTCTAGCTCCTATACCACCACCACCACCATTACAGCGCCT
CCCTCCAGGGTCCTGCAGAATGGAGGAGATAAGTTGGAGACGATGCCCCTCTACTTGGAAGACGACATTCGCCCTGATATAAAAGATGAT
ATATATGACCCCACCTACAAGGATAAGGAAGGCCCAAGCCCCAAGGTTGAATATGTCTGGAGAAACATCATCCTTATGTCTCTGCTACAC
TTGGGAGCCCTGTATGGGATCACTTTGATTCCTACCTGCAAGTTCTACACCTGGCTTTGGGGGGTATTCTACTATTTTGTCAGTGCCCTG
GGCATAACAGCAGGAGCTCATCGTCTGTGGAGCCACCGCTCTTACAAAGCTCGGCTGCCCCTACGGCTCTTTCTGATCATTGCCAACACA
ATGGCATTCCAGAATGATGTCTATGAATGGGCTCGTGACCACCGTGCCCACCACAAGTTTTCAGAAACACATGCTGATCCTCATAATTCC
CGACGTGGCTTTTTCTTCTCTCACGTGGGTTGGCTGCTTGTGCGCAAACACCCAGCTGTCAAAGAGAAGGGGAGTACGCTAGACTTGTCT
GACCTAGAAGCTGAGAAACTGGTGATGTTCCAGAGGAGGTACTACAAACCTGGCTTGCTGATGATGTGCTTCATCCTGCCCACGCTTGTG
CCCTGGTATTTCTGGGGTGAAACTTTTCAAAACAGTGTGTTCGTTGCCACTTTCTTGCGATATGCTGTGGTGCTTAATGCCACCTGGCTG
GTGAACAGTGCTGCCCACCTCTTCGGATATCGTCCTTATGACAAGAACATTAGCCCCCGGGAGAATATCCTGGTTTCACTTGGAGCTGTG
GGAACTTTAATGGAATTGGGTATCTCCCCAATTGTAACATCTGGTTTGATTATGCAGTTGTTAGCTGGAGCCAAAATCATTGAAGTTGGA
GATACACCGAAAGATAGAGCTTTATTCAATGGAGCCCAGAAACTGTTTGGTATGATCATTACCATTGGGCAAGCCATTGTGTATGTCATG
ACGGGGATGTATGGGGACCCTGCAGAAATGGGTGCCGGAATCTGTCTCCTGATCATCATTCAGTTGTTTGTTGCTGGTTTGATTGTGCTG
CTGTTAGATGAGCTGCTACAGAAGGGTTACGGCTTGGGGTCTGGGATTTCCCTCTTTATTGCCACCAACATCTGTGAGACCATTGTCTGG
AAGGCCTTTAGTCCCACTACCATTAACACTGGCAGAGGTACTGAGTTTGAGGGTGCAGTCATAGCTCTGTTCCATTTGTTGGCCACCAGG
ACGGACAAAGTCCGAGCTTTACGGGAGGCTTTTTATCGGCAGAACTTACCCAATCTCATGAACCTCATTGCTACAGTTTTTGTGTTTGCT
GTTGTTATATATTTCCAAGGATTTCGCGTTGATCTGCCCATTAAGTCGGCCCGTTACCGAGGACAGTACAGCAGCTACCCCATCAAACTC
TTCTACACCTCCAACATCCCCATCATCCTCCAGTCGGCCCTGGTGTCCAACCTGTATGTTATTTCCCAGATGCTGTCTGTTCGATTTAGT
GGCAACTTTTTAGTAAATTTACTAGGACAGTGGGCCGATGTCAGTGGGGGAGGACCCGCACGTTCTTACCCAGTTGGAGGCCTTTGTTAC
TATCTTTCTCCTCCTGAGTCCATGGGCGCCATCTTTGAGGATCCTGTCCATGTCGTTGTTTATATCATCTTCATGTTGGGGTCATGTGCA
TTCTTCTCTAAGACATGGATTGAAGTGTCTGGTTCCTCAGCCAAAGATGTAGCTAAACAGCTGAAAGAACAGCAGATGGTAATGAGGGGC
CACCGAGATACCTCTATGGTTCATGAGCTTAATAGGTACATCCCCACCGCAGCTGCGTTTGGCGGTTTGTGCATTGGCGCCCTGTCAGTG
CTGGCTGACTTCCTGGGGGCCATTGGATCTGGCACTGGAATTCTGCTAGCAGTCACTATTATTTACCAGTATTTTGAAATATTTGTTAAA
GAACAGGCCGAAGTTGGTGGGATGGGTGCTTTGTTTTTCTAAATGTTCAAATATTTCATTTTGTGCGTGTGAAAGGGAAAACACTTTGAC
GGATCGTTTTTGTCAGATGACACTGGTGGCTCCCCTTTTCTCCCCTCACAGTTTCTTGTTTCGAGTGCTGACTGACCCGTTTCTGAAATG
GGCACCGAGCTAAGTCTGTGTGCAGCATTAGTACCCGCTGCCTTAAAACTCAAGTTTACATTATTCATTAAAAAAAGTACATCTAGTGTT
GCCTGTAATGCTGGAAACCAGTGTATCTACCTTGCTGTGTTAAATCATGACAGTGAGACGGTGAGATGGATTCGTTTTGCACACAACATT
CAAAACACTTCATATTGCCCCCACTTGTTGAAAAATAAATGTAGTTCAAATTGCCACTTTCCAGTATTTTTGAGCTTATTTAATGAGTTC
TGGAACATTTATATCTAATCTATATTTTAGATAATTACTTTTTATACTTTTTTAACTCATGGTATCCCCACTCCCCACCCCCACCTCATT
TTTATTTGTCCCTTCTCAAAGCAGCCACTTAGCCCACATGGGCGAAATCAAGTCTCCAGTTATTTCTGCCACAACTGCTTCTAAGGCCTC
CTCCTTCTCCTCCTCCTCTTCCTCTTCCTCCTTTTCCTTCTCCTCCTCCTCTCTTCCCAGTGACAGCATCATCGTGCTGTTTGCCTGTAT
TGGCTATGCCTTCTAACTCCAACCAGTCACTTGAGAATATTCTTTCAAGATTCTGGGCCCCGATTCTTTTCTGTTTAAATCCCTAAAGCA
AAGATCTAATTCTCAAGCAATGTCTGTAGTTCAGTGGGGGTGAACAATGAATATATTCATGCTAGGAATTTGTGTCTGTTGTTGTACTCA
CAGCAGCAACATGAGTGTAAACAGTAGACAATAAACTTTTATTTAAGAAAACTGATTCAGTTGTGTTGGAAAAAATAAAGAAATCTGATA

>In-frame_SCD_ENST00000370355_chr10_102116521_+_SEC61A2_ENST00000298428_chr10_12191594_+_2845nt
GTGGTGTCGGTGTCGGCAGCATCCCCGGCGCCCTGCTGCGGTCGCCGCGAGCCTCGGCCTCTGTCTCCTCCCCCTCCCGCCCTTACCTCC
ACGCGGGACCGCCCGCGCCAGTCAACTCCTCGCACTTTGCCCCTGCTTGGCAGCGGATAAAAGGGGGCTGAGGAAATACCGGACACGGTC
ACCCGTTGCCAGCTCTAGCCTTTAAATTCCCGGCTCGGGGACCTCCACGCACCGCGGCTAGCGCCGACAACCAGCTAGCGTGCAAGGCGC
CGCGGCTCAGCGCGTACCGGCGGGCTTCGAAACCGCAGTCCTCCGGCGACCCCGAACTCCGCTCCGGAGCCTCAGCCCCCTGGAAAGTGA
TCCCGGCATCCGAGAGCCAAGATGCCGGCCCACTTGCTGCAGGACGATATCTCTAGCTCCTATACCACCACCACCACCATTACAGCGCCT
CCCTCCAGGGTCCTGCAGAATGGAGGAGATAAGTTGGAGACGATGCCCCTCTACTTGGAAGACGACATTCGCCCTGATATAAAAGATGAT
ATATATGACCCCACCTACAAGGATAAGGAAGGCCCAAGCCCCAAGGTTGAATATGTCTGGAGAAACATCATCCTTATGTCTCTGCTACAC
TTGGGAGCCCTGTATGGGATCACTTTGATTCCTACCTGCAAGTTCTACACCTGGCTTTGGGGGGTATTCTACTATTTTGTCAGTGCCCTG
GGCATAACAGCAGGAGCTCATCGTCTGTGGAGCCACCGCTCTTACAAAGCTCGGCTGCCCCTACGGCTCTTTCTGATCATTGCCAACACA
ATGGCATTCCAGAATGATGTCTATGAATGGGCTCGTGACCACCGTGCCCACCACAAGTTTTCAGAAACACATGCTGATCCTCATAATTCC
CGACGTGGCTTTTTCTTCTCTCACGTGGGTTGGCTGCTTGTGCGCAAACACCCAGCTGTCAAAGAGAAGGGGAGTACGCTAGACTTGTCT
GACCTAGAAGCTGAGAAACTGGTGATGTTCCAGAGGAGGTACTACAAACCTGGCTTGCTGATGATGTGCTTCATCCTGCCCACGCTTGTG
CCCTGGTATTTCTGGGGTGAAACTTTTCAAAACAGTGTGTTCGTTGCCACTTTCTTGCGATATGCTGTGGTGCTTAATGCCACCTGGCTG
GTGAACAGTGCTGCCCACCTCTTCGGATATCGTCCTTATGACAAGAACATTAGCCCCCGGGAGAATATCCTGGTTTCACTTGGAGCTGTG
GGAACTTTAATGGAATTGGGTATCTCCCCAATTGTAACATCTGGTTTGATTATGCAGTTGTTAGCTGGAGCCAAAATCATTGAAGTTGGA
GATACACCGAAAGATAGAGCTTTATTCAATGGAGCCCAGAAACTGTTTGGTATGATCATTACCATTGGGCAAGCCATTGTGTATGTCATG
ACGGGGATGTATGGGGACCCTGCAGAAATGGGTGCCGGAATCTGTCTCCTGATCATCATTCAGTTGTTTGTTGCTGGTTTGATTGTGCTG
CTGTTAGATGAGCTGCTACAGAAGGGTTACGGCTTGGGGTCTGGGATTTCCCTCTTTATTGCCACCAACATCTGTGAGACCATTGTCTGG
AAGGCCTTTAGTCCCACTACCATTAACACTGGCAGAGGTACTGAGTTTGAGGGTGCAGTCATAGCTCTGTTCCATTTGTTGGCCACCAGG
ACGGACAAAGTCCGAGCTTTACGGGAGGCTTTTTATCGGCAGAACTTACCCAATCTCATGAACCTCATTGCTACAGTTTTTGTGTTTGCT
GTTGTTATATATTTCCAAGGATTTCGCGTTGATCTGCCCATTAAGTCGGCCCGTTACCGAGGACAGTACAGCAGCTACCCCATCAAACTC
TTCTACACCTCCAACATCCCCATCATCCTCCAGTCGGCCCTGGTGTCCAACCTGTATGTTATTTCCCAGATGCTGTCTGTTCGATTTAGT
GGCAACTTTTTAGTAAATTTACTAGGACAGTGGGCCGATGTCAGTGGGGGAGGACCCGCACGTTCTTACCCAGTTGGAGGCCTTTGTTAC
TATCTTTCTCCTCCTGAGTCCATGGGCGCCATCTTTGAGGATCCTGTCCATGTCGTTGTTTATATCATCTTCATGTTGGGGTCATGTGCA
TTCTTCTCTAAGACATGGATTGAAGTGTCTGGTTCCTCAGCCAAAGATGTAGCTAAACAGCTGAAAGAACAGCAGATGGTAATGAGGGGC
CACCGAGATACCTCTATGGTTCATGAGCTTAATAGGTACATCCCCACCGCAGCTGCGTTTGGCGGTTTGTGCATTGGCGCCCTGTCAGTG
CTGGCTGACTTCCTGGGGGCCATTGGATCTGGCACTGGAATTCTGCTAGCAGTCACTATTATTTACCAGTATTTTGAAATATTTGTTAAA
GAACAGGCCGAAGTTGGTGGGATGGGTGCTTTGTTTTTCTAAATGTTCAAATATTTCATTTTGTGCGTGTGAAAGGGAAAACACTTTGAC
GGATCGTTTTTGTCAGATGACACTGGTGGCTCCCCTTTTCTCCCCTCACAGTTTCTTGTTTCGAGTGCTGACTGACCCGTTTCTGAAATG
GGCACCGAGCTAAGTCTGTGTGCAGCATTAGTACCCGCTGCCTTAAAACTCAAGTTTACATTATTCATTAAAAAAAGTACATCTAGTGTT
GCCTGTAATGCTGGAAACCAGTGTATCTACCTTGCTGTGTTAAATCATGACAGTGAGACGGTGAGATGGATTCGTTTTGCACACAACATT


Top

FusionGenePPI for SCD_SEC61A2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SCDNEDD4L, ELAVL1, VCP, APP, EGFR, HSD17B12, NSUN5, RPL14, PPP2R1A, RPS3, SLC25A3, UQCRC2, SSR4, VAPB, TCTN2, TCTN3, UBC, TTC30B, TESSEC61A2USP19, CLN3, CFTR, PTPN5, PTPRE, PTPRN, PTPRO


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SCD_SEC61A2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SCD_SEC61A2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSCDC0024667Animal Mammary Neoplasms2CTD_human
HgeneSCDC0024668Mammary Neoplasms, Experimental2CTD_human
HgeneSCDC0023794Lipoidosis1CTD_human
HgeneSCDC0023903Liver neoplasms1CTD_human
HgeneSCDC0339143Thyroid associated opthalmopathies1CTD_human
HgeneSCDC2239176Liver carcinoma1CTD_human