FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3262

FusionGeneSummary for ATP11A_TUBGCP3

check button Fusion gene summary
Fusion gene informationFusion gene name: ATP11A_TUBGCP3
Fusion gene ID: 3262
HgeneTgene
Gene symbol

ATP11A

TUBGCP3

Gene ID

23250

10426

Gene nameATPase phospholipid transporting 11Atubulin gamma complex associated protein 3
SynonymsATPIH|ATPIS104p|ALP6|GCP3|Grip104|SPBC98|Spc98|Spc98p
Cytomap

13q34

13q34

Type of geneprotein-codingprotein-coding
Descriptionprobable phospholipid-transporting ATPase IHATPase, class VI, type 11AP4-ATPase flippase complex alpha subunit ATP11Aphospholipid-translocating ATPasepotential phospholipid-transporting ATPase IHgamma-tubulin complex component 3gamma-ring complex protein 104 kDaspindle pole body protein Spc98 homolog
Modification date2018052320180523
UniProtAcc

P98196

Q96CW5

Ensembl transtripts involved in fusion geneENST00000283558, ENST00000375630, 
ENST00000487903, ENST00000375645, 
ENST00000419448, 
ENST00000261965, 
ENST00000375669, ENST00000462580, 
Fusion gene scores* DoF score12 X 9 X 11=11884 X 4 X 2=32
# samples 205
** MAII scorelog2(20/1188*10)=-2.57046293102604
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/32*10)=0.643856189774725
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ATP11A [Title/Abstract] AND TUBGCP3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-D8-A143-01AATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000283558ENST00000261965ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
In-frameENST00000283558ENST00000375669ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
5CDS-intronENST00000283558ENST00000462580ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
In-frameENST00000375630ENST00000261965ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
In-frameENST00000375630ENST00000375669ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
5CDS-intronENST00000375630ENST00000462580ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
In-frameENST00000487903ENST00000261965ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
In-frameENST00000487903ENST00000375669ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
5CDS-intronENST00000487903ENST00000462580ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
In-frameENST00000375645ENST00000261965ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
In-frameENST00000375645ENST00000375669ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
5CDS-intronENST00000375645ENST00000462580ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
intron-3CDSENST00000419448ENST00000261965ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
intron-3CDSENST00000419448ENST00000375669ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-
intron-intronENST00000419448ENST00000462580ATP11Achr13

113490565

+TUBGCP3chr13

113209319

-

Top

FusionProtFeatures for ATP11A_TUBGCP3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ATP11A

P98196

TUBGCP3

Q96CW5

Catalytic component of a P4-ATPase flippase complexwhich catalyzes the hydrolysis of ATP coupled to the transport ofaminophospholipids from the outer to the inner leaflet of variousmembranes and ensures the maintenance of asymmetric distributionof phospholipids. Phospholipid translocation seems also to beimplicated in vesicle formation and in uptake of lipid signalingmolecules (Probable). May be involved in the uptake offarnesyltransferase inhibitor drugs, such as lonafarnib.{ECO:0000269|PubMed:15860663, ECO:0000305}. Gamma-tubulin complex is necessary for microtubulenucleation at the centrosome.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+1629111_2965681135Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+16291_615681135Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+1629319_3495681135Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+162983_885681135Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+1630111_2965682857Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+16301_615682857Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+1630319_3495682857Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+163083_885682857Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+1630111_2965682878Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+16301_615682878Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+1630319_3495682878Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+163083_885682878Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+1629297_3185681135TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+1629350_3725681135TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+162962_825681135TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+162989_1105681135TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+1630297_3185682857TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+1630350_3725682857TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+163062_825682857TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+163089_1105682857TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+1630297_3185682878TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+1630350_3725682878TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+163062_825682878TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+163089_1105682878TransmembraneHelical
TgeneTUBGCP3chr13:113490565chr13:113209319ENST00000261965-522825_829240908Compositional biasNote=Poly-Glu
TgeneTUBGCP3chr13:113490565chr13:113209319ENST00000375669-521825_829240825Compositional biasNote=Poly-Glu

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+16291024_10295681135Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+16291051_10685681135Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+16291094_11345681135Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+1629373_8815681135Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+1629903_9145681135Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+1629935_9645681135Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+1629987_10005681135Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+16301024_10295682857Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+16301051_10685682857Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+16301094_11345682857Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+1630373_8815682857Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+1630903_9145682857Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+1630935_9645682857Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+1630987_10005682857Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+16301024_10295682878Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+16301051_10685682878Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+16301094_11345682878Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+1630373_8815682878Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+1630903_9145682878Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+1630935_9645682878Topological domainCytoplasmic
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+1630987_10005682878Topological domainExtracellular
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+16291001_10235681135TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+16291030_10505681135TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+16291069_10935681135TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+1629882_9025681135TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+1629915_9345681135TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000283558+1629965_9865681135TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+16301001_10235682857TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+16301030_10505682857TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+16301069_10935682857TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+1630882_9025682857TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+1630915_9345682857TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000375645+1630965_9865682857TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+16301001_10235682878TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+16301030_10505682878TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+16301069_10935682878TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+1630882_9025682878TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+1630915_9345682878TransmembraneHelical
HgeneATP11Achr13:113490565chr13:113209319ENST00000487903+1630965_9865682878TransmembraneHelical


Top

FusionGeneSequence for ATP11A_TUBGCP3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ATP11A_ENST00000283558_chr13_113490565_+_TUBGCP3_ENST00000261965_chr13_113209319_-_1236aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFYFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNYQSKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHN
KIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRK
GGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRK
VLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGD
FIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLR
VFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAAHE
VFLDTIISRCLLDSDSRALLNQLRAVFDQIIELQNAQDAIYRAALEELQRRLQFEEKKKQREIEGQWGVTAAEEEEENKRIGEFKESIPK

>In-frame_ATP11A_ENST00000283558_chr13_113490565_+_TUBGCP3_ENST00000375669_chr13_113209319_-_1153aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFYFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNYQSKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHN
KIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRK
GGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRK
VLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGD
FIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLR
VFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAAHE

>In-frame_ATP11A_ENST00000375630_chr13_113490565_+_TUBGCP3_ENST00000261965_chr13_113209319_-_1236aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFYFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNYQSKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHN
KIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRK
GGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRK
VLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGD
FIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLR
VFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAAHE
VFLDTIISRCLLDSDSRALLNQLRAVFDQIIELQNAQDAIYRAALEELQRRLQFEEKKKQREIEGQWGVTAAEEEEENKRIGEFKESIPK

>In-frame_ATP11A_ENST00000375630_chr13_113490565_+_TUBGCP3_ENST00000375669_chr13_113209319_-_1153aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFYFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNYQSKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHN
KIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRK
GGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRK
VLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGD
FIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLR
VFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAAHE

>In-frame_ATP11A_ENST00000487903_chr13_113490565_+_TUBGCP3_ENST00000261965_chr13_113209319_-_1236aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFYFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNYQSKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHN
KIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRK
GGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRK
VLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGD
FIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLR
VFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAAHE
VFLDTIISRCLLDSDSRALLNQLRAVFDQIIELQNAQDAIYRAALEELQRRLQFEEKKKQREIEGQWGVTAAEEEEENKRIGEFKESIPK

>In-frame_ATP11A_ENST00000487903_chr13_113490565_+_TUBGCP3_ENST00000375669_chr13_113209319_-_1153aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFYFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNYQSKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHN
KIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRK
GGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRK
VLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGD
FIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLR
VFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAAHE

>In-frame_ATP11A_ENST00000375645_chr13_113490565_+_TUBGCP3_ENST00000261965_chr13_113209319_-_1236aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFYFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNYQSKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHN
KIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRK
GGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRK
VLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGD
FIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLR
VFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAAHE
VFLDTIISRCLLDSDSRALLNQLRAVFDQIIELQNAQDAIYRAALEELQRRLQFEEKKKQREIEGQWGVTAAEEEEENKRIGEFKESIPK

>In-frame_ATP11A_ENST00000375645_chr13_113490565_+_TUBGCP3_ENST00000375669_chr13_113209319_-_1153aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFYFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNYQSKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHN
KIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRK
GGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRK
VLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGD
FIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLR
VFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAAHE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ATP11A_ENST00000283558_chr13_113490565_+_TUBGCP3_ENST00000261965_chr13_113209319_-_3708nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACT
ATGGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAA
AATTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAAT
AAAATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTC
AGAGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTA
ACACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAA
GGAGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTG
TCTCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCA
ACAGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAG
GTCCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCT
GCAGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGC
AAATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGAC
TTTATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAA
ACCGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGAC
ACTGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGA
GTATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGA
AACATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATC
ACATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAG
GTGTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATT
ATTGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAG
CGTGAAATTGAGGGCCAGTGGGGAGTGACGGCAGCAGAGGAAGAGGAGGAAAATAAGAGGATTGGAGAATTTAAAGAATCTATACCAAAA
ATGTGCTCACAGTTGCGAATATTGACCCATTTCTACCAGGGTATCGTGCAGCAGTTTTTGGTGTTACTGACGACCAGCTCTGACGAGAGT
CTTCGGTTTCTTAGCTTCAGGCTGGACTTCAACGAGCATTACAAAGCCAGGGAGCCCAGGCTCCGTGTGTCTCTGGGTACCAGGGGGCGG

>In-frame_ATP11A_ENST00000283558_chr13_113490565_+_TUBGCP3_ENST00000375669_chr13_113209319_-_3459nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACT
ATGGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAA
AATTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAAT
AAAATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTC
AGAGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTA
ACACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAA
GGAGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTG
TCTCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCA
ACAGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAG
GTCCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCT
GCAGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGC
AAATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGAC
TTTATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAA
ACCGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGAC
ACTGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGA
GTATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGA
AACATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATC
ACATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAG
GTGTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATT
ATTGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAG

>In-frame_ATP11A_ENST00000375630_chr13_113490565_+_TUBGCP3_ENST00000261965_chr13_113209319_-_3708nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACT
ATGGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAA
AATTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAAT
AAAATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTC
AGAGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTA
ACACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAA
GGAGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTG
TCTCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCA
ACAGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAG
GTCCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCT
GCAGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGC
AAATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGAC
TTTATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAA
ACCGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGAC
ACTGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGA
GTATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGA
AACATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATC
ACATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAG
GTGTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATT
ATTGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAG
CGTGAAATTGAGGGCCAGTGGGGAGTGACGGCAGCAGAGGAAGAGGAGGAAAATAAGAGGATTGGAGAATTTAAAGAATCTATACCAAAA
ATGTGCTCACAGTTGCGAATATTGACCCATTTCTACCAGGGTATCGTGCAGCAGTTTTTGGTGTTACTGACGACCAGCTCTGACGAGAGT
CTTCGGTTTCTTAGCTTCAGGCTGGACTTCAACGAGCATTACAAAGCCAGGGAGCCCAGGCTCCGTGTGTCTCTGGGTACCAGGGGGCGG

>In-frame_ATP11A_ENST00000375630_chr13_113490565_+_TUBGCP3_ENST00000375669_chr13_113209319_-_3459nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACT
ATGGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAA
AATTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAAT
AAAATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTC
AGAGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTA
ACACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAA
GGAGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTG
TCTCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCA
ACAGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAG
GTCCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCT
GCAGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGC
AAATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGAC
TTTATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAA
ACCGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGAC
ACTGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGA
GTATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGA
AACATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATC
ACATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAG
GTGTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATT
ATTGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAG

>In-frame_ATP11A_ENST00000487903_chr13_113490565_+_TUBGCP3_ENST00000261965_chr13_113209319_-_3708nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACT
ATGGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAA
AATTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAAT
AAAATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTC
AGAGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTA
ACACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAA
GGAGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTG
TCTCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCA
ACAGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAG
GTCCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCT
GCAGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGC
AAATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGAC
TTTATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAA
ACCGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGAC
ACTGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGA
GTATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGA
AACATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATC
ACATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAG
GTGTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATT
ATTGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAG
CGTGAAATTGAGGGCCAGTGGGGAGTGACGGCAGCAGAGGAAGAGGAGGAAAATAAGAGGATTGGAGAATTTAAAGAATCTATACCAAAA
ATGTGCTCACAGTTGCGAATATTGACCCATTTCTACCAGGGTATCGTGCAGCAGTTTTTGGTGTTACTGACGACCAGCTCTGACGAGAGT
CTTCGGTTTCTTAGCTTCAGGCTGGACTTCAACGAGCATTACAAAGCCAGGGAGCCCAGGCTCCGTGTGTCTCTGGGTACCAGGGGGCGG

>In-frame_ATP11A_ENST00000487903_chr13_113490565_+_TUBGCP3_ENST00000375669_chr13_113209319_-_3459nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACT
ATGGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAA
AATTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAAT
AAAATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTC
AGAGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTA
ACACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAA
GGAGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTG
TCTCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCA
ACAGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAG
GTCCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCT
GCAGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGC
AAATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGAC
TTTATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAA
ACCGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGAC
ACTGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGA
GTATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGA
AACATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATC
ACATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAG
GTGTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATT
ATTGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAG

>In-frame_ATP11A_ENST00000375645_chr13_113490565_+_TUBGCP3_ENST00000261965_chr13_113209319_-_3708nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACT
ATGGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAA
AATTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAAT
AAAATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTC
AGAGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTA
ACACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAA
GGAGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTG
TCTCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCA
ACAGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAG
GTCCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCT
GCAGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGC
AAATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGAC
TTTATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAA
ACCGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGAC
ACTGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGA
GTATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGA
AACATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATC
ACATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAG
GTGTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATT
ATTGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAG
CGTGAAATTGAGGGCCAGTGGGGAGTGACGGCAGCAGAGGAAGAGGAGGAAAATAAGAGGATTGGAGAATTTAAAGAATCTATACCAAAA
ATGTGCTCACAGTTGCGAATATTGACCCATTTCTACCAGGGTATCGTGCAGCAGTTTTTGGTGTTACTGACGACCAGCTCTGACGAGAGT
CTTCGGTTTCTTAGCTTCAGGCTGGACTTCAACGAGCATTACAAAGCCAGGGAGCCCAGGCTCCGTGTGTCTCTGGGTACCAGGGGGCGG

>In-frame_ATP11A_ENST00000375645_chr13_113490565_+_TUBGCP3_ENST00000375669_chr13_113209319_-_3459nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACT
ATGGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAA
AATTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAAT
AAAATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTC
AGAGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTA
ACACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAA
GGAGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTG
TCTCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCA
ACAGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAG
GTCCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCT
GCAGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGC
AAATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGAC
TTTATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAA
ACCGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGAC
ACTGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGA
GTATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGA
AACATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATC
ACATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAG
GTGTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATT
ATTGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ATP11A_ENST00000283558_chr13_113490565_+_TUBGCP3_ENST00000261965_chr13_113209319_-_4778nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACTAT
GGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAAAA
TTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAATAA
AATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTCAG
AGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTAAC
ACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAAGG
AGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTGTC
TCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCAAC
AGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAGGT
CCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCTGC
AGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGCAA
ATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGACTT
TATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAAAC
CGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGACAC
TGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGAGT
ATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGAAA
CATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATCAC
ATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAGGT
GTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATTAT
TGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAGCG
TGAAATTGAGGGCCAGTGGGGAGTGACGGCAGCAGAGGAAGAGGAGGAAAATAAGAGGATTGGAGAATTTAAAGAATCTATACCAAAAAT
GTGCTCACAGTTGCGAATATTGACCCATTTCTACCAGGGTATCGTGCAGCAGTTTTTGGTGTTACTGACGACCAGCTCTGACGAGAGTCT
TCGGTTTCTTAGCTTCAGGCTGGACTTCAACGAGCATTACAAAGCCAGGGAGCCCAGGCTCCGTGTGTCTCTGGGTACCAGGGGGCGGCG
CAGCTCCCACACGTGAAGCTCGCGGTCCTCCCAGGGAGCTGCGGGTGATGTTCGTTGCACTGCTAGACACGAAATTCCCATTGACGTCCT
GCAGGAACTGCATGCTGCAGGTGTCCTGCCCTTCCGCCCACGAGTGCGCCATGTTTCAGCGGAGCGGCGTGTGGGAGAAGCCACGTCGTG
TTTCACATGTCGGAGTCGAATGCATTTGTAAATCCCTAAGTCAAGTAGGCTGGCTGCACTGTTCACATTTGTCTCTAAAAGTCTTCATCG
CTAAAAGATACCATAATTTGCTGAGGCTTCTTAAGCTTTCTATGTTATAATTTATATTTGTCACTTTAAAAAATCCATTTCTTTTAGAAA
AAATTAGGGTGATAGGATATTCATTAGTTAAGATGGTAACGTCATTGCTATTTTTTTAACATCCTCTTTAGAGGTAATTTTTGTTAACAT
AACCAAAAATTAAATTGAAACAAAATGTCCCAACTAAGAAAATATATAGAGCATTTTATTTTTTTTTAGTGTTGTAAAATATTAACCTCT
GTGAGATCCTTTGTATCTTAATGCATTACCTTTACACATATTTATTCTTATTTTCTCTCCTTTCAGAGTTTACATTTTTATATTTAATTT
ACTATTTCAGATTTTTAAAATAGTATAGAAAAAAGTAGGAGTGATAGAGAACAAAAATACTCTTATACAGTGCAACCCAAATACCGCGAA
TGCATCAGCTAAAGCAGCGTGTAAATAGGAGTGACGAGAAAGTTAATGGAGTATTTTATTTTCAAAGTTCCTGATAAGCATTGGAAAGAA
ATCGACATGGATAATGAAGATTTCCTTTTTCCTTGCCTATTTTTTCATTGTAAATATTTATATACTACTGACCAAGATGTTGGGGTGGGG
GGGATTGTTTTTTGTAAAAATGTCATTATCAGGTCACATAAATCTGCCTTTATGTTGCATAAGTGAAAATTTAGAAAATTAAAAGCAATT

>In-frame_ATP11A_ENST00000283558_chr13_113490565_+_TUBGCP3_ENST00000375669_chr13_113209319_-_3648nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACTAT
GGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAAAA
TTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAATAA
AATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTCAG
AGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTAAC
ACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAAGG
AGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTGTC
TCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCAAC
AGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAGGT
CCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCTGC
AGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGCAA
ATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGACTT
TATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAAAC
CGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGACAC
TGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGAGT
ATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGAAA
CATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATCAC
ATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAGGT
GTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATTAT
TGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAGCG
TGAAATTGAGGTTGAGATGTGCCTATACTGCGTTTGAAGTCCCGAGAAATCACTGACAGTTGTAAAGAGGGAGGGGCCACCCTCACTGGC

>In-frame_ATP11A_ENST00000375630_chr13_113490565_+_TUBGCP3_ENST00000261965_chr13_113209319_-_4778nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACTAT
GGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAAAA
TTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAATAA
AATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTCAG
AGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTAAC
ACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAAGG
AGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTGTC
TCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCAAC
AGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAGGT
CCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCTGC
AGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGCAA
ATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGACTT
TATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAAAC
CGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGACAC
TGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGAGT
ATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGAAA
CATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATCAC
ATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAGGT
GTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATTAT
TGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAGCG
TGAAATTGAGGGCCAGTGGGGAGTGACGGCAGCAGAGGAAGAGGAGGAAAATAAGAGGATTGGAGAATTTAAAGAATCTATACCAAAAAT
GTGCTCACAGTTGCGAATATTGACCCATTTCTACCAGGGTATCGTGCAGCAGTTTTTGGTGTTACTGACGACCAGCTCTGACGAGAGTCT
TCGGTTTCTTAGCTTCAGGCTGGACTTCAACGAGCATTACAAAGCCAGGGAGCCCAGGCTCCGTGTGTCTCTGGGTACCAGGGGGCGGCG
CAGCTCCCACACGTGAAGCTCGCGGTCCTCCCAGGGAGCTGCGGGTGATGTTCGTTGCACTGCTAGACACGAAATTCCCATTGACGTCCT
GCAGGAACTGCATGCTGCAGGTGTCCTGCCCTTCCGCCCACGAGTGCGCCATGTTTCAGCGGAGCGGCGTGTGGGAGAAGCCACGTCGTG
TTTCACATGTCGGAGTCGAATGCATTTGTAAATCCCTAAGTCAAGTAGGCTGGCTGCACTGTTCACATTTGTCTCTAAAAGTCTTCATCG
CTAAAAGATACCATAATTTGCTGAGGCTTCTTAAGCTTTCTATGTTATAATTTATATTTGTCACTTTAAAAAATCCATTTCTTTTAGAAA
AAATTAGGGTGATAGGATATTCATTAGTTAAGATGGTAACGTCATTGCTATTTTTTTAACATCCTCTTTAGAGGTAATTTTTGTTAACAT
AACCAAAAATTAAATTGAAACAAAATGTCCCAACTAAGAAAATATATAGAGCATTTTATTTTTTTTTAGTGTTGTAAAATATTAACCTCT
GTGAGATCCTTTGTATCTTAATGCATTACCTTTACACATATTTATTCTTATTTTCTCTCCTTTCAGAGTTTACATTTTTATATTTAATTT
ACTATTTCAGATTTTTAAAATAGTATAGAAAAAAGTAGGAGTGATAGAGAACAAAAATACTCTTATACAGTGCAACCCAAATACCGCGAA
TGCATCAGCTAAAGCAGCGTGTAAATAGGAGTGACGAGAAAGTTAATGGAGTATTTTATTTTCAAAGTTCCTGATAAGCATTGGAAAGAA
ATCGACATGGATAATGAAGATTTCCTTTTTCCTTGCCTATTTTTTCATTGTAAATATTTATATACTACTGACCAAGATGTTGGGGTGGGG
GGGATTGTTTTTTGTAAAAATGTCATTATCAGGTCACATAAATCTGCCTTTATGTTGCATAAGTGAAAATTTAGAAAATTAAAAGCAATT

>In-frame_ATP11A_ENST00000375630_chr13_113490565_+_TUBGCP3_ENST00000375669_chr13_113209319_-_3648nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACTAT
GGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAAAA
TTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAATAA
AATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTCAG
AGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTAAC
ACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAAGG
AGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTGTC
TCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCAAC
AGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAGGT
CCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCTGC
AGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGCAA
ATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGACTT
TATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAAAC
CGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGACAC
TGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGAGT
ATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGAAA
CATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATCAC
ATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAGGT
GTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATTAT
TGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAGCG
TGAAATTGAGGTTGAGATGTGCCTATACTGCGTTTGAAGTCCCGAGAAATCACTGACAGTTGTAAAGAGGGAGGGGCCACCCTCACTGGC

>In-frame_ATP11A_ENST00000487903_chr13_113490565_+_TUBGCP3_ENST00000261965_chr13_113209319_-_4778nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACTAT
GGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAAAA
TTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAATAA
AATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTCAG
AGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTAAC
ACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAAGG
AGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTGTC
TCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCAAC
AGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAGGT
CCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCTGC
AGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGCAA
ATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGACTT
TATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAAAC
CGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGACAC
TGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGAGT
ATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGAAA
CATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATCAC
ATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAGGT
GTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATTAT
TGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAGCG
TGAAATTGAGGGCCAGTGGGGAGTGACGGCAGCAGAGGAAGAGGAGGAAAATAAGAGGATTGGAGAATTTAAAGAATCTATACCAAAAAT
GTGCTCACAGTTGCGAATATTGACCCATTTCTACCAGGGTATCGTGCAGCAGTTTTTGGTGTTACTGACGACCAGCTCTGACGAGAGTCT
TCGGTTTCTTAGCTTCAGGCTGGACTTCAACGAGCATTACAAAGCCAGGGAGCCCAGGCTCCGTGTGTCTCTGGGTACCAGGGGGCGGCG
CAGCTCCCACACGTGAAGCTCGCGGTCCTCCCAGGGAGCTGCGGGTGATGTTCGTTGCACTGCTAGACACGAAATTCCCATTGACGTCCT
GCAGGAACTGCATGCTGCAGGTGTCCTGCCCTTCCGCCCACGAGTGCGCCATGTTTCAGCGGAGCGGCGTGTGGGAGAAGCCACGTCGTG
TTTCACATGTCGGAGTCGAATGCATTTGTAAATCCCTAAGTCAAGTAGGCTGGCTGCACTGTTCACATTTGTCTCTAAAAGTCTTCATCG
CTAAAAGATACCATAATTTGCTGAGGCTTCTTAAGCTTTCTATGTTATAATTTATATTTGTCACTTTAAAAAATCCATTTCTTTTAGAAA
AAATTAGGGTGATAGGATATTCATTAGTTAAGATGGTAACGTCATTGCTATTTTTTTAACATCCTCTTTAGAGGTAATTTTTGTTAACAT
AACCAAAAATTAAATTGAAACAAAATGTCCCAACTAAGAAAATATATAGAGCATTTTATTTTTTTTTAGTGTTGTAAAATATTAACCTCT
GTGAGATCCTTTGTATCTTAATGCATTACCTTTACACATATTTATTCTTATTTTCTCTCCTTTCAGAGTTTACATTTTTATATTTAATTT
ACTATTTCAGATTTTTAAAATAGTATAGAAAAAAGTAGGAGTGATAGAGAACAAAAATACTCTTATACAGTGCAACCCAAATACCGCGAA
TGCATCAGCTAAAGCAGCGTGTAAATAGGAGTGACGAGAAAGTTAATGGAGTATTTTATTTTCAAAGTTCCTGATAAGCATTGGAAAGAA
ATCGACATGGATAATGAAGATTTCCTTTTTCCTTGCCTATTTTTTCATTGTAAATATTTATATACTACTGACCAAGATGTTGGGGTGGGG
GGGATTGTTTTTTGTAAAAATGTCATTATCAGGTCACATAAATCTGCCTTTATGTTGCATAAGTGAAAATTTAGAAAATTAAAAGCAATT

>In-frame_ATP11A_ENST00000487903_chr13_113490565_+_TUBGCP3_ENST00000375669_chr13_113209319_-_3648nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACTAT
GGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAAAA
TTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAATAA
AATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTCAG
AGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTAAC
ACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAAGG
AGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTGTC
TCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCAAC
AGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAGGT
CCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCTGC
AGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGCAA
ATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGACTT
TATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAAAC
CGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGACAC
TGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGAGT
ATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGAAA
CATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATCAC
ATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAGGT
GTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATTAT
TGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAGCG
TGAAATTGAGGTTGAGATGTGCCTATACTGCGTTTGAAGTCCCGAGAAATCACTGACAGTTGTAAAGAGGGAGGGGCCACCCTCACTGGC

>In-frame_ATP11A_ENST00000375645_chr13_113490565_+_TUBGCP3_ENST00000261965_chr13_113209319_-_4778nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACTAT
GGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAAAA
TTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAATAA
AATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTCAG
AGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTAAC
ACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAAGG
AGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTGTC
TCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCAAC
AGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAGGT
CCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCTGC
AGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGCAA
ATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGACTT
TATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAAAC
CGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGACAC
TGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGAGT
ATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGAAA
CATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATCAC
ATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAGGT
GTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATTAT
TGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAGCG
TGAAATTGAGGGCCAGTGGGGAGTGACGGCAGCAGAGGAAGAGGAGGAAAATAAGAGGATTGGAGAATTTAAAGAATCTATACCAAAAAT
GTGCTCACAGTTGCGAATATTGACCCATTTCTACCAGGGTATCGTGCAGCAGTTTTTGGTGTTACTGACGACCAGCTCTGACGAGAGTCT
TCGGTTTCTTAGCTTCAGGCTGGACTTCAACGAGCATTACAAAGCCAGGGAGCCCAGGCTCCGTGTGTCTCTGGGTACCAGGGGGCGGCG
CAGCTCCCACACGTGAAGCTCGCGGTCCTCCCAGGGAGCTGCGGGTGATGTTCGTTGCACTGCTAGACACGAAATTCCCATTGACGTCCT
GCAGGAACTGCATGCTGCAGGTGTCCTGCCCTTCCGCCCACGAGTGCGCCATGTTTCAGCGGAGCGGCGTGTGGGAGAAGCCACGTCGTG
TTTCACATGTCGGAGTCGAATGCATTTGTAAATCCCTAAGTCAAGTAGGCTGGCTGCACTGTTCACATTTGTCTCTAAAAGTCTTCATCG
CTAAAAGATACCATAATTTGCTGAGGCTTCTTAAGCTTTCTATGTTATAATTTATATTTGTCACTTTAAAAAATCCATTTCTTTTAGAAA
AAATTAGGGTGATAGGATATTCATTAGTTAAGATGGTAACGTCATTGCTATTTTTTTAACATCCTCTTTAGAGGTAATTTTTGTTAACAT
AACCAAAAATTAAATTGAAACAAAATGTCCCAACTAAGAAAATATATAGAGCATTTTATTTTTTTTTAGTGTTGTAAAATATTAACCTCT
GTGAGATCCTTTGTATCTTAATGCATTACCTTTACACATATTTATTCTTATTTTCTCTCCTTTCAGAGTTTACATTTTTATATTTAATTT
ACTATTTCAGATTTTTAAAATAGTATAGAAAAAAGTAGGAGTGATAGAGAACAAAAATACTCTTATACAGTGCAACCCAAATACCGCGAA
TGCATCAGCTAAAGCAGCGTGTAAATAGGAGTGACGAGAAAGTTAATGGAGTATTTTATTTTCAAAGTTCCTGATAAGCATTGGAAAGAA
ATCGACATGGATAATGAAGATTTCCTTTTTCCTTGCCTATTTTTTCATTGTAAATATTTATATACTACTGACCAAGATGTTGGGGTGGGG
GGGATTGTTTTTTGTAAAAATGTCATTATCAGGTCACATAAATCTGCCTTTATGTTGCATAAGTGAAAATTTAGAAAATTAAAAGCAATT

>In-frame_ATP11A_ENST00000375645_chr13_113490565_+_TUBGCP3_ENST00000375669_chr13_113209319_-_3648nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGTACTAT
GGAAATTACAGAAGCAGCTCTGGTAAGGGACATTTTGTACGTCTTTCAGGGCATAGATGGCAAAAACATCAAAATGAACAACACTGAAAA
TTGTTACAAAGTAGAAGGAAAGGCAAATCTAAGTAGGTCTTTGAGAGACACAGCAGTCAGGCTTTCTGAGTTGGGATGGTTGCATAATAA
AATCAGAAGATACACGGACCAGAGGAGCCTGGACCGCTCATTCGGACTCGTCGGGCAGAGCTTTTGTGCTGCCTTGCACCAGGAACTCAG
AGAATACTATCGATTGCTCTCTGTTTTACATTCTCAGCTACAACTAGAGGATGACCAGGGTGTGAATTTGGGACTTGAGAGTAGTTTAAC
ACTTCGGCGCCTCCTGGTTTGGACCTATGATCCCAAAATACGACTGAAGACCCTTGCGGCCCTAGTGGACCACTGCCAAGGAAGGAAAGG
AGGTGAGCTGGCCTCAGCTGTCCACGCCTACACAAAAACAGGAGACCCGTACATGCGGTCTCTGGTGCAGCACATCCTCAGCCTCGTGTC
TCATCCTGTTTTGAGCTTCCTGTACCGCTGGATATATGATGGGGAGCTTGAGGACACTTACCACGAATTTTTTGTAGCATCAGATCCAAC
AGTTAAAACAGATCGACTGTGGCACGACAAGTATACTTTGAGGAAATCGATGATTCCTTCGTTTATGACGATGGATCAGTCTAGGAAGGT
CCTTTTGATAGGAAAATCAATAAATTTCTTGCACCAAGTTTGTCATGATCAGACTCCCACTACAAAGATGATAGCTGTGACCAAGTCTGC
AGAGTCACCCCAGGACGCTGCAGACCTATTCACAGACTTGGAAAATGCATTTCAGGGGAAGATTGATGCTGCTTATTTTGAGACCAGCAA
ATACCTGTTGGATGTTCTCAATAAAAAGTACAGCTTGCTGGACCACATGCAGGCAATGAGGCGGTACCTGCTTCTTGGTCAAGGAGACTT
TATAAGGCACTTAATGGACTTGCTAAAACCAGAACTTGTCCGTCCAGCTACGACTTTGTATCAGCATAACTTGACTGGAATTCTAGAAAC
CGCTGTCAGAGCCACCAACGCACAGTTTGACAGTCCTGAGATCCTGCGAAGGCTGGACGTGCGGCTGCTGGAGGTCTCTCCAGGTGACAC
TGGATGGGATGTCTTCAGCCTCGATTATCATGTTGACGGACCAATTGCAACTGTGTTTACTCGAGAATGTATGAGCCACTACCTAAGAGT
ATTTAACTTCCTCTGGAGGGCGAAGCGGATGGAATACATCCTCACTGACATACGGAAGGGACACATGTGCAATGCAAAGCTCCTGAGAAA
CATGCCAGAGTTCTCCGGGGTGCTGCACCAGTGTCACATTTTGGCCTCTGAGATGGTCCATTTCATTCATCAGATGCAGTATTACATCAC
ATTTGAGGTGCTTGAATGTTCTTGGGATGAGCTTTGGAACAAAGTCCAGCAGGCCCAGGATTTGGATCACATCATTGCTGCACACGAGGT
GTTCTTAGACACCATCATCTCCCGCTGCCTGCTGGACAGTGACTCCAGGGCACTTTTAAATCAACTTAGAGCTGTGTTTGATCAAATTAT
TGAACTTCAGAATGCTCAAGATGCAATATACAGAGCTGCTCTGGAAGAATTGCAGAGACGATTACAGTTTGAAGAGAAAAAGAAACAGCG
TGAAATTGAGGTTGAGATGTGCCTATACTGCGTTTGAAGTCCCGAGAAATCACTGACAGTTGTAAAGAGGGAGGGGCCACCCTCACTGGC


Top

FusionGenePPI for ATP11A_TUBGCP3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ATP11ATMEM30A, NPDC1, PICK1, TRIM25TUBGCP3AKAP9, PCNT, BTRC, FBXW11, IMMT, ELAVL1, SH3KBP1, CDK5RAP2, TUBG1, TUBGCP5, TUBGCP2, HECW2, ACSL4, ACTB, AKAP12, ANKRD40, PRRC2A, MZT1, SDE2, CAPNS1, CEP170, CEP55, CPNE7, CTPS1, TUBB, RPS18, HSPA1A, DDX5, DGCR14, DOCK7, DYNC1I2, EIF4E2, EPPK1, FABP5, MRPS18B, RCN2, RPL24, RPL23, MZT2A, MZT2B, GIGYF2, HAX1, RPL27AP6, HECTD1, HNRNPA1, HNRNPH1, HNRNPU, HSP90AB1, HSPA5, HSPA8, HSPD1, IGF2BP1, IGF2BP3, ANXA5, IQGAP1, IRS4, KLC2, LGALS3BP, LY6G5B, MAGED2, MARCKS, MRPS14, MRPS2, MRPS21, MRPS23, MRPS25, MRPS28, MRPS7, MTMR1, NEDD1, NME7, PCBP1, PCID2, CDK17, PPIL1, PPP3CB, PRICKLE3, PRPF19, PSMA1, PSME3, RBBP4, RPL11, RPL23A, RPL26, RPL31, RPL37A, RPL8, RPS10, RPS14, RPS15, RPS17, RPS2, RPS25, RPS26P11, RPS27, RPS3, RPS4X, RPS6, RPS7, RPS8, RPS9, S100A8, SCO2, SEC61G, SKP1, SNW1, SUPT6H, TUBA1A, TUBB4B, TUBGCP4, TUBGCP6, UBR4, UBR5, UGGT1, DCAF8, RPL10, YWHAQ, SHMT2, MOV10, NXF1, LPAR6, VSIG4, ANXA13, SCN2B, LYPD6, NTRK1, CNTRL, XPO1, SCAF11, LRWD1, CDC5L, DPPA4, NANOG, POU5F1, TUBG2, TXNDC12, APLNR, CD79B, OPRM1, SIGLEC12, GYPB, SIGLECL1, CD2BP2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ATP11A_TUBGCP3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ATP11A_TUBGCP3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneATP11AC1800706Idiopathic Pulmonary Fibrosis1CTD_human;ORPHANET