FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32564

FusionGeneSummary for SAMD11_PROZ

check button Fusion gene summary
Fusion gene informationFusion gene name: SAMD11_PROZ
Fusion gene ID: 32564
HgeneTgene
Gene symbol

SAMD11

PROZ

Gene ID

148398

8858

Gene namesterile alpha motif domain containing 11protein Z, vitamin K dependent plasma glycoprotein
SynonymsMRSPZ
Cytomap

1p36.33

13q34

Type of geneprotein-codingprotein-coding
Descriptionsterile alpha motif domain-containing protein 11SAM domain-containing protein 11vitamin K-dependent protein Zvitamin K-dependent protein Z precursor variant 1
Modification date2018051920180523
UniProtAcc

Q96NU1

P22891

Ensembl transtripts involved in fusion geneENST00000342066, ENST00000478729, 
ENST00000342783, ENST00000375547, 
ENST00000493630, 
Fusion gene scores* DoF score3 X 3 X 2=181 X 1 X 1=1
# samples 31
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: SAMD11 [Title/Abstract] AND PROZ [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-KF-A41W-01ASAMD11chr1

861393

+PROZchr13

113824727

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000342066ENST00000342783SAMD11chr1

861393

+PROZchr13

113824727

+
In-frameENST00000342066ENST00000375547SAMD11chr1

861393

+PROZchr13

113824727

+
5CDS-3UTRENST00000342066ENST00000493630SAMD11chr1

861393

+PROZchr13

113824727

+
intron-3CDSENST00000478729ENST00000342783SAMD11chr1

861393

+PROZchr13

113824727

+
intron-3CDSENST00000478729ENST00000375547SAMD11chr1

861393

+PROZchr13

113824727

+
intron-3UTRENST00000478729ENST00000493630SAMD11chr1

861393

+PROZchr13

113824727

+

Top

FusionProtFeatures for SAMD11_PROZ


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SAMD11

Q96NU1

PROZ

P22891

Appears to assist hemostasis by binding thrombin andpromoting its association with phospholipid vesicles. Inhibitsactivity of the coagulation protease factor Xa in the presence ofSERPINA10, calcium and phospholipids.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSAMD11chr1:861393chr13:113824727ENST00000342066+214543_60824682DomainSAM
TgenePROZchr1:861393chr13:113824727ENST00000342783+69125_166213423DomainEGF-like 2
TgenePROZchr1:861393chr13:113824727ENST00000342783+69175_400213423DomainPeptidase S1
TgenePROZchr1:861393chr13:113824727ENST00000342783+6941_86213423DomainGla
TgenePROZchr1:861393chr13:113824727ENST00000342783+6987_123213423DomainEGF-like 1
TgenePROZchr1:861393chr13:113824727ENST00000375547+58125_166191401DomainEGF-like 2
TgenePROZchr1:861393chr13:113824727ENST00000375547+58175_400191401DomainPeptidase S1
TgenePROZchr1:861393chr13:113824727ENST00000375547+5841_86191401DomainGla
TgenePROZchr1:861393chr13:113824727ENST00000375547+5887_123191401DomainEGF-like 1


Top

FusionGeneSequence for SAMD11_PROZ


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SAMD11_ENST00000342066_chr1_861393_+_PROZ_ENST00000342783_chr13_113824727_+_234aa
MSKGILQVHPPICDCPGCRISSPVVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTTFNRTSQDPLMIKITHVHVHMRTDADA
GENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVA

>In-frame_SAMD11_ENST00000342066_chr1_861393_+_PROZ_ENST00000375547_chr13_113824727_+_234aa
MSKGILQVHPPICDCPGCRISSPVVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTTFNRTSQDPLMIKITHVHVHMRTDADA
GENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SAMD11_ENST00000342066_chr1_861393_+_PROZ_ENST00000342783_chr13_113824727_+_702nt
ATGTCCAAGGGGATCCTGCAGGTGCATCCTCCGATCTGCGACTGCCCGGGCTGCCGAATATCCTCCCCGGTGGTAAAGTTAACAAATTCC
GAAGGAAAAGACTTCTGTGGTGGTGTTATAATACGGGAAAATTTTGTACTGACAACAGCAAAATGTTCACTGTTACACAGGAATATTACT
GTAAAAACATATTTTAACAGAACGAGCCAAGACCCGCTGATGATCAAGATAACGCACGTCCATGTGCACATGCGGTATGACGCGGACGCG
GGGGAGAATGACCTGTCACTGCTGGAGCTGGAGTGGCCCATCCAGTGCCCAGGTGCGGGGCTCCCCGTGTGCACCCCTGAGAAAGACTTC
GCTGAGCACCTCCTCATCCCACGCACCAGGGGCCTCCTCAGCGGCTGGGCACGCAATGGCACTGACCTGGGCAACTCGCTGACCACGCGG
CCTGTCACACTTGTGGAGGGGGAGGAGTGCGGGCAGGTCCTGAATGTGACTGTCACCACCAGGACCTACTGTGAGAGAAGCAGCGTGGCG
GCCATGCACTGGATGGATGGAAGTGTGGTCACCAGAGAACACAGAGGCTCCTGGTTTCTCACGGGGGTCCTGGGCTCGCAGCCAGTAGGA

>In-frame_SAMD11_ENST00000342066_chr1_861393_+_PROZ_ENST00000375547_chr13_113824727_+_702nt
ATGTCCAAGGGGATCCTGCAGGTGCATCCTCCGATCTGCGACTGCCCGGGCTGCCGAATATCCTCCCCGGTGGTAAAGTTAACAAATTCC
GAAGGAAAAGACTTCTGTGGTGGTGTTATAATACGGGAAAATTTTGTACTGACAACAGCAAAATGTTCACTGTTACACAGGAATATTACT
GTAAAAACATATTTTAACAGAACGAGCCAAGACCCGCTGATGATCAAGATAACGCACGTCCATGTGCACATGCGGTATGACGCGGACGCG
GGGGAGAATGACCTGTCACTGCTGGAGCTGGAGTGGCCCATCCAGTGCCCAGGTGCGGGGCTCCCCGTGTGCACCCCTGAGAAAGACTTC
GCTGAGCACCTCCTCATCCCACGCACCAGGGGCCTCCTCAGCGGCTGGGCACGCAATGGCACTGACCTGGGCAACTCGCTGACCACGCGG
CCTGTCACACTTGTGGAGGGGGAGGAGTGCGGGCAGGTCCTGAATGTGACTGTCACCACCAGGACCTACTGTGAGAGAAGCAGCGTGGCG
GCCATGCACTGGATGGATGGAAGTGTGGTCACCAGAGAACACAGAGGCTCCTGGTTTCTCACGGGGGTCCTGGGCTCGCAGCCAGTAGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_SAMD11_ENST00000342066_chr1_861393_+_PROZ_ENST00000342783_chr13_113824727_+_1060nt
CCAGCAGATCCCTGCGGCGTTCGCGAGGGTGGGACGGGAAGCGGGCTGGGAAGTCGGGCCGAGGGAAAAGTCTGAAGACGCTTATGTCCA
AGGGGATCCTGCAGGTGCATCCTCCGATCTGCGACTGCCCGGGCTGCCGAATATCCTCCCCGGTGGTAAAGTTAACAAATTCCGAAGGAA
AAGACTTCTGTGGTGGTGTTATAATACGGGAAAATTTTGTACTGACAACAGCAAAATGTTCACTGTTACACAGGAATATTACTGTAAAAA
CATATTTTAACAGAACGAGCCAAGACCCGCTGATGATCAAGATAACGCACGTCCATGTGCACATGCGGTATGACGCGGACGCGGGGGAGA
ATGACCTGTCACTGCTGGAGCTGGAGTGGCCCATCCAGTGCCCAGGTGCGGGGCTCCCCGTGTGCACCCCTGAGAAAGACTTCGCTGAGC
ACCTCCTCATCCCACGCACCAGGGGCCTCCTCAGCGGCTGGGCACGCAATGGCACTGACCTGGGCAACTCGCTGACCACGCGGCCTGTCA
CACTTGTGGAGGGGGAGGAGTGCGGGCAGGTCCTGAATGTGACTGTCACCACCAGGACCTACTGTGAGAGAAGCAGCGTGGCGGCCATGC
ACTGGATGGATGGAAGTGTGGTCACCAGAGAACACAGAGGCTCCTGGTTTCTCACGGGGGTCCTGGGCTCGCAGCCAGTAGGAGGGCAGG
CTCACATGGTCCTTGTCACCAAGGTCTCCAGGTACTCACTCTGGTTTAAACAGATCATGAACTAACTGAAACTCAGCTAGCCAGAATGAA
CAACACAACCGGAAGCGGGATTCCAAGCTGGCACTGCCACTGTGGAGGGCGCTGAAACTTCATCACACACTGAGAGGCCGTCACAGCCCC
AGACCACCCGCTTGGCCCACGCAGCAGCAGAGCCGCCGTTTGCTGGGTTGTTTACCGAGCACTGTGACCTTTCTTTCCCTGGAACTCTTT

>In-frame_SAMD11_ENST00000342066_chr1_861393_+_PROZ_ENST00000375547_chr13_113824727_+_1060nt
CCAGCAGATCCCTGCGGCGTTCGCGAGGGTGGGACGGGAAGCGGGCTGGGAAGTCGGGCCGAGGGAAAAGTCTGAAGACGCTTATGTCCA
AGGGGATCCTGCAGGTGCATCCTCCGATCTGCGACTGCCCGGGCTGCCGAATATCCTCCCCGGTGGTAAAGTTAACAAATTCCGAAGGAA
AAGACTTCTGTGGTGGTGTTATAATACGGGAAAATTTTGTACTGACAACAGCAAAATGTTCACTGTTACACAGGAATATTACTGTAAAAA
CATATTTTAACAGAACGAGCCAAGACCCGCTGATGATCAAGATAACGCACGTCCATGTGCACATGCGGTATGACGCGGACGCGGGGGAGA
ATGACCTGTCACTGCTGGAGCTGGAGTGGCCCATCCAGTGCCCAGGTGCGGGGCTCCCCGTGTGCACCCCTGAGAAAGACTTCGCTGAGC
ACCTCCTCATCCCACGCACCAGGGGCCTCCTCAGCGGCTGGGCACGCAATGGCACTGACCTGGGCAACTCGCTGACCACGCGGCCTGTCA
CACTTGTGGAGGGGGAGGAGTGCGGGCAGGTCCTGAATGTGACTGTCACCACCAGGACCTACTGTGAGAGAAGCAGCGTGGCGGCCATGC
ACTGGATGGATGGAAGTGTGGTCACCAGAGAACACAGAGGCTCCTGGTTTCTCACGGGGGTCCTGGGCTCGCAGCCAGTAGGAGGGCAGG
CTCACATGGTCCTTGTCACCAAGGTCTCCAGGTACTCACTCTGGTTTAAACAGATCATGAACTAACTGAAACTCAGCTAGCCAGAATGAA
CAACACAACCGGAAGCGGGATTCCAAGCTGGCACTGCCACTGTGGAGGGCGCTGAAACTTCATCACACACTGAGAGGCCGTCACAGCCCC
AGACCACCCGCTTGGCCCACGCAGCAGCAGAGCCGCCGTTTGCTGGGTTGTTTACCGAGCACTGTGACCTTTCTTTCCCTGGAACTCTTT


Top

FusionGenePPI for SAMD11_PROZ


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SAMD11SAMD7, PRR20E, L3MBTL1, HNRNPLL, NCAPH2, ASB3, SIRT6, TRIM25PROZFOXG1, INTS6, IP6K3, XRCC6BP1, FOXF2, OR52W1, SIPA1L2, SDF2L1, SIK2, MAP2K7, CDC6, SENP1, RICTOR, TUBA4A, TYW3, MELK, EGFL7, TUBB8, SEPN1, KANK2, GNL3L, MLF1, ACOT9, ETV3, HSPA5, DNAJB9, HIGD1A, TUBB3, N4BP2L2, ZNHIT6, ARVCF


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SAMD11_PROZ


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgenePROZP22891DB00170MenadioneVitamin K-dependent protein Zsmall moleculeapproved|nutraceutical

Top

RelatedDiseases for SAMD11_PROZ


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSAMD11C0023893Liver Cirrhosis, Experimental1CTD_human