FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32545

FusionGeneSummary for SAE1_RPA2

check button Fusion gene summary
Fusion gene informationFusion gene name: SAE1_RPA2
Fusion gene ID: 32545
HgeneTgene
Gene symbol

SAE1

RPA2

Gene ID

10055

84172

Gene nameSUMO1 activating enzyme subunit 1RNA polymerase I subunit B
SynonymsAOS1|HSPC140|SUA1|UBLE1ARPA135|RPA2|Rpo1-2
Cytomap

19q13.32

2q14.1

Type of geneprotein-codingprotein-coding
DescriptionSUMO-activating enzyme subunit 1SUMO-1 activating enzyme E1 N subunitSUMO-1 activating enzyme subunit 1activator of SUMO1sentrin/SUMO-activating protein AOS1ubiquitin-like 1-activating enzyme E1Aubiquitin-like protein SUMO-1 activating enzymeDNA-directed RNA polymerase I subunit RPA2DNA-directed RNA polymerase I 135 kDa polypeptideDNA-directed RNA polymerase I 135kDa polypeptideRNA polymerase I subunit 2polymerase (RNA) I polypeptide B, 128kDapolymerase (RNA) I subunit B
Modification date2018052320180523
UniProtAcc

Q9UBE0

P15927

Ensembl transtripts involved in fusion geneENST00000413379, ENST00000540850, 
ENST00000598840, ENST00000270225, 
ENST00000392776, 
ENST00000373912, 
ENST00000373909, ENST00000313433, 
Fusion gene scores* DoF score9 X 3 X 8=2161 X 1 X 1=1
# samples 81
** MAII scorelog2(8/216*10)=-1.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: SAE1 [Title/Abstract] AND RPA2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTranscription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSAE1

GO:0016925

protein sumoylation

15660128|20164921


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCECTCGA-B5-A3S1-01ASAE1chr19

47658470

+RPA2chr1

28233793

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000413379ENST00000373912SAE1chr19

47658470

+RPA2chr1

28233793

-
In-frameENST00000413379ENST00000373909SAE1chr19

47658470

+RPA2chr1

28233793

-
In-frameENST00000413379ENST00000313433SAE1chr19

47658470

+RPA2chr1

28233793

-
In-frameENST00000540850ENST00000373912SAE1chr19

47658470

+RPA2chr1

28233793

-
In-frameENST00000540850ENST00000373909SAE1chr19

47658470

+RPA2chr1

28233793

-
In-frameENST00000540850ENST00000313433SAE1chr19

47658470

+RPA2chr1

28233793

-
intron-3CDSENST00000598840ENST00000373912SAE1chr19

47658470

+RPA2chr1

28233793

-
intron-3CDSENST00000598840ENST00000373909SAE1chr19

47658470

+RPA2chr1

28233793

-
intron-3CDSENST00000598840ENST00000313433SAE1chr19

47658470

+RPA2chr1

28233793

-
In-frameENST00000270225ENST00000373912SAE1chr19

47658470

+RPA2chr1

28233793

-
In-frameENST00000270225ENST00000373909SAE1chr19

47658470

+RPA2chr1

28233793

-
In-frameENST00000270225ENST00000313433SAE1chr19

47658470

+RPA2chr1

28233793

-
In-frameENST00000392776ENST00000373912SAE1chr19

47658470

+RPA2chr1

28233793

-
In-frameENST00000392776ENST00000373909SAE1chr19

47658470

+RPA2chr1

28233793

-
In-frameENST00000392776ENST00000313433SAE1chr19

47658470

+RPA2chr1

28233793

-

Top

FusionProtFeatures for SAE1_RPA2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SAE1

Q9UBE0

RPA2

P15927

The heterodimer acts as an E1 ligase for SUMO1, SUMO2,SUMO3, and probably SUMO4. It mediates ATP-dependent activation ofSUMO proteins followed by formation of a thioester bond between aSUMO protein and a conserved active site cysteine residue onUBA2/SAE2. {ECO:0000269|PubMed:10187858,ECO:0000269|PubMed:10217437, ECO:0000269|PubMed:11451954,ECO:0000269|PubMed:11481243, ECO:0000269|PubMed:15660128,ECO:0000269|PubMed:20164921, ECO:0000269|PubMed:9920803}. As part of the heterotrimeric replication protein Acomplex (RPA/RP-A), binds and stabilizes single-stranded DNAintermediates, that form during DNA replication or upon DNAstress. It prevents their reannealing and in parallel, recruitsand activates different proteins and complexes involved in DNAmetabolism. Thereby, it plays an essential role both in DNAreplication and the cellular response to DNA damage. In thecellular response to DNA damage, the RPA complex controls DNArepair and DNA damage checkpoint activation. Through recruitmentof ATRIP activates the ATR kinase a master regulator of the DNAdamage response. It is required for the recruitment of the DNAdouble-strand break repair factors RAD51 and RAD52 to chromatin inresponse to DNA damage. Also recruits to sites of DNA damageproteins like XPA and XPG that are involved in nucleotide excisionrepair and is required for this mechanism of DNA repair. Playsalso a role in base excision repair (BER) probably throughinteraction with UNG. Also recruits SMARCAL1/HARP, which isinvolved in replication fork restart, to sites of DNA damage. Mayalso play a role in telomere maintenance.{ECO:0000269|PubMed:15205463, ECO:0000269|PubMed:17765923,ECO:0000269|PubMed:17959650, ECO:0000269|PubMed:19116208,ECO:0000269|PubMed:20154705, ECO:0000269|PubMed:21504906,ECO:0000269|PubMed:2406247, ECO:0000269|PubMed:24332808,ECO:0000269|PubMed:7697716, ECO:0000269|PubMed:7700386,ECO:0000269|PubMed:8702565, ECO:0000269|PubMed:9430682,ECO:0000269|PubMed:9765279}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRPA2chr19:47658470chr1:28233793ENST00000313433-08127_145127359Compositional biasNote=Arg/Lys-rich (basic)
TgeneRPA2chr19:47658470chr1:28233793ENST00000313433-08247_270127359Compositional biasNote=Asp/Glu-rich (acidic)
TgeneRPA2chr19:47658470chr1:28233793ENST00000373909-19127_14547279Compositional biasNote=Arg/Lys-rich (basic)
TgeneRPA2chr19:47658470chr1:28233793ENST00000373909-19247_27047279Compositional biasNote=Asp/Glu-rich (acidic)
TgeneRPA2chr19:47658470chr1:28233793ENST00000373909-1995_12347279Compositional biasNote=Asp/Glu-rich (acidic)
TgeneRPA2chr19:47658470chr1:28233793ENST00000373912-19127_14539271Compositional biasNote=Arg/Lys-rich (basic)
TgeneRPA2chr19:47658470chr1:28233793ENST00000373912-19247_27039271Compositional biasNote=Asp/Glu-rich (acidic)
TgeneRPA2chr19:47658470chr1:28233793ENST00000373912-1937_4539271Compositional biasNote=Arg/Lys-rich (basic)
TgeneRPA2chr19:47658470chr1:28233793ENST00000373912-1995_12339271Compositional biasNote=Asp/Glu-rich (acidic)
TgeneRPA2chr19:47658470chr1:28233793ENST00000373909-1974_14847279DNA bindingNote=OB
TgeneRPA2chr19:47658470chr1:28233793ENST00000373912-1974_14839271DNA bindingNote=OB

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRPA2chr19:47658470chr1:28233793ENST00000313433-081_29127359Compositional biasNote=Gly/Ser-rich
TgeneRPA2chr19:47658470chr1:28233793ENST00000313433-0837_45127359Compositional biasNote=Arg/Lys-rich (basic)
TgeneRPA2chr19:47658470chr1:28233793ENST00000313433-0895_123127359Compositional biasNote=Asp/Glu-rich (acidic)
TgeneRPA2chr19:47658470chr1:28233793ENST00000373909-191_2947279Compositional biasNote=Gly/Ser-rich
TgeneRPA2chr19:47658470chr1:28233793ENST00000373909-1937_4547279Compositional biasNote=Arg/Lys-rich (basic)
TgeneRPA2chr19:47658470chr1:28233793ENST00000373912-191_2939271Compositional biasNote=Gly/Ser-rich
TgeneRPA2chr19:47658470chr1:28233793ENST00000313433-0874_148127359DNA bindingNote=OB


Top

FusionGeneSequence for SAE1_RPA2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SAE1_ENST00000413379_chr19_47658470_+_RPA2_ENST00000373912_chr1_28233793_-_441aa
MVEKEEAGGGISEEEAAQTDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRN
RAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAA
PMDVRQWVDTDDTSSENTVVPPETTVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSE

>In-frame_SAE1_ENST00000413379_chr19_47658470_+_RPA2_ENST00000373909_chr1_28233793_-_441aa
MVEKEEAGGGISEEEAAQTDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRN
RAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAA
PMDVRQWVDTDDTSSENTVVPPETTVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSE

>In-frame_SAE1_ENST00000413379_chr19_47658470_+_RPA2_ENST00000313433_chr1_28233793_-_441aa
MVEKEEAGGGISEEEAAQTDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRN
RAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAA
PMDVRQWVDTDDTSSENTVVPPETTVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSE

>In-frame_SAE1_ENST00000540850_chr19_47658470_+_RPA2_ENST00000373912_chr1_28233793_-_267aa
MLEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKI
DDMTAAPMDVRQWVDTDDTSSENTVVPPETTVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPIS

>In-frame_SAE1_ENST00000540850_chr19_47658470_+_RPA2_ENST00000373909_chr1_28233793_-_267aa
MLEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKI
DDMTAAPMDVRQWVDTDDTSSENTVVPPETTVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPIS

>In-frame_SAE1_ENST00000540850_chr19_47658470_+_RPA2_ENST00000313433_chr1_28233793_-_267aa
MLEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKI
DDMTAAPMDVRQWVDTDDTSSENTVVPPETTVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPIS

>In-frame_SAE1_ENST00000270225_chr19_47658470_+_RPA2_ENST00000373912_chr1_28233793_-_441aa
MVEKEEAGGGISEEEAAQTDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRN
RAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAA
PMDVRQWVDTDDTSSENTVVPPETTVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSE

>In-frame_SAE1_ENST00000270225_chr19_47658470_+_RPA2_ENST00000373909_chr1_28233793_-_441aa
MVEKEEAGGGISEEEAAQTDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRN
RAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAA
PMDVRQWVDTDDTSSENTVVPPETTVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSE

>In-frame_SAE1_ENST00000270225_chr19_47658470_+_RPA2_ENST00000313433_chr1_28233793_-_441aa
MVEKEEAGGGISEEEAAQTDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRN
RAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAA
PMDVRQWVDTDDTSSENTVVPPETTVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSE

>In-frame_SAE1_ENST00000392776_chr19_47658470_+_RPA2_ENST00000373912_chr1_28233793_-_441aa
MVEKEEAGGGISEEEAAQTDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRN
RAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAA
PMDVRQWVDTDDTSSENTVVPPETTVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSE

>In-frame_SAE1_ENST00000392776_chr19_47658470_+_RPA2_ENST00000373909_chr1_28233793_-_441aa
MVEKEEAGGGISEEEAAQTDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRN
RAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAA
PMDVRQWVDTDDTSSENTVVPPETTVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSE

>In-frame_SAE1_ENST00000392776_chr19_47658470_+_RPA2_ENST00000313433_chr1_28233793_-_441aa
MVEKEEAGGGISEEEAAQTDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRN
RAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAA
PMDVRQWVDTDDTSSENTVVPPETTVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SAE1_ENST00000413379_chr19_47658470_+_RPA2_ENST00000373912_chr1_28233793_-_1323nt
ATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCC
CAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTG
AAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAAT
AGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAGAAGAAACCAGAG
TCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGC
ATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAA
GTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGA
GCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAG
ATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCA
CCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGC
CACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTG
GAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAA
GCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCA
AGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGC

>In-frame_SAE1_ENST00000413379_chr19_47658470_+_RPA2_ENST00000373909_chr1_28233793_-_1323nt
ATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCC
CAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTG
AAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAAT
AGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAGAAGAAACCAGAG
TCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGC
ATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAA
GTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGA
GCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAG
ATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCA
CCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGC
CACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTG
GAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAA
GCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCA
AGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGC

>In-frame_SAE1_ENST00000413379_chr19_47658470_+_RPA2_ENST00000313433_chr1_28233793_-_1323nt
ATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCC
CAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTG
AAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAAT
AGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAGAAGAAACCAGAG
TCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGC
ATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAA
GTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGA
GCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAG
ATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCA
CCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGC
CACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTG
GAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAA
GCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCA
AGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGC

>In-frame_SAE1_ENST00000540850_chr19_47658470_+_RPA2_ENST00000373912_chr1_28233793_-_801nt
ATGCTGGAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACA
ACGATGGTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTC
AGAATTGGGAATGTTGAGATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATA
GATGACATGACAGCTGCACCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACA
TATGTGAAAGTGGCAGGCCACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAG
TTCACCACACATATTCTGGAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGC
AATCCAGGAATGAGTGAAGCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAAT
TTGATTAAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAA

>In-frame_SAE1_ENST00000540850_chr19_47658470_+_RPA2_ENST00000373909_chr1_28233793_-_801nt
ATGCTGGAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACA
ACGATGGTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTC
AGAATTGGGAATGTTGAGATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATA
GATGACATGACAGCTGCACCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACA
TATGTGAAAGTGGCAGGCCACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAG
TTCACCACACATATTCTGGAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGC
AATCCAGGAATGAGTGAAGCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAAT
TTGATTAAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAA

>In-frame_SAE1_ENST00000540850_chr19_47658470_+_RPA2_ENST00000313433_chr1_28233793_-_801nt
ATGCTGGAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACA
ACGATGGTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTC
AGAATTGGGAATGTTGAGATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATA
GATGACATGACAGCTGCACCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACA
TATGTGAAAGTGGCAGGCCACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAG
TTCACCACACATATTCTGGAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGC
AATCCAGGAATGAGTGAAGCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAAT
TTGATTAAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAA

>In-frame_SAE1_ENST00000270225_chr19_47658470_+_RPA2_ENST00000373912_chr1_28233793_-_1323nt
ATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCC
CAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTG
AAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAAT
AGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAGAAGAAACCAGAG
TCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGC
ATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAA
GTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGA
GCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAG
ATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCA
CCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGC
CACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTG
GAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAA
GCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCA
AGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGC

>In-frame_SAE1_ENST00000270225_chr19_47658470_+_RPA2_ENST00000373909_chr1_28233793_-_1323nt
ATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCC
CAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTG
AAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAAT
AGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAGAAGAAACCAGAG
TCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGC
ATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAA
GTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGA
GCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAG
ATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCA
CCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGC
CACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTG
GAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAA
GCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCA
AGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGC

>In-frame_SAE1_ENST00000270225_chr19_47658470_+_RPA2_ENST00000313433_chr1_28233793_-_1323nt
ATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCC
CAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTG
AAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAAT
AGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAGAAGAAACCAGAG
TCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGC
ATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAA
GTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGA
GCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAG
ATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCA
CCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGC
CACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTG
GAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAA
GCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCA
AGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGC

>In-frame_SAE1_ENST00000392776_chr19_47658470_+_RPA2_ENST00000373912_chr1_28233793_-_1323nt
ATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCC
CAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTG
AAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAAT
AGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAGAAGAAACCAGAG
TCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGC
ATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAA
GTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGA
GCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAG
ATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCA
CCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGC
CACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTG
GAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAA
GCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCA
AGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGC

>In-frame_SAE1_ENST00000392776_chr19_47658470_+_RPA2_ENST00000373909_chr1_28233793_-_1323nt
ATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCC
CAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTG
AAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAAT
AGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAGAAGAAACCAGAG
TCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGC
ATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAA
GTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGA
GCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAG
ATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCA
CCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGC
CACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTG
GAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAA
GCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCA
AGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGC

>In-frame_SAE1_ENST00000392776_chr19_47658470_+_RPA2_ENST00000313433_chr1_28233793_-_1323nt
ATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCC
CAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTG
AAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAAT
AGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAGAAGAAACCAGAG
TCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGC
ATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAA
GTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGA
GCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAG
ATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCA
CCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGC
CACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTG
GAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAA
GCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCA
AGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SAE1_ENST00000413379_chr19_47658470_+_RPA2_ENST00000373912_chr1_28233793_-_2064nt
AGAAGCACTCCGGGCGTGCTGCCGGCGGCGGTAGGTGGCGCGCGGGTCCGGCGGGCGGTTGGCTTGAGCGGGACCGGAGCTGAGGCAGGA
AGAGCCGGCGCCATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGG
GGACTGGAGGCCCAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATC
TTGGCAGGAGTGAAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCT
GTTGGCCGAAATAGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAG
AAGAAACCAGAGTCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGT
CACAAAAATAGCATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAG
GAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATG
GTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATT
GGGAATGTTGAGATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGAC
ATGACAGCTGCACCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTG
AAAGTGGCAGGCCACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACC
ACACATATTCTGGAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCA
GGAATGAGTGAAGCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATT
AAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTG
GATTTTCTGAGCAATGAGGGGCACATCTATTCTACTGTGGATGATGACCATTTTAAATCCACAGATGCAGAATAACTGGATCTAACTGGG
TACCTGAGATATTTTACAGCTGGACCTAGTTTCACAATCTGTTGTCTCCAGCTCTGCATATGTCTGGCCAGGGGGCTTCTAGGAAGTAGG
TTTCATCTATCAAATGTCTCCTCTGACTTCCTTTTGAAACTTACTGCTCTTCTGTTTTATTTTGTTTTGTTTGAAGCTCAGAGGGAGATG
GGCAATTGACAGGGATGCAATCCAGGGTGGGATTTCTTGAGGAAGTTACAAATAAGCTTGTTACAACATCAAGATAGATGGAATTGGAAG
GATGCTACCAGGAGAGTACTTACATAGTGCTCAGGAGTTTCTCTTCTTAAAATGTTTACTGCTGAAAGATGAGCAGGACCAGGGCGTTAT
AGGCAGAGCCCTAGCCGAGAAACCTGCTGGCCTCTGCCTGTTTTCATTTCCCACTTTGGTTGTGTGGCATTACTTTCAGAATTGCACTTT
CCTGCTTGTCATGACTTTTTGACACACTTGCCATGACGTGTGTTTCTGTGAACATGAAGTTCTGCGGTAGTGCCTCCAGGGGCAGAGGAA

>In-frame_SAE1_ENST00000413379_chr19_47658470_+_RPA2_ENST00000373909_chr1_28233793_-_1664nt
AGAAGCACTCCGGGCGTGCTGCCGGCGGCGGTAGGTGGCGCGCGGGTCCGGCGGGCGGTTGGCTTGAGCGGGACCGGAGCTGAGGCAGGA
AGAGCCGGCGCCATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGG
GGACTGGAGGCCCAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATC
TTGGCAGGAGTGAAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCT
GTTGGCCGAAATAGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAG
AAGAAACCAGAGTCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGT
CACAAAAATAGCATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAG
GAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATG
GTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATT
GGGAATGTTGAGATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGAC
ATGACAGCTGCACCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTG
AAAGTGGCAGGCCACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACC
ACACATATTCTGGAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCA
GGAATGAGTGAAGCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATT
AAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTG
GATTTTCTGAGCAATGAGGGGCACATCTATTCTACTGTGGATGATGACCATTTTAAATCCACAGATGCAGAATAACTGGATCTAACTGGG
TACCTGAGATATTTTACAGCTGGACCTAGTTTCACAATCTGTTGTCTCCAGCTCTGCATATGTCTGGCCAGGGGGCTTCTAGGAAGTAGG
TTTCATCTATCAAATGTCTCCTCTGACTTCCTTTTGAAACTTACTGCTCTTCTGTTTTATTTTGTTTTGTTTGAAGCTCAGAGGGAGATG

>In-frame_SAE1_ENST00000413379_chr19_47658470_+_RPA2_ENST00000313433_chr1_28233793_-_1515nt
AGAAGCACTCCGGGCGTGCTGCCGGCGGCGGTAGGTGGCGCGCGGGTCCGGCGGGCGGTTGGCTTGAGCGGGACCGGAGCTGAGGCAGGA
AGAGCCGGCGCCATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGG
GGACTGGAGGCCCAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATC
TTGGCAGGAGTGAAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCT
GTTGGCCGAAATAGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAG
AAGAAACCAGAGTCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGT
CACAAAAATAGCATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAG
GAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATG
GTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATT
GGGAATGTTGAGATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGAC
ATGACAGCTGCACCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTG
AAAGTGGCAGGCCACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACC
ACACATATTCTGGAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCA
GGAATGAGTGAAGCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATT
AAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTG
GATTTTCTGAGCAATGAGGGGCACATCTATTCTACTGTGGATGATGACCATTTTAAATCCACAGATGCAGAATAACTGGATCTAACTGGG

>In-frame_SAE1_ENST00000540850_chr19_47658470_+_RPA2_ENST00000373912_chr1_28233793_-_1745nt
ACTCCGGGCGTGCTGCCGGCGGCGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCT
CATCTTGGCAGGAGTGAAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGG
GTCTGTTGGCCGAAATAGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATAT
AGAGAAGAAACCAGAGTCATTTTTCACTCAATTCGATGCTGGAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCG
ACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTC
AGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAGATTTCACAGGTCACTATTGTGGGGATCATCAGACATG
CAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCACCCATGGACGTTCGCCAGTGGGTTGACACAGATGACA
CCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGCCACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAG
CCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTGGAAGTGATCAATGCACACATGGTACTAAGCAAAGCCA
ACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAAGCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAA
ATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACC
AGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGCAATGAGGGGCACATCTATTCTACTGTGGATGATGACC
ATTTTAAATCCACAGATGCAGAATAACTGGATCTAACTGGGTACCTGAGATATTTTACAGCTGGACCTAGTTTCACAATCTGTTGTCTCC
AGCTCTGCATATGTCTGGCCAGGGGGCTTCTAGGAAGTAGGTTTCATCTATCAAATGTCTCCTCTGACTTCCTTTTGAAACTTACTGCTC
TTCTGTTTTATTTTGTTTTGTTTGAAGCTCAGAGGGAGATGGGCAATTGACAGGGATGCAATCCAGGGTGGGATTTCTTGAGGAAGTTAC
AAATAAGCTTGTTACAACATCAAGATAGATGGAATTGGAAGGATGCTACCAGGAGAGTACTTACATAGTGCTCAGGAGTTTCTCTTCTTA
AAATGTTTACTGCTGAAAGATGAGCAGGACCAGGGCGTTATAGGCAGAGCCCTAGCCGAGAAACCTGCTGGCCTCTGCCTGTTTTCATTT
CCCACTTTGGTTGTGTGGCATTACTTTCAGAATTGCACTTTCCTGCTTGTCATGACTTTTTGACACACTTGCCATGACGTGTGTTTCTGT
GAACATGAAGTTCTGCGGTAGTGCCTCCAGGGGCAGAGGAAAAGAAGAAGTGTTACTGCATTTTGTACAAAATAAATACAGTCATATGTT

>In-frame_SAE1_ENST00000540850_chr19_47658470_+_RPA2_ENST00000373909_chr1_28233793_-_1345nt
ACTCCGGGCGTGCTGCCGGCGGCGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCT
CATCTTGGCAGGAGTGAAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGG
GTCTGTTGGCCGAAATAGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATAT
AGAGAAGAAACCAGAGTCATTTTTCACTCAATTCGATGCTGGAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCG
ACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTC
AGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAGATTTCACAGGTCACTATTGTGGGGATCATCAGACATG
CAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCACCCATGGACGTTCGCCAGTGGGTTGACACAGATGACA
CCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGCCACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAG
CCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTGGAAGTGATCAATGCACACATGGTACTAAGCAAAGCCA
ACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAAGCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAA
ATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACC
AGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGCAATGAGGGGCACATCTATTCTACTGTGGATGATGACC
ATTTTAAATCCACAGATGCAGAATAACTGGATCTAACTGGGTACCTGAGATATTTTACAGCTGGACCTAGTTTCACAATCTGTTGTCTCC
AGCTCTGCATATGTCTGGCCAGGGGGCTTCTAGGAAGTAGGTTTCATCTATCAAATGTCTCCTCTGACTTCCTTTTGAAACTTACTGCTC

>In-frame_SAE1_ENST00000540850_chr19_47658470_+_RPA2_ENST00000313433_chr1_28233793_-_1196nt
ACTCCGGGCGTGCTGCCGGCGGCGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCT
CATCTTGGCAGGAGTGAAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGG
GTCTGTTGGCCGAAATAGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATAT
AGAGAAGAAACCAGAGTCATTTTTCACTCAATTCGATGCTGGAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCG
ACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTC
AGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAGATTTCACAGGTCACTATTGTGGGGATCATCAGACATG
CAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCACCCATGGACGTTCGCCAGTGGGTTGACACAGATGACA
CCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGCCACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAG
CCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTGGAAGTGATCAATGCACACATGGTACTAAGCAAAGCCA
ACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAAGCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAA
ATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACC
AGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGCAATGAGGGGCACATCTATTCTACTGTGGATGATGACC
ATTTTAAATCCACAGATGCAGAATAACTGGATCTAACTGGGTACCTGAGATATTTTACAGCTGGACCTAGTTTCACAATCTGTTGTCTCC

>In-frame_SAE1_ENST00000270225_chr19_47658470_+_RPA2_ENST00000373912_chr1_28233793_-_2030nt
GTGGCGCGCGGGTCCGGCGGGCGGTTGGCTTGAGCGGGACCGGAGCTGAGGCAGGAAGAGCCGGCGCCATGGTGGAGAAGGAGGAGGCTG
GCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCCCAGAAACGGCTGCGGGCCTCTC
GGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTGAAAGGACTGACCATGCTGGATC
ACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAATAGGGCTGAAGCCTCTTTGGAGC
GAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAGAAGAAACCAGAGTCATTTTTCACTCAATTCGATG
CTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGCATCAAGTTCTTTACAGGAGATG
TTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAG
TAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGC
CCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAGATTTCACAGGTCACTATTGTGG
GGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCACCCATGGACGTTCGCCAGTGGG
TTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGCCACCTGAGATCTTTTCAGAACA
AAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTGGAAGTGATCAATGCACACATGG
TACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAAGCAGGGAACTTTGGTGGGAATA
GCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTC
AGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGCAATGAGGGGCACATCTATTCTA
CTGTGGATGATGACCATTTTAAATCCACAGATGCAGAATAACTGGATCTAACTGGGTACCTGAGATATTTTACAGCTGGACCTAGTTTCA
CAATCTGTTGTCTCCAGCTCTGCATATGTCTGGCCAGGGGGCTTCTAGGAAGTAGGTTTCATCTATCAAATGTCTCCTCTGACTTCCTTT
TGAAACTTACTGCTCTTCTGTTTTATTTTGTTTTGTTTGAAGCTCAGAGGGAGATGGGCAATTGACAGGGATGCAATCCAGGGTGGGATT
TCTTGAGGAAGTTACAAATAAGCTTGTTACAACATCAAGATAGATGGAATTGGAAGGATGCTACCAGGAGAGTACTTACATAGTGCTCAG
GAGTTTCTCTTCTTAAAATGTTTACTGCTGAAAGATGAGCAGGACCAGGGCGTTATAGGCAGAGCCCTAGCCGAGAAACCTGCTGGCCTC
TGCCTGTTTTCATTTCCCACTTTGGTTGTGTGGCATTACTTTCAGAATTGCACTTTCCTGCTTGTCATGACTTTTTGACACACTTGCCAT
GACGTGTGTTTCTGTGAACATGAAGTTCTGCGGTAGTGCCTCCAGGGGCAGAGGAAAAGAAGAAGTGTTACTGCATTTTGTACAAAATAA

>In-frame_SAE1_ENST00000270225_chr19_47658470_+_RPA2_ENST00000373909_chr1_28233793_-_1630nt
GTGGCGCGCGGGTCCGGCGGGCGGTTGGCTTGAGCGGGACCGGAGCTGAGGCAGGAAGAGCCGGCGCCATGGTGGAGAAGGAGGAGGCTG
GCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCCCAGAAACGGCTGCGGGCCTCTC
GGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTGAAAGGACTGACCATGCTGGATC
ACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAATAGGGCTGAAGCCTCTTTGGAGC
GAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAGAAGAAACCAGAGTCATTTTTCACTCAATTCGATG
CTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGCATCAAGTTCTTTACAGGAGATG
TTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAG
TAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGC
CCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAGATTTCACAGGTCACTATTGTGG
GGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCACCCATGGACGTTCGCCAGTGGG
TTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGCCACCTGAGATCTTTTCAGAACA
AAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTGGAAGTGATCAATGCACACATGG
TACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAAGCAGGGAACTTTGGTGGGAATA
GCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTC
AGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGCAATGAGGGGCACATCTATTCTA
CTGTGGATGATGACCATTTTAAATCCACAGATGCAGAATAACTGGATCTAACTGGGTACCTGAGATATTTTACAGCTGGACCTAGTTTCA
CAATCTGTTGTCTCCAGCTCTGCATATGTCTGGCCAGGGGGCTTCTAGGAAGTAGGTTTCATCTATCAAATGTCTCCTCTGACTTCCTTT
TGAAACTTACTGCTCTTCTGTTTTATTTTGTTTTGTTTGAAGCTCAGAGGGAGATGGGCAATTGACAGGGATGCAATCCAGGGTGGGATT

>In-frame_SAE1_ENST00000270225_chr19_47658470_+_RPA2_ENST00000313433_chr1_28233793_-_1481nt
GTGGCGCGCGGGTCCGGCGGGCGGTTGGCTTGAGCGGGACCGGAGCTGAGGCAGGAAGAGCCGGCGCCATGGTGGAGAAGGAGGAGGCTG
GCGGCGGCATTAGCGAGGAGGAGGCGGCACAGTATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCCCAGAAACGGCTGCGGGCCTCTC
GGGTGCTTCTTGTCGGCTTGAAAGGACTTGGGGCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTGAAAGGACTGACCATGCTGGATC
ACGAACAGGTAACTCCAGAAGATCCCGGAGCTCAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAATAGGGCTGAAGCCTCTTTGGAGC
GAGCTCAGAATCTCAACCCCATGGTGGATGTGAAGGTGGACACTGAGGATATAGAGAAGAAACCAGAGTCATTTTTCACTCAATTCGATG
CTGTGTGTCTGACTTGCTGCTCCAGGGATGTCATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGCATCAAGTTCTTTACAGGAGATG
TTTTTGGCTACCATGGATACACATTTGCCAATCTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAG
TAGAAGATGGGCCCGACACCAAGAGAGCAAAACTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGC
CCTGTACTATATCTCAGCTGCTTTCTGCCACTTTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAGATTTCACAGGTCACTATTGTGG
GGATCATCAGACATGCAGAGAAGGCTCCAACCAACATTGTTTACAAAATAGATGACATGACAGCTGCACCCATGGACGTTCGCCAGTGGG
TTGACACAGATGACACCAGCAGTGAAAACACTGTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGCCACCTGAGATCTTTTCAGAACA
AAAAGAGCCTGGTAGCCTTTAAGATCATGCCCCTGGAGGATATGAATGAGTTCACCACACATATTCTGGAAGTGATCAATGCACACATGG
TACTAAGCAAAGCCAACAGCCAGCCCTCAGCAGGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAAGCAGGGAACTTTGGTGGGAATA
GCTTCATGCCAGCAAATGGCCTCACTGTGGCCCAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTC
AGGATCTCAAGAACCAGCTGAAACACATGTCTGTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGCAATGAGGGGCACATCTATTCTA
CTGTGGATGATGACCATTTTAAATCCACAGATGCAGAATAACTGGATCTAACTGGGTACCTGAGATATTTTACAGCTGGACCTAGTTTCA

>In-frame_SAE1_ENST00000392776_chr19_47658470_+_RPA2_ENST00000373912_chr1_28233793_-_1998nt
AGCGGGACCGGAGCTGAGGCAGGAAGAGCCGGCGCCATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAG
TATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCCCAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGG
GCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTGAAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCT
CAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAATAGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTG
AAGGTGGACACTGAGGATATAGAGAAGAAACCAGAGTCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTC
ATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGCATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAAT
CTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAA
CTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACT
TTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAGATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACC
AACATTGTTTACAAAATAGATGACATGACAGCTGCACCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACT
GTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGCCACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCC
CTGGAGGATATGAATGAGTTCACCACACATATTCTGGAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCA
GGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAAGCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCC
CAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCT
GTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGCAATGAGGGGCACATCTATTCTACTGTGGATGATGACCATTTTAAATCCACAGAT
GCAGAATAACTGGATCTAACTGGGTACCTGAGATATTTTACAGCTGGACCTAGTTTCACAATCTGTTGTCTCCAGCTCTGCATATGTCTG
GCCAGGGGGCTTCTAGGAAGTAGGTTTCATCTATCAAATGTCTCCTCTGACTTCCTTTTGAAACTTACTGCTCTTCTGTTTTATTTTGTT
TTGTTTGAAGCTCAGAGGGAGATGGGCAATTGACAGGGATGCAATCCAGGGTGGGATTTCTTGAGGAAGTTACAAATAAGCTTGTTACAA
CATCAAGATAGATGGAATTGGAAGGATGCTACCAGGAGAGTACTTACATAGTGCTCAGGAGTTTCTCTTCTTAAAATGTTTACTGCTGAA
AGATGAGCAGGACCAGGGCGTTATAGGCAGAGCCCTAGCCGAGAAACCTGCTGGCCTCTGCCTGTTTTCATTTCCCACTTTGGTTGTGTG
GCATTACTTTCAGAATTGCACTTTCCTGCTTGTCATGACTTTTTGACACACTTGCCATGACGTGTGTTTCTGTGAACATGAAGTTCTGCG
GTAGTGCCTCCAGGGGCAGAGGAAAAGAAGAAGTGTTACTGCATTTTGTACAAAATAAATACAGTCATATGTTTAATAAAACAGTTCTAT

>In-frame_SAE1_ENST00000392776_chr19_47658470_+_RPA2_ENST00000373909_chr1_28233793_-_1598nt
AGCGGGACCGGAGCTGAGGCAGGAAGAGCCGGCGCCATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAG
TATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCCCAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGG
GCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTGAAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCT
CAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAATAGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTG
AAGGTGGACACTGAGGATATAGAGAAGAAACCAGAGTCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTC
ATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGCATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAAT
CTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAA
CTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACT
TTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAGATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACC
AACATTGTTTACAAAATAGATGACATGACAGCTGCACCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACT
GTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGCCACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCC
CTGGAGGATATGAATGAGTTCACCACACATATTCTGGAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCA
GGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAAGCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCC
CAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCT
GTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGCAATGAGGGGCACATCTATTCTACTGTGGATGATGACCATTTTAAATCCACAGAT
GCAGAATAACTGGATCTAACTGGGTACCTGAGATATTTTACAGCTGGACCTAGTTTCACAATCTGTTGTCTCCAGCTCTGCATATGTCTG
GCCAGGGGGCTTCTAGGAAGTAGGTTTCATCTATCAAATGTCTCCTCTGACTTCCTTTTGAAACTTACTGCTCTTCTGTTTTATTTTGTT

>In-frame_SAE1_ENST00000392776_chr19_47658470_+_RPA2_ENST00000313433_chr1_28233793_-_1449nt
AGCGGGACCGGAGCTGAGGCAGGAAGAGCCGGCGCCATGGTGGAGAAGGAGGAGGCTGGCGGCGGCATTAGCGAGGAGGAGGCGGCACAG
TATGACCGGCAGATCCGCCTGTGGGGACTGGAGGCCCAGAAACGGCTGCGGGCCTCTCGGGTGCTTCTTGTCGGCTTGAAAGGACTTGGG
GCTGAAATTGCCAAGAATCTCATCTTGGCAGGAGTGAAAGGACTGACCATGCTGGATCACGAACAGGTAACTCCAGAAGATCCCGGAGCT
CAGTTCTTGATTCGTACTGGGTCTGTTGGCCGAAATAGGGCTGAAGCCTCTTTGGAGCGAGCTCAGAATCTCAACCCCATGGTGGATGTG
AAGGTGGACACTGAGGATATAGAGAAGAAACCAGAGTCATTTTTCACTCAATTCGATGCTGTGTGTCTGACTTGCTGCTCCAGGGATGTC
ATAGTTAAAGTTGACCAGATCTGTCACAAAAATAGCATCAAGTTCTTTACAGGAGATGTTTTTGGCTACCATGGATACACATTTGCCAAT
CTAGGAGAGCATGAGTTTGTAGAGGAGAAAACTAAAGTTGCCAAAGTTAGCCAAGGAGTAGAAGATGGGCCCGACACCAAGAGAGCAAAA
CTTGATTCTTCTGAGACAACGATGGTCAAAAAGAGAGCCCGAGCCCAGCACATTGTGCCCTGTACTATATCTCAGCTGCTTTCTGCCACT
TTGGTTGATGAAGTGTTCAGAATTGGGAATGTTGAGATTTCACAGGTCACTATTGTGGGGATCATCAGACATGCAGAGAAGGCTCCAACC
AACATTGTTTACAAAATAGATGACATGACAGCTGCACCCATGGACGTTCGCCAGTGGGTTGACACAGATGACACCAGCAGTGAAAACACT
GTGGTTCCTCCAGAAACATATGTGAAAGTGGCAGGCCACCTGAGATCTTTTCAGAACAAAAAGAGCCTGGTAGCCTTTAAGATCATGCCC
CTGGAGGATATGAATGAGTTCACCACACATATTCTGGAAGTGATCAATGCACACATGGTACTAAGCAAAGCCAACAGCCAGCCCTCAGCA
GGGAGAGCACCTATCAGCAATCCAGGAATGAGTGAAGCAGGGAACTTTGGTGGGAATAGCTTCATGCCAGCAAATGGCCTCACTGTGGCC
CAAAACCAGGTGTTGAATTTGATTAAGGCTTGTCCAAGACCTGAAGGGTTGAACTTTCAGGATCTCAAGAACCAGCTGAAACACATGTCT
GTATCCTCAATCAAGCAAGCTGTGGATTTTCTGAGCAATGAGGGGCACATCTATTCTACTGTGGATGATGACCATTTTAAATCCACAGAT
GCAGAATAACTGGATCTAACTGGGTACCTGAGATATTTTACAGCTGGACCTAGTTTCACAATCTGTTGTCTCCAGCTCTGCATATGTCTG


Top

FusionGenePPI for SAE1_RPA2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SAE1UBA2, UBE2I, FKBP4, SUMO3, UNC79, CYP1B1, SUMO1, SUMO2, BCL6, ETV4, APP, BAG3, IL3RA, PTK2, AARS, ADSL, DHPS, LPP, PDE12, RANGAP1, CALU, CUL5, DPP9, MCM3, NPLOC4, OSGEP, PANK4, PPP2R5E, TRMT10A, RPRD1B, SRP14, TP53RK, TPD52L2, WDR4, USP39, HSPA1A, HSPA2, FUS, FAF2, ABCE1, FRG1B, PSMB6, UBE2M, TYMS, NTRK1, KRAS, MYC, EWSR1, OFD1, CTSC, GDF15, PQBP1, WAS, DNM1L, SOD1, EDEM3RPA2STAT3, MCM2, ORC2, TP53BP1, KIN, ORC1, ORC4, ORC5, MCM3, MCM4, MCM5, HERPUD1, ACP5, GOLM1, COPS6, RBM48, RPLP1, UNC119, MED31, CRMP1, EEF1A1, GAPDH, KIAA1377, LRIF1, UTP14A, TLE1, TUBB2A, PRKDC, XRCC6, RPA1, UNG, RPA4, SERTAD3, XPA, RAD52, RPA3, CREBBP, MEN1, RAD9A, RAD1, HUS1, FANCM, FYCO1, RB1CC1, CHD1L, ATR, PRIM1, HNRNPUL1, BLM, RFWD3, PCNA, GTF2H1, BID, APC, NEURL4, CUL3, APP, POLD1, DDX1, PPIA, PMPCB, NUDT5, UBXN1, DYNC1H1, ATP6V1A, FN1, ATM, PAN2, SDF4, EIF4G2, CFB, SLC17A9, CALCOCO2, MARCKS, PFDN2, PRKACA, ANP32A, ARPC1B, ARPC2, CALU, PPP2R5D, SH3GLB1, TPD52L2, TPRKB, UBQLN2, PARP1, HNRNPM, SMARCAL1, MYH9, PARP14, LIG3, TOP3A, FBXO18, DHX36, DNA2, XRCC1, HLTF, XRN2, HNRNPD, GTF2I, MYH10, IQGAP1, CDKN2AIP, SFPQ, RMI1, MSI2, RTEL1, XRCC5, TIAL1, WRN, FUS, MPG, TARDBP, HNRNPA0, PARP9, HNRNPA2B1, ANXA2P2, PURB, PNKP, MSH2, RFC5, RBM4, NPM1, RBFOX2, MSH3, FLNA, EIF2S1, ACTB, HNRNPA1, NUDT21, HNRNPAB, KCNAB2, YTHDF1, XRN1, YTHDF3, SNRNP200, NONO, INTS6, C14orf166, ELAVL1, CSNK1A1, CUL1, RBM14, DTX3L, FUBP3, RFC4, HNRNPU, RPLP0, RAVER1, ACTA2, PTBP1, EWSR1, PRDX1, IMPDH2, PARP12, RNASEH1, SLFN11, RAB11B, RPL7, EEF1A2, RAB13, SERPINB12, ANXA2, NTHL1, TAF15, NTPCR, DAZAP1, YTHDF2, CELF1, ESRP2, HNRNPDL, MATR3, SF3B1, TUBB4B, DHX15, TUBA4A, ATRIP, ACTBL2, HNRNPA3, KHDRBS1, RAB5C, HSPB1, SNRPB, TUBA1C, APEX1, MYH11, DDX5, PRPF6, DDX17, RPS9, RAB7A, SEC22B, RAB1A, TUBB, RPS7, CAPZA1, EMG1, RAB8A, RAI14, HNRNPK, PDS5A, LMO7, RBM27, SF3B2, NCL, RPL13A, RPS5, LDHA, PPP1CC, RFC2, EFTUD2, SF3A1, MPRIP, CHTF18, RBM25, ILF3, SF3B3, RBM26, SPTAN1, BCAP31, MNAT1, DDX3X, BCAS2, MDC1, RAB35, RBM39, RPL19, RPL9, BUB3, RPS8, CSNK1A1L, RAB10, TMEM33, MYO1C, DSP, PRPF8, TOP2B, PABPC1, TCOF1, TFRC, MYO1E, RBM15, PRPF40A, SKIV2L2, MYOF, PPP1R10, SMC3, INTS3, THOC2, RAD50, SYMPK, CLTC, KIAA0196, TRIM28, ARHGEF2, HNRNPR, LIMCH1, ALPP, CDC5L, CKAP5, RPL6, SMC1A, SMC2, HSPA8, CCAR2, LIMA1, LMAN2, MYO1B, WDR82, ADAR, FKBP15, HNRNPL, ILF2, MOV10, RFC1, SPTBN1, THOC6, AHNAK, PRRC2A, CHD4, DHX9, HSPA5, KDM1A, MRE11A, MTHFD1, NAPA, RPRD1B, SYNCRIP, TOP2A, DDX23, DNTTIP1, LOC442497, SCAMP3, U2SURP, TSR1, WDR3, ADD1, CAPRIN1, CCNH, CPSF7, EXOSC10, GTF2H3, MAP4, NBN, POLA1, PSIP1, RAB2A, RFC3, RPL18A, SNRNP40, SRBD1, TAGLN2, TMPO, TPX2, AP1B1, BAG2, BBX, ELMSAN1, CALD1, CANX, CDK7, COPA, CSNK2A2, DDX46, EGFR, ERGIC1, GEMIN5, GTF3C2, PKP3, POLR1B, POLR2E, RALY, SMC4, STRBP, THOC7, TRIP12, WDR33, ATP6V0D1, C7orf50, CAV1, CLINT1, COBL, CPSF1, CTTN, DDB1, DIDO1, DNAJC9, EDC4, EIF2S2, ESYT1, HCFC1, INTS1, MORF4L2, PCF11, PPP2CA, RAB14, RAB6B, RPL15, RPS7P4, SMARCA5, THOC1, TPM2, UBC, ZNF638, AKAP8, AP2A1, AP2A2, AP2B1, ARG1, CHERP, EPRS, EXOSC7, EXOSC8, FBL, GEMIN4, HNRNPCL1, HNRNPF, HNRNPH1, ITGB1, KIAA1033, MED4, MYO1F, NIPBL, NUMA1, PABPC4, PELP1, PGRMC1, PPP1R12A, PRPF19, RAB6A, RAD21, RBM10, RPL10L, RPL13P12, RPL18, RPRD2, RPS3A, RTN4, RUVBL2, SEH1L, SCAF4, SMARCC2, TCERG1, TERF2, TEX10, USP7, WAPAL, WDHD1, ZCCHC8, ZFR, ZNF598, HUWE1, APITD1, STRA13, RPAIN, XPC, SUPT16H, PARP2, SSRP1, CETN2, HMCES, HIST2H2AB, HYPK, DARS, DARS2, UBE2A, TXNDC5, KRAS, CEP162, MAX, RBPJ, TP53, FOXA1, FOXA3, FOXB1, FOXJ3, FOXN1, FOXP1, NF2, USP37, NFATC2, EYA1, EYA4, POLL, ERCC1, STYX, SPTA1, DLD, VCP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneRPA2chr19:47658470chr1:28233793ENST00000313433-08187_270127359RAD52%2C TIPIN%2C UNG and XPA
TgeneRPA2chr19:47658470chr1:28233793ENST00000373909-19187_27047279RAD52%2C TIPIN%2C UNG and XPA
TgeneRPA2chr19:47658470chr1:28233793ENST00000373912-19187_27039271RAD52%2C TIPIN%2C UNG and XPA


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SAE1_RPA2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SAE1_RPA2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource