FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32456

FusionGeneSummary for RYR1_SEMA4A

check button Fusion gene summary
Fusion gene informationFusion gene name: RYR1_SEMA4A
Fusion gene ID: 32456
HgeneTgene
Gene symbol

RYR1

SEMA4A

Gene ID

6261

64218

Gene nameryanodine receptor 1semaphorin 4A
SynonymsCCO|MHS|MHS1|PPP1R137|RYDR|RYR|RYR-1|SKRRCORD10|RP35|SEMAB|SEMB
Cytomap

19q13.2

1q22

Type of geneprotein-codingprotein-coding
Descriptionryanodine receptor 1central core disease of muscleprotein phosphatase 1, regulatory subunit 137ryanodine receptor 1 (skeletal)sarcoplasmic reticulum calcium release channelskeletal muscle calcium release channelskeletal muscle ryanodine receptortypsemaphorin-4Asema Bsema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4Asemaphorin-B
Modification date2018052320180523
UniProtAcc

P21817

Q9H3S1

Ensembl transtripts involved in fusion geneENST00000355481, ENST00000360985, 
ENST00000359596, 
ENST00000355014, 
ENST00000368285, ENST00000368284, 
ENST00000368286, ENST00000368282, 
ENST00000487358, 
Fusion gene scores* DoF score3 X 3 X 3=273 X 2 X 3=18
# samples 34
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/18*10)=1.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RYR1 [Title/Abstract] AND SEMA4A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRYR1

GO:0001666

response to hypoxia

19120137


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-51-6867-01ARYR1chr19

39058557

+SEMA4Achr1

156142617

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000355481ENST00000355014RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000355481ENST00000368285RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000355481ENST00000368284RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000355481ENST00000368286RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000355481ENST00000368282RYR1chr19

39058557

+SEMA4Achr1

156142617

+
5CDS-3UTRENST00000355481ENST00000487358RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000360985ENST00000355014RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000360985ENST00000368285RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000360985ENST00000368284RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000360985ENST00000368286RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000360985ENST00000368282RYR1chr19

39058557

+SEMA4Achr1

156142617

+
5CDS-3UTRENST00000360985ENST00000487358RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000359596ENST00000355014RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000359596ENST00000368285RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000359596ENST00000368284RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000359596ENST00000368286RYR1chr19

39058557

+SEMA4Achr1

156142617

+
In-frameENST00000359596ENST00000368282RYR1chr19

39058557

+SEMA4Achr1

156142617

+
5CDS-3UTRENST00000359596ENST00000487358RYR1chr19

39058557

+SEMA4Achr1

156142617

+

Top

FusionProtFeatures for RYR1_SEMA4A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RYR1

P21817

SEMA4A

Q9H3S1

Calcium channel that mediates the release of Ca(2+) fromthe sarcoplasmic reticulum into the cytoplasm and thereby plays akey role in triggering muscle contraction following depolarizationof T-tubules (PubMed:11741831, PubMed:16163667). Repeated veryhigh-level exercise increases the open probability of the channeland leads to Ca(2+) leaking into the cytoplasm (PubMed:18268335).Can also mediate the release of Ca(2+) from intracellular storesin neurons, and may thereby promote prolonged Ca(2+) signaling inthe brain. Required for normal embryonic development of musclefibers and skeletal muscle. Required for normal heartmorphogenesis, skin development and ossification duringembryogenesis (By similarity). {ECO:0000250|UniProtKB:E9PZQ0,ECO:0000269|PubMed:18268335, ECO:0000305|PubMed:11741831,ECO:0000305|PubMed:16163667}. Cell surface receptor for PLXNB1, PLXNB2, PLXNB3 andPLXND1 that plays an important role in cell-cell signaling. Playsa role in priming antigen-specific T-cells, promotesdifferentiation of Th1 T-helper cells, and thereby contributes toadaptive immunity. Promotes phosphorylation of TIMD2. Inhibitsangiogenesis. Promotes axon growth cone collapse. Inhibits axonalextension by providing local signals to specify territoriesinaccessible for growing axons (By similarity).{ECO:0000250|UniProtKB:Q62178}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921051873_192445485034Compositional biasNote=Glu-rich (acidic)
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054462_453245485034Compositional biasNote=Pro-rich
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931061873_192445535039Compositional biasNote=Glu-rich (acidic)
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064462_453245535039Compositional biasNote=Pro-rich
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921051873_192445485034Compositional biasNote=Glu-rich (acidic)
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054462_453245485034Compositional biasNote=Pro-rich
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921051013_120845485034DomainB30.2/SPRY 2
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921051356_157045485034DomainB30.2/SPRY 3
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+92105159_20445485034DomainMIR 2
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+92105210_26445485034DomainMIR 3
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+92105270_32745485034DomainMIR 4
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+92105335_39245485034DomainMIR 5
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054074_410245485034DomainEF-hand
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+92105581_79745485034DomainB30.2/SPRY 1
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+9210597_15245485034DomainMIR 1
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931061013_120845535039DomainB30.2/SPRY 2
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931061356_157045535039DomainB30.2/SPRY 3
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+93106159_20445535039DomainMIR 2
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+93106210_26445535039DomainMIR 3
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+93106270_32745535039DomainMIR 4
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+93106335_39245535039DomainMIR 5
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064074_410245535039DomainEF-hand
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+93106581_79745535039DomainB30.2/SPRY 1
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+9310697_15245535039DomainMIR 1
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921051013_120845485034DomainB30.2/SPRY 2
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921051356_157045485034DomainB30.2/SPRY 3
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+92105159_20445485034DomainMIR 2
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+92105210_26445485034DomainMIR 3
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+92105270_32745485034DomainMIR 4
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+92105335_39245485034DomainMIR 5
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054074_410245485034DomainEF-hand
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+92105581_79745485034DomainB30.2/SPRY 1
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+9210597_15245485034DomainMIR 1
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054210_421445485034Nucleotide bindingATP
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064210_421445535039Nucleotide bindingATP
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054210_421445485034Nucleotide bindingATP
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+92105841_295945485034RegionNote=6 X approximate repeats
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+93106841_295945535039RegionNote=6 X approximate repeats
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+92105841_295945485034RegionNote=6 X approximate repeats
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921051344_135945485034RepeatNote=3%3B truncated
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921051372_138745485034RepeatNote=4%3B truncated
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921052726_284545485034RepeatNote=5
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921052846_295945485034RepeatNote=6
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+92105841_95445485034RepeatNote=1
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+92105955_106845485034RepeatNote=2
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931061344_135945535039RepeatNote=3%3B truncated
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931061372_138745535039RepeatNote=4%3B truncated
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931062726_284545535039RepeatNote=5
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931062846_295945535039RepeatNote=6
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+93106841_95445535039RepeatNote=1
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+93106955_106845535039RepeatNote=2
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921051344_135945485034RepeatNote=3%3B truncated
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921051372_138745485034RepeatNote=4%3B truncated
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921052726_284545485034RepeatNote=5
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921052846_295945485034RepeatNote=6
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+92105841_95445485034RepeatNote=1
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+92105955_106845485034RepeatNote=2
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000355014+915496_548378762DomainNote=PSI
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000355014+915573_631378762DomainNote=Ig-like C2-type
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368282+814496_548378762DomainNote=PSI
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368282+814573_631378762DomainNote=Ig-like C2-type
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368284+713496_548246630DomainNote=PSI
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368284+713573_631246630DomainNote=Ig-like C2-type
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368285+915496_548378762DomainNote=PSI
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368285+915573_631378762DomainNote=Ig-like C2-type
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368286+814496_548246630DomainNote=PSI
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368286+814573_631246630DomainNote=Ig-like C2-type
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000355014+915705_761378762Topological domainCytoplasmic
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368282+814705_761378762Topological domainCytoplasmic
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368284+713705_761246630Topological domainCytoplasmic
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368285+915705_761378762Topological domainCytoplasmic
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368286+814705_761246630Topological domainCytoplasmic
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000355014+915684_704378762TransmembraneHelical
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368282+814684_704378762TransmembraneHelical
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368284+713684_704246630TransmembraneHelical
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368285+915684_704378762TransmembraneHelical
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368286+814684_704246630TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054881_490045485034IntramembranePore-forming
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064881_490045535039IntramembranePore-forming
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054881_490045485034IntramembranePore-forming
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054895_490145485034MotifSelectivity filter
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064895_490145535039MotifSelectivity filter
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054895_490145485034MotifSelectivity filter
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054955_496045485034Nucleotide bindingATP
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054980_498645485034Nucleotide bindingATP
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064955_496045535039Nucleotide bindingATP
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064980_498645535039Nucleotide bindingATP
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054955_496045485034Nucleotide bindingATP
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054980_498645485034Nucleotide bindingATP
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921051_455945485034Topological domainCytoplasmic
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054581_464145485034Topological domainLumenal
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054663_478045485034Topological domainCytoplasmic
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054804_480445485034Topological domainLumenal
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054822_483645485034Topological domainCytoplasmic
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054858_488045485034Topological domainLumenal
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054901_492045485034Topological domainLumenal
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054942_503845485034Topological domainCytoplasmic
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931061_455945535039Topological domainCytoplasmic
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064581_464145535039Topological domainLumenal
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064663_478045535039Topological domainCytoplasmic
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064804_480445535039Topological domainLumenal
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064822_483645535039Topological domainCytoplasmic
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064858_488045535039Topological domainLumenal
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064901_492045535039Topological domainLumenal
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064942_503845535039Topological domainCytoplasmic
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921051_455945485034Topological domainCytoplasmic
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054581_464145485034Topological domainLumenal
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054663_478045485034Topological domainCytoplasmic
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054804_480445485034Topological domainLumenal
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054822_483645485034Topological domainCytoplasmic
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054858_488045485034Topological domainLumenal
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054901_492045485034Topological domainLumenal
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054942_503845485034Topological domainCytoplasmic
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054560_458045485034TransmembraneHelical%3B Name%3D1
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054642_466245485034TransmembraneHelical%3B Name%3D2
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054781_480345485034TransmembraneHelical%3B Name%3D3
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054805_482145485034TransmembraneHelical%3B Name%3D4
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054837_485745485034TransmembraneHelical%3B Name%3D5
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921054921_494145485034TransmembraneHelical%3B Name%3D6
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064560_458045535039TransmembraneHelical%3B Name%3D1
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064642_466245535039TransmembraneHelical%3B Name%3D2
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064781_480345535039TransmembraneHelical%3B Name%3D3
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064805_482145535039TransmembraneHelical%3B Name%3D4
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064837_485745535039TransmembraneHelical%3B Name%3D5
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931064921_494145535039TransmembraneHelical%3B Name%3D6
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054560_458045485034TransmembraneHelical%3B Name%3D1
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054642_466245485034TransmembraneHelical%3B Name%3D2
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054781_480345485034TransmembraneHelical%3B Name%3D3
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054805_482145485034TransmembraneHelical%3B Name%3D4
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054837_485745485034TransmembraneHelical%3B Name%3D5
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921054921_494145485034TransmembraneHelical%3B Name%3D6
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000355014+91536_494378762DomainSema
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368282+81436_494378762DomainSema
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368284+71336_494246630DomainSema
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368285+91536_494378762DomainSema
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368286+81436_494246630DomainSema
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000355014+91533_683378762Topological domainExtracellular
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368282+81433_683378762Topological domainExtracellular
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368284+71333_683246630Topological domainExtracellular
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368285+91533_683378762Topological domainExtracellular
TgeneSEMA4Achr19:39058557chr1:156142617ENST00000368286+81433_683246630Topological domainExtracellular


Top

FusionGeneSequence for RYR1_SEMA4A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000355014_chr1_156142617_+_4932aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKSGGSDQERTKKKRRGDRYSVQTSLIVATLK
KMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYY
LDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKP
DPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQMISAC
KGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMA
DDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLT
EYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVE
MILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVL
LTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVS
FCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRLRRLTA
REAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDA
AEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELEPEKAD
AENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLAR
DPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFVTVTVL

>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000368285_chr1_156142617_+_4932aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKSGGSDQERTKKKRRGDRYSVQTSLIVATLK
KMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYY
LDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKP
DPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQMISAC
KGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMA
DDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLT
EYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVE
MILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVL
LTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVS
FCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRLRRLTA
REAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDA
AEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELEPEKAD
AENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLAR
DPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFVTVTVL

>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000368284_chr1_156142617_+_4932aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKSGGSDQERTKKKRRGDRYSVQTSLIVATLK
KMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYY
LDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKP
DPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQMISAC
KGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMA
DDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLT
EYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVE
MILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVL
LTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVS
FCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRLRRLTA
REAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDA
AEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELEPEKAD
AENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLAR
DPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFVTVTVL

>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000368286_chr1_156142617_+_4932aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKSGGSDQERTKKKRRGDRYSVQTSLIVATLK
KMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYY
LDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKP
DPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQMISAC
KGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMA
DDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLT
EYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVE
MILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVL
LTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVS
FCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRLRRLTA
REAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDA
AEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELEPEKAD
AENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLAR
DPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFVTVTVL

>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000368282_chr1_156142617_+_4932aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKSGGSDQERTKKKRRGDRYSVQTSLIVATLK
KMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYY
LDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKP
DPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQMISAC
KGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMA
DDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLT
EYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVE
MILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVL
LTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVS
FCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRLRRLTA
REAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDA
AEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELEPEKAD
AENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLAR
DPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFVTVTVL

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000355014_chr1_156142617_+_4932aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDIQSGGSDQERTKKKRRGDRYSVQTSLI
VATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVS
AVLYYLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEV
EEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQ
MISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVGEKVMA
DDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLT
EYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVE
MILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVL
LTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVS
FCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRLRRLTA
REAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDA
AEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELEPEKAD
AENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLAR
DPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFVTVTVL

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000368285_chr1_156142617_+_4932aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDIQSGGSDQERTKKKRRGDRYSVQTSLI
VATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVS
AVLYYLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEV
EEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQ
MISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVGEKVMA
DDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLT
EYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVE
MILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVL
LTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVS
FCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRLRRLTA
REAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDA
AEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELEPEKAD
AENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLAR
DPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFVTVTVL

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000368284_chr1_156142617_+_4932aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDIQSGGSDQERTKKKRRGDRYSVQTSLI
VATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVS
AVLYYLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEV
EEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQ
MISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVGEKVMA
DDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLT
EYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVE
MILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVL
LTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVS
FCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRLRRLTA
REAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDA
AEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELEPEKAD
AENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLAR
DPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFVTVTVL

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000368286_chr1_156142617_+_4932aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDIQSGGSDQERTKKKRRGDRYSVQTSLI
VATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVS
AVLYYLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEV
EEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQ
MISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVGEKVMA
DDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLT
EYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVE
MILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVL
LTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVS
FCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRLRRLTA
REAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDA
AEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELEPEKAD
AENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLAR
DPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFVTVTVL

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000368282_chr1_156142617_+_4932aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDIQSGGSDQERTKKKRRGDRYSVQTSLI
VATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVS
AVLYYLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEV
EEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQ
MISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVGEKVMA
DDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLT
EYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVE
MILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVL
LTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVS
FCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRLRRLTA
REAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDA
AEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELEPEKAD
AENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLAR
DPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFVTVTVL

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000355014_chr1_156142617_+_4937aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDIQSGGSDQERTKKKRRGDRYSVQTSLI
VATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVS
AVLYYLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEV
EEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQ
MISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNG
EKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQV
FNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVES
SSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGF
NVAVLLTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKM
ELFVSFCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRL
RRLTAREAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASE
GAGDAAEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELE
PEKADAENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEY
TRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVD
CVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGP
AAVPEASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFV

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000368285_chr1_156142617_+_4937aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDIQSGGSDQERTKKKRRGDRYSVQTSLI
VATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVS
AVLYYLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEV
EEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQ
MISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNG
EKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQV
FNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVES
SSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGF
NVAVLLTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKM
ELFVSFCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRL
RRLTAREAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASE
GAGDAAEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELE
PEKADAENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEY
TRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVD
CVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGP
AAVPEASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFV

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000368284_chr1_156142617_+_4937aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDIQSGGSDQERTKKKRRGDRYSVQTSLI
VATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVS
AVLYYLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEV
EEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQ
MISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNG
EKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQV
FNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVES
SSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGF
NVAVLLTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKM
ELFVSFCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRL
RRLTAREAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASE
GAGDAAEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELE
PEKADAENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEY
TRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVD
CVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGP
AAVPEASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFV

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000368286_chr1_156142617_+_4937aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDIQSGGSDQERTKKKRRGDRYSVQTSLI
VATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVS
AVLYYLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEV
EEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQ
MISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNG
EKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQV
FNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVES
SSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGF
NVAVLLTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKM
ELFVSFCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRL
RRLTAREAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASE
GAGDAAEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELE
PEKADAENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEY
TRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVD
CVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGP
AAVPEASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFV

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000368282_chr1_156142617_+_4937aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVRALQEMLANTVEAGVE
SSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSG
SHLRWGQPLRVRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIY
FEPPSEDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGREL
LLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPC
HEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAEN
GHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMS
DSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWSEAENGKEG
TAKEGAPGGTPQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMIEPEVFTEEEEEEDEEEEGEEEDEE
EKEEDEEETAQEKEDEEKEEEEAAEGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLAHCGIQLDGEEEEPEEETTLGSRLMSLLEKV
RLVKKKEEKPEEERSAEESKPRSLQELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSM
FDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALI
DLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMSL
CRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPM
LRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDIS
QEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQH
QFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGID
EASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDIQSGGSDQERTKKKRRGDRYSVQTSLI
VATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVS
AVLYYLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEV
EEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQ
MISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNG
EKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQV
FNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVES
SSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGF
NVAVLLTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKM
ELFVSFCEDTIFEMQIAAQISEPEGEPETDEDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRL
RRLTAREAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASE
GAGDAAEGAGDEEEAVHEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELE
PEKADAENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEY
TRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVD
CVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGP
AAVPEASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000355014_chr1_156142617_+_14796nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
TCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAG
AAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACA
GATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTG
TACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTAC
CTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGT
TTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAA
GACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCA
GACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTAT
GCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAA
CAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGC
AAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATG
CTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCC
TTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGAGAGAAGGTCATGGCG
GATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAG
ACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTAC
TACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACT
GAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTC
GCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATG
TTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAG
ATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGC
CTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAA
GCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTG
CTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCC
TACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAG
ATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGT
TTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCG
GGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCG
CGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCC
CGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTG
GGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGAC
CCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCC
GCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCC
TTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAG
AGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGAT
GCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAG
GAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACC
TTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTG
GAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGG
GACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCA
GTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGG
GACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGG
GGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCT
GTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAA
GCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGC
TTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCAT
GTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTC
TTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAG
ACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGAC

>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000368285_chr1_156142617_+_14796nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
TCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAG
AAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACA
GATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTG
TACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTAC
CTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGT
TTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAA
GACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCA
GACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTAT
GCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAA
CAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGC
AAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATG
CTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCC
TTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGAGAGAAGGTCATGGCG
GATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAG
ACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTAC
TACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACT
GAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTC
GCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATG
TTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAG
ATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGC
CTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAA
GCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTG
CTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCC
TACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAG
ATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGT
TTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCG
GGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCG
CGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCC
CGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTG
GGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGAC
CCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCC
GCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCC
TTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAG
AGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGAT
GCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAG
GAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACC
TTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTG
GAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGG
GACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCA
GTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGG
GACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGG
GGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCT
GTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAA
GCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGC
TTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCAT
GTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTC
TTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAG
ACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGAC

>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000368284_chr1_156142617_+_14796nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
TCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAG
AAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACA
GATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTG
TACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTAC
CTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGT
TTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAA
GACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCA
GACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTAT
GCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAA
CAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGC
AAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATG
CTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCC
TTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGAGAGAAGGTCATGGCG
GATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAG
ACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTAC
TACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACT
GAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTC
GCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATG
TTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAG
ATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGC
CTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAA
GCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTG
CTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCC
TACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAG
ATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGT
TTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCG
GGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCG
CGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCC
CGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTG
GGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGAC
CCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCC
GCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCC
TTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAG
AGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGAT
GCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAG
GAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACC
TTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTG
GAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGG
GACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCA
GTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGG
GACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGG
GGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCT
GTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAA
GCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGC
TTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCAT
GTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTC
TTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAG
ACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGAC

>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000368286_chr1_156142617_+_14796nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
TCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAG
AAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACA
GATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTG
TACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTAC
CTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGT
TTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAA
GACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCA
GACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTAT
GCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAA
CAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGC
AAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATG
CTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCC
TTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGAGAGAAGGTCATGGCG
GATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAG
ACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTAC
TACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACT
GAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTC
GCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATG
TTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAG
ATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGC
CTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAA
GCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTG
CTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCC
TACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAG
ATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGT
TTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCG
GGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCG
CGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCC
CGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTG
GGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGAC
CCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCC
GCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCC
TTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAG
AGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGAT
GCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAG
GAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACC
TTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTG
GAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGG
GACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCA
GTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGG
GACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGG
GGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCT
GTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAA
GCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGC
TTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCAT
GTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTC
TTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAG
ACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGAC

>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000368282_chr1_156142617_+_14796nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
TCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAG
AAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACA
GATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTG
TACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTAC
CTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGT
TTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAA
GACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCA
GACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTAT
GCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAA
CAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGC
AAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATG
CTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCC
TTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGAGAGAAGGTCATGGCG
GATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAG
ACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTAC
TACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACT
GAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTC
GCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATG
TTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAG
ATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGC
CTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAA
GCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTG
CTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCC
TACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAG
ATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGT
TTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCG
GGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCG
CGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCC
CGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTG
GGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGAC
CCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCC
GCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCC
TTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAG
AGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGAT
GCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAG
GAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACC
TTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTG
GAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGG
GACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCA
GTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGG
GACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGG
GGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCT
GTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAA
GCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGC
TTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCAT
GTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTC
TTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAG
ACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGAC

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000355014_chr1_156142617_+_14796nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTAGGAGAGAAGGTCATGGCG
GATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAG
ACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTAC
TACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACT
GAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTC
GCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATG
TTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAG
ATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGC
CTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAA
GCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTG
CTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCC
TACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAG
ATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGT
TTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCG
GGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCG
CGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCC
CGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTG
GGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGAC
CCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCC
GCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCC
TTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAG
AGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGAT
GCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAG
GAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACC
TTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTG
GAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGG
GACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCA
GTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGG
GACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGG
GGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCT
GTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAA
GCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGC
TTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCAT
GTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTC
TTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAG
ACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGAC

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000368285_chr1_156142617_+_14796nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTAGGAGAGAAGGTCATGGCG
GATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAG
ACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTAC
TACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACT
GAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTC
GCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATG
TTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAG
ATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGC
CTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAA
GCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTG
CTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCC
TACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAG
ATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGT
TTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCG
GGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCG
CGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCC
CGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTG
GGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGAC
CCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCC
GCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCC
TTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAG
AGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGAT
GCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAG
GAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACC
TTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTG
GAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGG
GACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCA
GTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGG
GACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGG
GGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCT
GTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAA
GCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGC
TTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCAT
GTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTC
TTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAG
ACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGAC

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000368284_chr1_156142617_+_14796nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTAGGAGAGAAGGTCATGGCG
GATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAG
ACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTAC
TACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACT
GAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTC
GCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATG
TTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAG
ATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGC
CTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAA
GCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTG
CTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCC
TACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAG
ATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGT
TTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCG
GGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCG
CGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCC
CGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTG
GGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGAC
CCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCC
GCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCC
TTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAG
AGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGAT
GCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAG
GAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACC
TTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTG
GAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGG
GACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCA
GTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGG
GACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGG
GGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCT
GTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAA
GCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGC
TTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCAT
GTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTC
TTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAG
ACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGAC

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000368286_chr1_156142617_+_14796nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTAGGAGAGAAGGTCATGGCG
GATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAG
ACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTAC
TACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACT
GAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTC
GCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATG
TTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAG
ATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGC
CTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAA
GCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTG
CTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCC
TACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAG
ATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGT
TTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCG
GGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCG
CGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCC
CGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTG
GGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGAC
CCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCC
GCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCC
TTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAG
AGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGAT
GCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAG
GAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACC
TTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTG
GAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGG
GACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCA
GTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGG
GACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGG
GGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCT
GTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAA
GCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGC
TTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCAT
GTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTC
TTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAG
ACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGAC

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000368282_chr1_156142617_+_14796nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTAGGAGAGAAGGTCATGGCG
GATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAG
ACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTAC
TACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACT
GAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTC
GCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATG
TTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAG
ATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGC
CTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAA
GCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTG
CTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCC
TACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAG
ATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGT
TTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCG
GGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCG
CGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCC
CGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTG
GGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGAC
CCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCC
GCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCC
TTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAG
AGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGAT
GCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAG
GAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACC
TTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTG
GAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGG
GACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCA
GTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGG
GACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGG
GGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCT
GTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAA
GCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGC
TTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCAT
GTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTC
TTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAG
ACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGAC

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000355014_chr1_156142617_+_14811nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGA
GAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAAC
TACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGC
GACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTG
TTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGA
TTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAG
GACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCC
TCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTA
ACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTG
CTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTC
AACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTT
GAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAAC
CGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATG
GAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGAC
GAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCG
GCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTG
CGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCG
GCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTG
GCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAG
GGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTG
ACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGC
TCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAG
CCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCC
CCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCT
GATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTAT
ACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAG
GCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCC
CCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGAC
TGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAG
CAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATT
AAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCA
GCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGG
GCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGC
ATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTC
ACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAG
GTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCT

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000368285_chr1_156142617_+_14811nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGA
GAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAAC
TACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGC
GACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTG
TTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGA
TTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAG
GACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCC
TCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTA
ACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTG
CTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTC
AACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTT
GAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAAC
CGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATG
GAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGAC
GAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCG
GCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTG
CGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCG
GCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTG
GCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAG
GGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTG
ACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGC
TCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAG
CCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCC
CCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCT
GATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTAT
ACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAG
GCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCC
CCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGAC
TGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAG
CAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATT
AAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCA
GCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGG
GCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGC
ATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTC
ACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAG
GTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCT

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000368284_chr1_156142617_+_14811nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGA
GAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAAC
TACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGC
GACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTG
TTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGA
TTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAG
GACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCC
TCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTA
ACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTG
CTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTC
AACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTT
GAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAAC
CGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATG
GAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGAC
GAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCG
GCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTG
CGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCG
GCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTG
GCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAG
GGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTG
ACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGC
TCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAG
CCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCC
CCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCT
GATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTAT
ACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAG
GCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCC
CCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGAC
TGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAG
CAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATT
AAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCA
GCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGG
GCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGC
ATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTC
ACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAG
GTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCT

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000368286_chr1_156142617_+_14811nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGA
GAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAAC
TACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGC
GACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTG
TTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGA
TTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAG
GACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCC
TCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTA
ACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTG
CTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTC
AACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTT
GAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAAC
CGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATG
GAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGAC
GAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCG
GCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTG
CGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCG
GCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTG
GCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAG
GGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTG
ACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGC
TCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAG
CCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCC
CCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCT
GATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTAT
ACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAG
GCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCC
CCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGAC
TGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAG
CAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATT
AAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCA
GCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGG
GCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGC
ATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTC
ACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAG
GTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCT

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000368282_chr1_156142617_+_14811nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGA
GAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAAC
TACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGC
GACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTG
TTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGA
TTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAG
GACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCC
TCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTA
ACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTG
CTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTC
AACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTT
GAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAAC
CGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATG
GAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGAC
GAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCG
GCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTG
CGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCG
GCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTG
GCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAG
GGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTG
ACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGC
TCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAG
CCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCC
CCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCT
GATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTAT
ACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAG
GCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCC
CCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGAC
TGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAG
CAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATT
AAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCA
GCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGG
GCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGC
ATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTC
ACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAG
GTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000355014_chr1_156142617_+_15674nt
ATCTACCTCGCGGGTGCCTCTGGTGTCTCCAGAGGTCTCCGACCCCAGCCCGCCCCCAGCCCTCCCGCCCAGCCCGCAGCCCCCTCCCTC
TGTTCCCCGACCTCAGACCCTGGGCTTCCGACCTCGACATCATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACG
ATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAGCAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCT
TCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGATCTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCC
TGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAGTCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCC
TGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTCACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGC
AGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCACCCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATG
ACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCACCTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGA
CACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAGGGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGG
ATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAGCGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCT
CCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGGAGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCG
GGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTGGTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCA
TCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTGGAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCG
TGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCTCCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGC
TGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACCCGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCA
ATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTCAGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCA
TCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTACTTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGC
TGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAGGGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACA
CCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCAGCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTT
CTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCCACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGT
CTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGTCCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCT
CCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGACGTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACC
AAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTTCTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACA
TCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAATGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTC
AGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGCTACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCG
GCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTCTGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCC
TGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGCGTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCT
TTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTCAGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATG
GTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGCCATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGG
AGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGCCCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACA
CTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGGGAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCG
AGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAGAGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGA
GGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACTCTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGG
ACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATGAGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGA
CGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAATGGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACA
GCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTGGTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACA
GCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTACAACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTC
GTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTATACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAG
GCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCTGATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACC
GCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGCCCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGA
ACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCTGACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCT
TCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCATCTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTG
GCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAGCGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAG
TGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGACGGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGG
GCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTGAGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCA
CCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGACGAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCT
CAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGGACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGG
CGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACCGAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCA
TGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTCCCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCC
TCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCTGGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACC
ATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTCGTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCA
AGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTGAGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGT
GCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCCAATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGC
TATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTCATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCG
CCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGCCCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCA
TGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGCGAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGG
CGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTGGAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGC
GCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTGGCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCC
TGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTACTATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCC
GCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAGACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTC
ACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCGCTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGC
CAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCTGCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGG
AGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTCGGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCA
CCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAACAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGG
AGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAGGAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGG
AAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAAGGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGT
TACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAGCTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGG
ACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTCATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCG
AGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTGCAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGA
TTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCACACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGA
CCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTGCGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAG
AGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCACATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGG
TGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGGCTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGT
CCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGCCAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACC
TCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTCTTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGG
TCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCCAAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCT
GCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATGTTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCA
TGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTCATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAA
AGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGCCCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTG
GTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTCGTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGC
TCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGTGAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCT
CCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGACCGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGC
ACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATCGACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCA
AGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTTGTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTC
CCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATGTCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGG
ACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCACGTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGG
ACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTGAACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGC
CGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGACTCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCA
AGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTCTGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGG
TGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCACTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCC
TACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAGGAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGG
CCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATGCCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATG
CCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGATGCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCA
TCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAGTACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCT
ATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATGCTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCT
GGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAATGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGA
AAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGATCCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCC
TGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAAAATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCA
AAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACGCTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTAC
TGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGCCTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCT
TTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCTCAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGG
AAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAGATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATT
TCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCACGCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTG
CTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGACGCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATG
CCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCTGGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGG
TGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACCCAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGC
TGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCACCAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACC
GAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAACACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTC
TGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTGAACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGC
GGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGTCCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGG
CCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATCGAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGC
GCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCCCCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGG
GGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGACGAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGA
GCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCAACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGG
AGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGCGAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACG
CCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGGGCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGA
TGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAACTTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACA
TGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACC
GGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACC
TCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAA
AGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAA
TCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACA
AGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACA
TGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGG
AGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGG
AAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACG
GTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCC
GGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCT
CCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCC
AGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATG
GCACTGTCATCAATCGCCAGAACGGAGAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTG
AGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACC
TCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCA
AAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACA
GTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGC
TGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGC
AGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGG
GCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGT
TCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCC
AGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACT
TCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCA
TCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGA
ACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGG
AGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGC
TCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCA
GCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGC
GCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCA
AGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAG
ACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGG
GCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGC
CTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAG
AGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCC
CCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGT
TCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCC
TGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGG
GAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTG
AACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACT
GTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGT
CTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTC
GGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGG
CCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATG
GAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCC
TGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCC
AGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCAT
TGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCC
AGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAG
GCCGGGGCTGCGGTGCAGGCACCTGGCCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCT
TTCTCCCCTGAGAGGAGCTTCTGCTACTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCC
CTTCTACCAAGCACATGAGCTCTCTAACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCT
TCAGTTCTGGCCATTCCAGGGACCCTCCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGA
ACACCAAACATCTAAACAATCATATGCTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCT
CCCAGGGTCATGCAGGGATCTGCTCCCTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCA
CCTTTCTTCTTGCTTCAGTTGGGGCAGACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTAC
CCTAGCTGACCCCTTCACCTCTCCCCCTCCCTTTTCCTTTGTTTTGGGATTCAGAAAACTGCTTGTCAGAGACTGTTTATTTTTTATTAA

>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000368285_chr1_156142617_+_15674nt
ATCTACCTCGCGGGTGCCTCTGGTGTCTCCAGAGGTCTCCGACCCCAGCCCGCCCCCAGCCCTCCCGCCCAGCCCGCAGCCCCCTCCCTC
TGTTCCCCGACCTCAGACCCTGGGCTTCCGACCTCGACATCATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACG
ATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAGCAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCT
TCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGATCTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCC
TGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAGTCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCC
TGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTCACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGC
AGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCACCCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATG
ACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCACCTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGA
CACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAGGGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGG
ATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAGCGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCT
CCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGGAGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCG
GGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTGGTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCA
TCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTGGAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCG
TGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCTCCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGC
TGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACCCGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCA
ATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTCAGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCA
TCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTACTTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGC
TGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAGGGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACA
CCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCAGCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTT
CTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCCACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGT
CTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGTCCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCT
CCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGACGTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACC
AAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTTCTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACA
TCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAATGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTC
AGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGCTACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCG
GCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTCTGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCC
TGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGCGTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCT
TTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTCAGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATG
GTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGCCATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGG
AGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGCCCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACA
CTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGGGAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCG
AGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAGAGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGA
GGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACTCTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGG
ACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATGAGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGA
CGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAATGGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACA
GCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTGGTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACA
GCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTACAACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTC
GTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTATACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAG
GCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCTGATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACC
GCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGCCCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGA
ACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCTGACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCT
TCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCATCTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTG
GCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAGCGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAG
TGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGACGGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGG
GCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTGAGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCA
CCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGACGAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCT
CAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGGACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGG
CGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACCGAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCA
TGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTCCCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCC
TCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCTGGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACC
ATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTCGTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCA
AGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTGAGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGT
GCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCCAATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGC
TATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTCATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCG
CCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGCCCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCA
TGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGCGAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGG
CGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTGGAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGC
GCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTGGCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCC
TGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTACTATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCC
GCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAGACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTC
ACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCGCTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGC
CAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCTGCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGG
AGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTCGGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCA
CCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAACAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGG
AGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAGGAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGG
AAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAAGGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGT
TACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAGCTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGG
ACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTCATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCG
AGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTGCAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGA
TTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCACACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGA
CCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTGCGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAG
AGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCACATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGG
TGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGGCTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGT
CCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGCCAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACC
TCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTCTTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGG
TCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCCAAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCT
GCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATGTTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCA
TGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTCATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAA
AGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGCCCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTG
GTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTCGTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGC
TCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGTGAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCT
CCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGACCGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGC
ACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATCGACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCA
AGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTTGTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTC
CCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATGTCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGG
ACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCACGTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGG
ACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTGAACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGC
CGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGACTCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCA
AGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTCTGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGG
TGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCACTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCC
TACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAGGAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGG
CCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATGCCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATG
CCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGATGCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCA
TCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAGTACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCT
ATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATGCTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCT
GGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAATGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGA
AAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGATCCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCC
TGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAAAATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCA
AAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACGCTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTAC
TGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGCCTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCT
TTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCTCAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGG
AAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAGATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATT
TCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCACGCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTG
CTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGACGCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATG
CCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCTGGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGG
TGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACCCAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGC
TGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCACCAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACC
GAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAACACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTC
TGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTGAACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGC
GGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGTCCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGG
CCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATCGAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGC
GCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCCCCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGG
GGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGACGAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGA
GCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCAACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGG
AGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGCGAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACG
CCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGGGCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGA
TGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAACTTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACA
TGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACC
GGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACC
TCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAA
AGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAA
TCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACA
AGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACA
TGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGG
AGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGG
AAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACG
GTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCC
GGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCT
CCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCC
AGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATG
GCACTGTCATCAATCGCCAGAACGGAGAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTG
AGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACC
TCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCA
AAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACA
GTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGC
TGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGC
AGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGG
GCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGT
TCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCC
AGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACT
TCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCA
TCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGA
ACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGG
AGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGC
TCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCA
GCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGC
GCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCA
AGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAG
ACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGG
GCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGC
CTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAG
AGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCC
CCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGT
TCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCC
TGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGG
GAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTG
AACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACT
GTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGT
CTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTC
GGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGG
CCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATG
GAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCC
TGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCC
AGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCAT
TGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCC
AGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAG
GCCGGGGCTGCGGTGCAGGCACCTGGCCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCT
TTCTCCCCTGAGAGGAGCTTCTGCTACTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCC
CTTCTACCAAGCACATGAGCTCTCTAACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCT
TCAGTTCTGGCCATTCCAGGGACCCTCCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGA
ACACCAAACATCTAAACAATCATATGCTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCT
CCCAGGGTCATGCAGGGATCTGCTCCCTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCA
CCTTTCTTCTTGCTTCAGTTGGGGCAGACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTAC
CCTAGCTGACCCCTTCACCTCTCCCCCTCCCTTTTCCTTTGTTTTGGGATTCAGAAAACTGCTTGTCAGAGACTGTTTATTTTTTATTAA

>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000368284_chr1_156142617_+_15673nt
ATCTACCTCGCGGGTGCCTCTGGTGTCTCCAGAGGTCTCCGACCCCAGCCCGCCCCCAGCCCTCCCGCCCAGCCCGCAGCCCCCTCCCTC
TGTTCCCCGACCTCAGACCCTGGGCTTCCGACCTCGACATCATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACG
ATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAGCAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCT
TCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGATCTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCC
TGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAGTCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCC
TGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTCACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGC
AGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCACCCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATG
ACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCACCTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGA
CACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAGGGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGG
ATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAGCGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCT
CCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGGAGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCG
GGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTGGTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCA
TCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTGGAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCG
TGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCTCCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGC
TGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACCCGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCA
ATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTCAGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCA
TCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTACTTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGC
TGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAGGGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACA
CCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCAGCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTT
CTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCCACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGT
CTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGTCCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCT
CCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGACGTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACC
AAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTTCTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACA
TCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAATGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTC
AGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGCTACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCG
GCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTCTGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCC
TGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGCGTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCT
TTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTCAGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATG
GTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGCCATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGG
AGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGCCCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACA
CTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGGGAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCG
AGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAGAGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGA
GGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACTCTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGG
ACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATGAGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGA
CGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAATGGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACA
GCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTGGTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACA
GCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTACAACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTC
GTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTATACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAG
GCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCTGATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACC
GCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGCCCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGA
ACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCTGACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCT
TCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCATCTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTG
GCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAGCGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAG
TGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGACGGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGG
GCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTGAGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCA
CCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGACGAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCT
CAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGGACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGG
CGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACCGAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCA
TGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTCCCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCC
TCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCTGGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACC
ATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTCGTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCA
AGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTGAGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGT
GCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCCAATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGC
TATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTCATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCG
CCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGCCCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCA
TGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGCGAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGG
CGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTGGAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGC
GCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTGGCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCC
TGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTACTATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCC
GCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAGACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTC
ACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCGCTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGC
CAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCTGCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGG
AGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTCGGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCA
CCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAACAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGG
AGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAGGAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGG
AAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAAGGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGT
TACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAGCTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGG
ACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTCATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCG
AGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTGCAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGA
TTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCACACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGA
CCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTGCGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAG
AGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCACATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGG
TGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGGCTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGT
CCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGCCAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACC
TCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTCTTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGG
TCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCCAAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCT
GCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATGTTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCA
TGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTCATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAA
AGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGCCCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTG
GTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTCGTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGC
TCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGTGAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCT
CCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGACCGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGC
ACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATCGACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCA
AGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTTGTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTC
CCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATGTCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGG
ACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCACGTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGG
ACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTGAACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGC
CGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGACTCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCA
AGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTCTGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGG
TGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCACTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCC
TACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAGGAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGG
CCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATGCCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATG
CCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGATGCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCA
TCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAGTACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCT
ATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATGCTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCT
GGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAATGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGA
AAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGATCCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCC
TGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAAAATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCA
AAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACGCTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTAC
TGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGCCTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCT
TTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCTCAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGG
AAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAGATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATT
TCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCACGCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTG
CTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGACGCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATG
CCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCTGGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGG
TGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACCCAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGC
TGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCACCAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACC
GAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAACACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTC
TGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTGAACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGC
GGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGTCCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGG
CCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATCGAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGC
GCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCCCCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGG
GGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGACGAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGA
GCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCAACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGG
AGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGCGAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACG
CCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGGGCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGA
TGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAACTTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACA
TGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACC
GGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACC
TCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAA
AGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAA
TCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACA
AGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACA
TGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGG
AGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGG
AAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACG
GTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCC
GGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCT
CCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCC
AGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATG
GCACTGTCATCAATCGCCAGAACGGAGAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTG
AGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACC
TCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCA
AAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACA
GTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGC
TGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGC
AGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGG
GCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGT
TCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCC
AGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACT
TCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCA
TCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGA
ACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGG
AGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGC
TCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCA
GCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGC
GCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCA
AGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAG
ACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGG
GCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGC
CTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAG
AGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCC
CCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGT
TCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCC
TGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGG
GAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTG
AACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACT
GTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGT
CTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTC
GGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGG
CCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATG
GAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCC
TGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCC
AGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCAT
TGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCC
AGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAG
GCCGGGGCTGCGGTGCAGGCACCTGGCCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCT
TTCTCCCCTGAGAGGAGCTTCTGCTACTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCC
CTTCTACCAAGCACATGAGCTCTCTAACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCT
TCAGTTCTGGCCATTCCAGGGACCCTCCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGA
ACACCAAACATCTAAACAATCATATGCTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCT
CCCAGGGTCATGCAGGGATCTGCTCCCTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCA
CCTTTCTTCTTGCTTCAGTTGGGGCAGACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTAC
CCTAGCTGACCCCTTCACCTCTCCCCCTCCCTTTTCCTTTGTTTTGGGATTCAGAAAACTGCTTGTCAGAGACTGTTTATTTTTTATTAA

>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000368286_chr1_156142617_+_15673nt
ATCTACCTCGCGGGTGCCTCTGGTGTCTCCAGAGGTCTCCGACCCCAGCCCGCCCCCAGCCCTCCCGCCCAGCCCGCAGCCCCCTCCCTC
TGTTCCCCGACCTCAGACCCTGGGCTTCCGACCTCGACATCATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACG
ATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAGCAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCT
TCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGATCTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCC
TGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAGTCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCC
TGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTCACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGC
AGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCACCCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATG
ACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCACCTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGA
CACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAGGGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGG
ATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAGCGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCT
CCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGGAGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCG
GGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTGGTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCA
TCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTGGAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCG
TGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCTCCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGC
TGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACCCGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCA
ATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTCAGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCA
TCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTACTTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGC
TGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAGGGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACA
CCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCAGCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTT
CTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCCACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGT
CTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGTCCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCT
CCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGACGTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACC
AAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTTCTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACA
TCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAATGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTC
AGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGCTACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCG
GCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTCTGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCC
TGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGCGTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCT
TTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTCAGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATG
GTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGCCATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGG
AGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGCCCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACA
CTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGGGAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCG
AGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAGAGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGA
GGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACTCTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGG
ACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATGAGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGA
CGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAATGGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACA
GCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTGGTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACA
GCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTACAACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTC
GTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTATACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAG
GCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCTGATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACC
GCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGCCCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGA
ACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCTGACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCT
TCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCATCTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTG
GCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAGCGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAG
TGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGACGGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGG
GCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTGAGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCA
CCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGACGAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCT
CAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGGACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGG
CGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACCGAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCA
TGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTCCCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCC
TCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCTGGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACC
ATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTCGTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCA
AGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTGAGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGT
GCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCCAATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGC
TATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTCATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCG
CCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGCCCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCA
TGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGCGAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGG
CGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTGGAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGC
GCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTGGCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCC
TGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTACTATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCC
GCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAGACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTC
ACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCGCTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGC
CAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCTGCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGG
AGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTCGGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCA
CCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAACAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGG
AGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAGGAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGG
AAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAAGGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGT
TACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAGCTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGG
ACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTCATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCG
AGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTGCAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGA
TTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCACACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGA
CCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTGCGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAG
AGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCACATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGG
TGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGGCTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGT
CCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGCCAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACC
TCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTCTTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGG
TCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCCAAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCT
GCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATGTTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCA
TGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTCATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAA
AGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGCCCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTG
GTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTCGTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGC
TCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGTGAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCT
CCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGACCGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGC
ACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATCGACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCA
AGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTTGTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTC
CCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATGTCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGG
ACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCACGTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGG
ACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTGAACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGC
CGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGACTCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCA
AGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTCTGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGG
TGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCACTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCC
TACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAGGAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGG
CCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATGCCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATG
CCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGATGCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCA
TCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAGTACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCT
ATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATGCTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCT
GGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAATGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGA
AAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGATCCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCC
TGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAAAATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCA
AAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACGCTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTAC
TGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGCCTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCT
TTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCTCAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGG
AAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAGATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATT
TCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCACGCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTG
CTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGACGCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATG
CCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCTGGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGG
TGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACCCAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGC
TGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCACCAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACC
GAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAACACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTC
TGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTGAACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGC
GGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGTCCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGG
CCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATCGAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGC
GCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCCCCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGG
GGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGACGAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGA
GCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCAACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGG
AGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGCGAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACG
CCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGGGCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGA
TGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAACTTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACA
TGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACC
GGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACC
TCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAA
AGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAA
TCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACA
AGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACA
TGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGG
AGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGG
AAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACG
GTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCC
GGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCT
CCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCC
AGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATG
GCACTGTCATCAATCGCCAGAACGGAGAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTG
AGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACC
TCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCA
AAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACA
GTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGC
TGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGC
AGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGG
GCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGT
TCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCC
AGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACT
TCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCA
TCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGA
ACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGG
AGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGC
TCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCA
GCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGC
GCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCA
AGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAG
ACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGG
GCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGC
CTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAG
AGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCC
CCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGT
TCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCC
TGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGG
GAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTG
AACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACT
GTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGT
CTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTC
GGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGG
CCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATG
GAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCC
TGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCC
AGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCAT
TGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCC
AGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAG
GCCGGGGCTGCGGTGCAGGCACCTGGCCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCT
TTCTCCCCTGAGAGGAGCTTCTGCTACTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCC
CTTCTACCAAGCACATGAGCTCTCTAACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCT
TCAGTTCTGGCCATTCCAGGGACCCTCCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGA
ACACCAAACATCTAAACAATCATATGCTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCT
CCCAGGGTCATGCAGGGATCTGCTCCCTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCA
CCTTTCTTCTTGCTTCAGTTGGGGCAGACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTAC
CCTAGCTGACCCCTTCACCTCTCCCCCTCCCTTTTCCTTTGTTTTGGGATTCAGAAAACTGCTTGTCAGAGACTGTTTATTTTTTATTAA

>In-frame_RYR1_ENST00000355481_chr19_39058557_+_SEMA4A_ENST00000368282_chr1_156142617_+_15682nt
ATCTACCTCGCGGGTGCCTCTGGTGTCTCCAGAGGTCTCCGACCCCAGCCCGCCCCCAGCCCTCCCGCCCAGCCCGCAGCCCCCTCCCTC
TGTTCCCCGACCTCAGACCCTGGGCTTCCGACCTCGACATCATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACG
ATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAGCAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCT
TCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGATCTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCC
TGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAGTCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCC
TGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTCACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGC
AGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCACCCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATG
ACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCACCTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGA
CACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAGGGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGG
ATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAGCGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCT
CCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGGAGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCG
GGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTGGTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCA
TCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTGGAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCG
TGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCTCCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGC
TGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACCCGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCA
ATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTCAGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCA
TCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTACTTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGC
TGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAGGGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACA
CCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCAGCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTT
CTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCCACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGT
CTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGTCCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCT
CCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGACGTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACC
AAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTTCTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACA
TCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAATGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTC
AGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGCTACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCG
GCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTCTGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCC
TGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGCGTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCT
TTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTCAGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATG
GTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGCCATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGG
AGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGCCCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACA
CTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGGGAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCG
AGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAGAGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGA
GGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACTCTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGG
ACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATGAGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGA
CGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAATGGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACA
GCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTGGTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACA
GCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTACAACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTC
GTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTATACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAG
GCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCTGATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACC
GCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGCCCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGA
ACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCTGACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCT
TCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCATCTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTG
GCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAGCGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAG
TGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGACGGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGG
GCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTGAGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCA
CCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGACGAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCT
CAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGGACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGG
CGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACCGAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCA
TGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTCCCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCC
TCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCTGGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACC
ATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTCGTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCA
AGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTGAGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGT
GCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCCAATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGC
TATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTCATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCG
CCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGCCCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCA
TGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGCGAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGG
CGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTGGAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGC
GCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTGGCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCC
TGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTACTATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCC
GCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAGACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTC
ACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCGCTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGC
CAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCTGCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGG
AGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTCGGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCA
CCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAACAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGG
AGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAGGAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGG
AAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAAGGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGT
TACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAGCTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGG
ACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTCATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCG
AGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTGCAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGA
TTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCACACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGA
CCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTGCGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAG
AGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCACATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGG
TGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGGCTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGT
CCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGCCAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACC
TCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTCTTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGG
TCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCCAAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCT
GCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATGTTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCA
TGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTCATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAA
AGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGCCCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTG
GTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTCGTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGC
TCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGTGAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCT
CCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGACCGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGC
ACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATCGACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCA
AGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTTGTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTC
CCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATGTCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGG
ACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCACGTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGG
ACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTGAACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGC
CGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGACTCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCA
AGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTCTGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGG
TGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCACTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCC
TACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAGGAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGG
CCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATGCCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATG
CCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGATGCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCA
TCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAGTACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCT
ATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATGCTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCT
GGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAATGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGA
AAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGATCCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCC
TGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAAAATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCA
AAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACGCTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTAC
TGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGCCTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCT
TTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCTCAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGG
AAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAGATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATT
TCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCACGCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTG
CTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGACGCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATG
CCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCTGGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGG
TGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACCCAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGC
TGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCACCAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACC
GAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAACACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTC
TGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTGAACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGC
GGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGTCCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGG
CCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATCGAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGC
GCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCCCCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGG
GGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGACGAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGA
GCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCAACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGG
AGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGCGAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACG
CCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGGGCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGA
TGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAACTTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACA
TGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACC
GGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACC
TCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAA
AGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAA
TCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACA
AGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACA
TGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGG
AGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGG
AAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACG
GTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCC
GGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCT
CCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCC
AGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATG
GCACTGTCATCAATCGCCAGAACGGAGAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTG
AGGGGCACAATAATGATTTCCAGAACTACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACC
TCCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCA
AAGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACA
GTCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGC
TGAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGC
AGATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGG
GCTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGT
TCAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCC
AGGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACT
TCCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCA
TCTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGA
ACGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGG
AGCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGC
TCGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCA
GCCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGC
GCGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCA
AGAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAG
ACGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGG
GCGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGC
CTGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAG
AGCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCC
CCAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGT
TCCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCC
TGCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGG
GAACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTG
AACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACT
GTAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGT
CTGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTC
GGCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGG
CCTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATG
GAGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCC
TGGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCC
AGCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCAT
TGAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCC
AGTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAG
GCCGGGGCTGCGGTGCAGGCACCTGGCCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCT
TTCTCCCCTGAGAGGAGCTTCTGCTACTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCC
CTTCTACCAAGCACATGAGCTCTCTAACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCT
TCAGTTCTGGCCATTCCAGGGACCCTCCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGA
ACACCAAACATCTAAACAATCATATGCTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCT
CCCAGGGTCATGCAGGGATCTGCTCCCTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCA
CCTTTCTTCTTGCTTCAGTTGGGGCAGACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTAC
CCTAGCTGACCCCTTCACCTCTCCCCCTCCCTTTTCCTTTGTTTTGGGATTCAGAAAACTGCTTGTCAGAGACTGTTTATTTTTTATTAA

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000355014_chr1_156142617_+_15673nt
TCTACCTCGCGGGTGCCTCTGGTGTCTCCAGAGGTCTCCGACCCCAGCCCGCCCCCAGCCCTCCCGCCCAGCCCGCAGCCCCCTCCCTCT
GTTCCCCGACCTCAGACCCTGGGCTTCCGACCTCGACATCATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGA
TGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAGCAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTT
CCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGATCTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCT
GCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAGTCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCT
GCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTCACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCA
GGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCACCCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGA
CATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCACCTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGAC
ACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAGGGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGA
TGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAGCGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTC
CCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGGAGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGG
GCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTGGTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCAT
CTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTGGAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGT
GCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCTCCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCT
GCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACCCGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAA
TGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTCAGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCAT
CGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTACTTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCT
GCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAGGGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACAC
CACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCAGCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTC
TCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCCACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTC
TGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGTCCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTC
CCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGACGTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCA
AGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTTCTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACAT
CTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAATGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCA
GGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGCTACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGG
CGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTCTGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCT
GGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGCGTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTT
TGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTCAGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGG
TGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGCCATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGA
GTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGCCCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACAC
TGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGGGAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGA
GCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAGAGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAG
GAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACTCTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGA
CAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATGAGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGAC
GCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAATGGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAG
CGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTGGTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAG
CCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTACAACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCG
TTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTATACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGG
CGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCTGATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCG
CGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGCCCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAA
CACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCTGACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTT
CCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCATCTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGG
CCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAGCGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGT
GCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGACGGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGG
CTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTGAGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCAC
CCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGACGAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTC
AGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGGACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGC
GCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACCGAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCAT
GATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTCCCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCT
CAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCTGGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCA
TCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTCGTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAA
GTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTGAGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTG
CCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCCAATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCT
ATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTCATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGC
CATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGCCCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCAT
GCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGCGAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGC
GCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTGGAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCG
CCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTGGCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCT
GGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTACTATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCG
CTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAGACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCA
CCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCGCTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCC
AGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCTGCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGA
GGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTCGGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCAC
CCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAACAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGA
GGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAGGAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGA
AAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAAGGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTT
ACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAGCTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGA
CAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTCATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGA
GTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTGCAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGAT
TCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCACACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGAC
CACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTGCGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGA
GGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCACATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGT
GCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGGCTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTC
CTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGCCAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCT
CATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTCTTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGT
CATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCCAAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTG
CTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATGTTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCAT
GCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTCATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAA
GGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGCCCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGG
TGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTCGTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCT
CATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGTGAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTC
CGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGACCGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCA
CCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATCGACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAA
GGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTTGTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCC
CACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATGTCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGA
CCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCACGTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGA
CACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTGAACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCC
GCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGACTCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAA
GGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTCTGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGT
GTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCACTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCT
ACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAGGAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGC
CCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATGCCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGC
CTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGATGCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCAT
CCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAGTACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTA
TGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATGCTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTG
GCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAATGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAA
AAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGATCCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCT
GTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAAAATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAA
AGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACGCTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACT
GAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGCCTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTT
TGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCTCAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGA
AAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAGATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTT
CTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCACGCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGC
TGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGACGCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGC
CAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCTGGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGT
GGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACCCAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCT
GCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCACCAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCG
AACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAACACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCT
GGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTGAACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCG
GGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGTCCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGC
CGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATCGAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCG
CGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCCCCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGG
GAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGACGAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAG
CCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCAACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGA
GCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGCGAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGC
CCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGGGCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGAT
GGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAACTTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACAT
GTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAGGCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAA
GCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCC
CACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCT
TCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGA
TGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAA
GGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCA
CCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCT
TTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCG
CACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGA
GGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGC
ACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCT
GAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTT
CTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCAT
GGTGAATGAGGATGGCACTGTAGGAGAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGA
GGGGCACAATAATGATTTCCAGAACTACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCT
CCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAA
AGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAG
TCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCT
GAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCA
GATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGG
CTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTT
CAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCA
GGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTT
CCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCAT
CTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAA
CGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGA
GCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCT
CGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAG
CCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCG
CGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAA
GAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGA
CGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGG
CGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCC
TGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGA
GCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCC
CAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTT
CCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCT
GCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGG
AACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGA
ACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTG
TAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTC
TGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCG
GCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGC
CTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGG
AGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCT
GGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCA
GCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATT
GAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCA
GTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAGG
CCGGGGCTGCGGTGCAGGCACCTGGCCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCTT
TCTCCCCTGAGAGGAGCTTCTGCTACTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCCC
TTCTACCAAGCACATGAGCTCTCTAACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCTT
CAGTTCTGGCCATTCCAGGGACCCTCCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGAA
CACCAAACATCTAAACAATCATATGCTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCTC
CCAGGGTCATGCAGGGATCTGCTCCCTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCAC
CTTTCTTCTTGCTTCAGTTGGGGCAGACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTACC
CTAGCTGACCCCTTCACCTCTCCCCCTCCCTTTTCCTTTGTTTTGGGATTCAGAAAACTGCTTGTCAGAGACTGTTTATTTTTTATTAAA

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000368285_chr1_156142617_+_15673nt
TCTACCTCGCGGGTGCCTCTGGTGTCTCCAGAGGTCTCCGACCCCAGCCCGCCCCCAGCCCTCCCGCCCAGCCCGCAGCCCCCTCCCTCT
GTTCCCCGACCTCAGACCCTGGGCTTCCGACCTCGACATCATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGA
TGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAGCAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTT
CCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGATCTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCT
GCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAGTCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCT
GCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTCACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCA
GGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCACCCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGA
CATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCACCTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGAC
ACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAGGGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGA
TGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAGCGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTC
CCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGGAGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGG
GCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTGGTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCAT
CTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTGGAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGT
GCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCTCCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCT
GCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACCCGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAA
TGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTCAGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCAT
CGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTACTTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCT
GCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAGGGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACAC
CACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCAGCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTC
TCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCCACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTC
TGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGTCCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTC
CCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGACGTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCA
AGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTTCTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACAT
CTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAATGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCA
GGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGCTACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGG
CGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTCTGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCT
GGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGCGTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTT
TGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTCAGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGG
TGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGCCATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGA
GTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGCCCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACAC
TGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGGGAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGA
GCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAGAGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAG
GAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACTCTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGA
CAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATGAGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGAC
GCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAATGGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAG
CGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTGGTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAG
CCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTACAACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCG
TTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTATACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGG
CGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCTGATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCG
CGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGCCCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAA
CACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCTGACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTT
CCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCATCTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGG
CCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAGCGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGT
GCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGACGGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGG
CTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTGAGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCAC
CCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGACGAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTC
AGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGGACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGC
GCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACCGAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCAT
GATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTCCCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCT
CAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCTGGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCA
TCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTCGTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAA
GTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTGAGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTG
CCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCCAATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCT
ATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTCATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGC
CATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGCCCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCAT
GCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGCGAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGC
GCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTGGAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCG
CCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTGGCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCT
GGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTACTATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCG
CTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAGACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCA
CCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCGCTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCC
AGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCTGCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGA
GGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTCGGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCAC
CCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAACAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGA
GGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAGGAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGA
AAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAAGGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTT
ACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAGCTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGA
CAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTCATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGA
GTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTGCAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGAT
TCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCACACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGAC
CACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTGCGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGA
GGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCACATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGT
GCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGGCTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTC
CTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGCCAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCT
CATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTCTTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGT
CATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCCAAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTG
CTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATGTTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCAT
GCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTCATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAA
GGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGCCCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGG
TGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTCGTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCT
CATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGTGAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTC
CGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGACCGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCA
CCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATCGACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAA
GGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTTGTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCC
CACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATGTCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGA
CCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCACGTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGA
CACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTGAACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCC
GCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGACTCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAA
GGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTCTGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGT
GTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCACTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCT
ACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAGGAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGC
CCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATGCCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGC
CTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGATGCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCAT
CCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAGTACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTA
TGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATGCTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTG
GCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAATGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAA
AAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGATCCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCT
GTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAAAATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAA
AGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACGCTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACT
GAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGCCTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTT
TGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCTCAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGA
AAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAGATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTT
CTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCACGCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGC
TGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGACGCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGC
CAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCTGGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGT
GGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACCCAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCT
GCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCACCAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCG
AACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAACACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCT
GGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTGAACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCG
GGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGTCCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGC
CGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATCGAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCG
CGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCCCCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGG
GAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGACGAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAG
CCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCAACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGA
GCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGCGAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGC
CCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGGGCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGAT
GGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAACTTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACAT
GTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAGGCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAA
GCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCC
CACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCT
TCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGA
TGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAA
GGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCA
CCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCT
TTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCG
CACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGA
GGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGC
ACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCT
GAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTT
CTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCAT
GGTGAATGAGGATGGCACTGTAGGAGAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGA
GGGGCACAATAATGATTTCCAGAACTACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCT
CCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAA
AGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAG
TCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCT
GAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCA
GATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGG
CTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTT
CAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCA
GGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTT
CCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCAT
CTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAA
CGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGA
GCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCT
CGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAG
CCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCG
CGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAA
GAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGA
CGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGG
CGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCC
TGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGA
GCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCC
CAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTT
CCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCT
GCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGG
AACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGA
ACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTG
TAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTC
TGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCG
GCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGC
CTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGG
AGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCT
GGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCA
GCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATT
GAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCA
GTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAGG
CCGGGGCTGCGGTGCAGGCACCTGGCCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCTT
TCTCCCCTGAGAGGAGCTTCTGCTACTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCCC
TTCTACCAAGCACATGAGCTCTCTAACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCTT
CAGTTCTGGCCATTCCAGGGACCCTCCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGAA
CACCAAACATCTAAACAATCATATGCTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCTC
CCAGGGTCATGCAGGGATCTGCTCCCTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCAC
CTTTCTTCTTGCTTCAGTTGGGGCAGACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTACC
CTAGCTGACCCCTTCACCTCTCCCCCTCCCTTTTCCTTTGTTTTGGGATTCAGAAAACTGCTTGTCAGAGACTGTTTATTTTTTATTAAA

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000368284_chr1_156142617_+_15672nt
TCTACCTCGCGGGTGCCTCTGGTGTCTCCAGAGGTCTCCGACCCCAGCCCGCCCCCAGCCCTCCCGCCCAGCCCGCAGCCCCCTCCCTCT
GTTCCCCGACCTCAGACCCTGGGCTTCCGACCTCGACATCATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGA
TGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAGCAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTT
CCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGATCTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCT
GCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAGTCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCT
GCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTCACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCA
GGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCACCCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGA
CATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCACCTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGAC
ACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAGGGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGA
TGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAGCGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTC
CCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGGAGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGG
GCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTGGTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCAT
CTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTGGAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGT
GCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCTCCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCT
GCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACCCGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAA
TGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTCAGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCAT
CGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTACTTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCT
GCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAGGGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACAC
CACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCAGCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTC
TCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCCACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTC
TGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGTCCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTC
CCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGACGTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCA
AGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTTCTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACAT
CTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAATGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCA
GGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGCTACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGG
CGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTCTGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCT
GGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGCGTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTT
TGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTCAGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGG
TGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGCCATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGA
GTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGCCCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACAC
TGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGGGAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGA
GCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAGAGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAG
GAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACTCTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGA
CAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATGAGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGAC
GCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAATGGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAG
CGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTGGTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAG
CCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTACAACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCG
TTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTATACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGG
CGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCTGATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCG
CGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGCCCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAA
CACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCTGACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTT
CCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCATCTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGG
CCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAGCGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGT
GCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGACGGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGG
CTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTGAGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCAC
CCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGACGAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTC
AGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGGACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGC
GCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACCGAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCAT
GATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTCCCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCT
CAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCTGGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCA
TCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTCGTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAA
GTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTGAGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTG
CCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCCAATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCT
ATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTCATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGC
CATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGCCCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCAT
GCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGCGAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGC
GCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTGGAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCG
CCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTGGCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCT
GGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTACTATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCG
CTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAGACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCA
CCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCGCTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCC
AGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCTGCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGA
GGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTCGGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCAC
CCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAACAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGA
GGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAGGAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGA
AAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAAGGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTT
ACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAGCTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGA
CAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTCATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGA
GTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTGCAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGAT
TCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCACACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGAC
CACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTGCGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGA
GGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCACATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGT
GCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGGCTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTC
CTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGCCAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCT
CATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTCTTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGT
CATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCCAAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTG
CTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATGTTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCAT
GCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTCATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAA
GGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGCCCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGG
TGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTCGTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCT
CATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGTGAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTC
CGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGACCGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCA
CCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATCGACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAA
GGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTTGTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCC
CACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATGTCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGA
CCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCACGTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGA
CACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTGAACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCC
GCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGACTCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAA
GGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTCTGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGT
GTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCACTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCT
ACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAGGAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGC
CCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATGCCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGC
CTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGATGCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCAT
CCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAGTACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTA
TGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATGCTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTG
GCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAATGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAA
AAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGATCCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCT
GTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAAAATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAA
AGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACGCTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACT
GAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGCCTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTT
TGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCTCAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGA
AAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAGATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTT
CTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCACGCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGC
TGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGACGCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGC
CAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCTGGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGT
GGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACCCAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCT
GCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCACCAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCG
AACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAACACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCT
GGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTGAACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCG
GGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGTCCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGC
CGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATCGAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCG
CGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCCCCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGG
GAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGACGAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAG
CCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCAACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGA
GCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGCGAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGC
CCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGGGCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGAT
GGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAACTTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACAT
GTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAGGCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAA
GCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCC
CACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCT
TCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGA
TGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAA
GGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCA
CCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCT
TTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCG
CACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGA
GGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGC
ACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCT
GAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTT
CTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCAT
GGTGAATGAGGATGGCACTGTAGGAGAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGA
GGGGCACAATAATGATTTCCAGAACTACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCT
CCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAA
AGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAG
TCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCT
GAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCA
GATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGG
CTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTT
CAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCA
GGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTT
CCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCAT
CTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAA
CGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGA
GCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCT
CGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAG
CCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCG
CGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAA
GAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGA
CGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGG
CGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCC
TGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGA
GCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCC
CAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTT
CCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCT
GCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGG
AACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGA
ACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTG
TAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTC
TGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCG
GCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGC
CTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGG
AGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCT
GGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCA
GCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATT
GAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCA
GTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAGG
CCGGGGCTGCGGTGCAGGCACCTGGCCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCTT
TCTCCCCTGAGAGGAGCTTCTGCTACTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCCC
TTCTACCAAGCACATGAGCTCTCTAACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCTT
CAGTTCTGGCCATTCCAGGGACCCTCCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGAA
CACCAAACATCTAAACAATCATATGCTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCTC
CCAGGGTCATGCAGGGATCTGCTCCCTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCAC
CTTTCTTCTTGCTTCAGTTGGGGCAGACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTACC
CTAGCTGACCCCTTCACCTCTCCCCCTCCCTTTTCCTTTGTTTTGGGATTCAGAAAACTGCTTGTCAGAGACTGTTTATTTTTTATTAAA

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000368286_chr1_156142617_+_15672nt
TCTACCTCGCGGGTGCCTCTGGTGTCTCCAGAGGTCTCCGACCCCAGCCCGCCCCCAGCCCTCCCGCCCAGCCCGCAGCCCCCTCCCTCT
GTTCCCCGACCTCAGACCCTGGGCTTCCGACCTCGACATCATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGA
TGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAGCAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTT
CCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGATCTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCT
GCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAGTCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCT
GCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTCACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCA
GGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCACCCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGA
CATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCACCTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGAC
ACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAGGGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGA
TGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAGCGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTC
CCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGGAGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGG
GCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTGGTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCAT
CTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTGGAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGT
GCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCTCCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCT
GCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACCCGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAA
TGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTCAGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCAT
CGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTACTTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCT
GCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAGGGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACAC
CACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCAGCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTC
TCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCCACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTC
TGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGTCCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTC
CCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGACGTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCA
AGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTTCTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACAT
CTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAATGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCA
GGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGCTACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGG
CGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTCTGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCT
GGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGCGTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTT
TGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTCAGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGG
TGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGCCATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGA
GTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGCCCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACAC
TGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGGGAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGA
GCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAGAGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAG
GAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACTCTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGA
CAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATGAGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGAC
GCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAATGGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAG
CGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTGGTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAG
CCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTACAACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCG
TTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTATACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGG
CGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCTGATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCG
CGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGCCCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAA
CACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCTGACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTT
CCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCATCTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGG
CCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAGCGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGT
GCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGACGGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGG
CTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTGAGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCAC
CCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGACGAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTC
AGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGGACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGC
GCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACCGAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCAT
GATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTCCCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCT
CAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCTGGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCA
TCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTCGTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAA
GTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTGAGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTG
CCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCCAATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCT
ATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTCATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGC
CATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGCCCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCAT
GCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGCGAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGC
GCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTGGAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCG
CCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTGGCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCT
GGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTACTATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCG
CTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAGACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCA
CCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCGCTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCC
AGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCTGCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGA
GGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTCGGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCAC
CCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAACAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGA
GGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAGGAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGA
AAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAAGGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTT
ACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAGCTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGA
CAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTCATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGA
GTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTGCAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGAT
TCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCACACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGAC
CACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTGCGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGA
GGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCACATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGT
GCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGGCTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTC
CTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGCCAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCT
CATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTCTTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGT
CATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCCAAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTG
CTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATGTTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCAT
GCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTCATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAA
GGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGCCCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGG
TGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTCGTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCT
CATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGTGAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTC
CGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGACCGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCA
CCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATCGACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAA
GGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTTGTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCC
CACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATGTCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGA
CCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCACGTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGA
CACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTGAACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCC
GCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGACTCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAA
GGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTCTGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGT
GTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCACTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCT
ACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAGGAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGC
CCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATGCCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGC
CTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGATGCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCAT
CCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAGTACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTA
TGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATGCTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTG
GCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAATGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAA
AAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGATCCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCT
GTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAAAATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAA
AGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACGCTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACT
GAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGCCTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTT
TGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCTCAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGA
AAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAGATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTT
CTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCACGCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGC
TGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGACGCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGC
CAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCTGGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGT
GGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACCCAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCT
GCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCACCAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCG
AACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAACACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCT
GGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTGAACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCG
GGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGTCCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGC
CGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATCGAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCG
CGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCCCCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGG
GAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGACGAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAG
CCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCAACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGA
GCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGCGAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGC
CCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGGGCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGAT
GGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAACTTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACAT
GTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAGGCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAA
GCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCC
CACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCT
TCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGA
TGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAA
GGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCA
CCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCT
TTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCG
CACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGA
GGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGC
ACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCT
GAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTT
CTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCAT
GGTGAATGAGGATGGCACTGTAGGAGAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGA
GGGGCACAATAATGATTTCCAGAACTACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCT
CCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAA
AGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAG
TCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCT
GAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCA
GATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGG
CTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTT
CAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCA
GGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTT
CCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCAT
CTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAA
CGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGA
GCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCT
CGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAG
CCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCG
CGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAA
GAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGA
CGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGG
CGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCC
TGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGA
GCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCC
CAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTT
CCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCT
GCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGG
AACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGA
ACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTG
TAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTC
TGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCG
GCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGC
CTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGG
AGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCT
GGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCA
GCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATT
GAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCA
GTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAGG
CCGGGGCTGCGGTGCAGGCACCTGGCCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCTT
TCTCCCCTGAGAGGAGCTTCTGCTACTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCCC
TTCTACCAAGCACATGAGCTCTCTAACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCTT
CAGTTCTGGCCATTCCAGGGACCCTCCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGAA
CACCAAACATCTAAACAATCATATGCTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCTC
CCAGGGTCATGCAGGGATCTGCTCCCTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCAC
CTTTCTTCTTGCTTCAGTTGGGGCAGACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTACC
CTAGCTGACCCCTTCACCTCTCCCCCTCCCTTTTCCTTTGTTTTGGGATTCAGAAAACTGCTTGTCAGAGACTGTTTATTTTTTATTAAA

>In-frame_RYR1_ENST00000360985_chr19_39058557_+_SEMA4A_ENST00000368282_chr1_156142617_+_15681nt
TCTACCTCGCGGGTGCCTCTGGTGTCTCCAGAGGTCTCCGACCCCAGCCCGCCCCCAGCCCTCCCGCCCAGCCCGCAGCCCCCTCCCTCT
GTTCCCCGACCTCAGACCCTGGGCTTCCGACCTCGACATCATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGA
TGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAGCAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTT
CCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGATCTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCT
GCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAGTCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCT
GCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTCACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCA
GGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCACCCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGA
CATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCACCTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGAC
ACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAGGGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGA
TGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAGCGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTC
CCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGGAGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGG
GCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTGGTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCAT
CTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTGGAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGT
GCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCTCCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCT
GCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACCCGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAA
TGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTCAGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCAT
CGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTACTTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCT
GCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAGGGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACAC
CACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCAGCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTC
TCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCCACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTC
TGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGTCCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTC
CCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGACGTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCA
AGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTTCTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACAT
CTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAATGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCA
GGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGCTACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGG
CGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTCTGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCT
GGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGCGTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTT
TGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTCAGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGG
TGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGCCATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGA
GTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGCCCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACAC
TGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGGGAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGA
GCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAGAGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAG
GAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACTCTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGA
CAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATGAGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGAC
GCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAATGGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAG
CGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTGGTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAG
CCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTACAACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCG
TTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTATACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGG
CGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCTGATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCG
CGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGCCCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAA
CACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCTGACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTT
CCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCATCTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGG
CCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAGCGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGT
GCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGACGGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGG
CTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTGAGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCAC
CCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGACGAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTC
AGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGGACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGC
GCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACCGAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCAT
GATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTCCCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCT
CAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCTGGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCA
TCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTCGTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAA
GTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTGAGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTG
CCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCCAATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCT
ATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTCATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGC
CATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGCCCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCAT
GCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGCGAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGC
GCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTGGAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCG
CCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTGGCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCT
GGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTACTATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCG
CTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAGACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCA
CCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCGCTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCC
AGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCTGCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGA
GGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTCGGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCAC
CCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAACAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGA
GGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAGGAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGA
AAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAAGGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTT
ACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAGCTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGA
CAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTCATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGA
GTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTGCAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGAT
TCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCACACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGAC
CACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTGCGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGA
GGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCACATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGT
GCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGGCTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTC
CTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGCCAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCT
CATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTCTTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGT
CATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCCAAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTG
CTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATGTTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCAT
GCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTCATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAA
GGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGCCCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGG
TGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTCGTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCT
CATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGTGAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTC
CGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGACCGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCA
CCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATCGACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAA
GGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTTGTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCC
CACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATGTCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGA
CCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCACGTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGA
CACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTGAACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCC
GCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGACTCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAA
GGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTCTGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGT
GTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCACTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCT
ACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAGGAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGC
CCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATGCCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGC
CTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGATGCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCAT
CCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAGTACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTA
TGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATGCTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTG
GCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAATGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAA
AAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGATCCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCT
GTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAAAATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAA
AGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACGCTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACT
GAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGCCTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTT
TGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCTCAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGA
AAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAGATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTT
CTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCACGCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGC
TGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGACGCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGC
CAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCTGGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGT
GGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACCCAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCT
GCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCACCAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCG
AACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAACACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCT
GGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTGAACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCG
GGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGTCCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGC
CGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATCGAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCG
CGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCCCCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGG
GAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGACGAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAG
CCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCAACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGA
GCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGCGAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGC
CCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGGGCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGAT
GGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAACTTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACAT
GTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAGGCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAA
GCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATCGTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCC
CACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTACGCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCT
TCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGCTGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGA
TGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCAGCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAA
GGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGGGCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCA
CCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCATGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCT
TTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTGGAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCG
CACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTACCTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGA
GGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTCTCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGC
ACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAGATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCT
GAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAGGTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTT
CTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTCCTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCAT
GGTGAATGAGGATGGCACTGTAGGAGAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGA
GGGGCACAATAATGATTTCCAGAACTACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCT
CCTGCGGCTGCAGGAATCCATCAGCGACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAA
AGCCATGTCGGTGGCTAAGCAGGTGTTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAG
TCGCCTATGGGACGCAGTGGTGGGATTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCT
GAAGGAGCTGCTGGATCTGCAGAAGGACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCA
GATGGTGGACATGCTCGTGGAATCCTCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGG
CTCTGAAGCCTTCCAGGACTACGTAACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTT
CAGCGGTCCAGAAATCCAGTTCCTGCTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCA
GGAGCCAGCACGCGACATCGGCTTCAACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTT
CCTGGAGCTGGCCGAGAGCATCCTTGAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCAT
CTACTTCGAGATCTCAGAGACCAACCGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAA
CGAGGGCGGCGAGGCTGAGAAGATGGAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGA
GCCCGAGGGCGAGCCGGAGACCGACGAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCT
CGAGGGCACGGCGGCCACGGCGGCGGCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAG
CCTGCGGCGGCGCGTGCGGCGGCTGCGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCG
CGCTGGGGCCGCTGGCGCGGGGGCGGCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAA
GAAGGTGACGGTGACCGAGCTCCTGGCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGA
CGCAGACGGCGAGGGTGCCAGCGAGGGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGG
CGGTGCCGACGGGGCGGTGGCCGTGACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCC
TGCGGAACCGCCCACACCCGAGGGCTCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGA
GCCCGAGCCGGAACCAGAGCTGGAGCCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCC
CAAGAAGCAAGCACCTCCCTCACCCCCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTT
CCTGTGCTCAGTGGGCCCCTCCTCTGATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCT
GCTGGTGAAATCTGGCGTGGAGTATACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGG
AACCACCACAGGGTCGCTCCACAAGGCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGA
ACCTGTTCGCAACCTGCAGCTGGCCCCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTG
TAGTGTCTATGAGAGCTGTGTGGACTGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTC
TGCCCCCAACCTGAACTCCTGGAAGCAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCG
GCCTCAGAGCCGCCCGCAAATCATTAAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGC
CTCTTATTATTGGAGTCATGGCCCAGCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGG
AGTTGGGGGTCTCTACCAGTGCTGGGCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCT
GGCCCTGGATCCTGAACTGGCAGGCATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCA
GCAGTCCTACTGGCCCCACTTTGTCACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATT
GAGAGCACTCCGGGCTCGGGGCAAGGTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCA
GTCTCCCAAGGAATGCAGGACCTCTGCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAGG
CCGGGGCTGCGGTGCAGGCACCTGGCCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCTT
TCTCCCCTGAGAGGAGCTTCTGCTACTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCCC
TTCTACCAAGCACATGAGCTCTCTAACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCTT
CAGTTCTGGCCATTCCAGGGACCCTCCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGAA
CACCAAACATCTAAACAATCATATGCTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCTC
CCAGGGTCATGCAGGGATCTGCTCCCTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCAC
CTTTCTTCTTGCTTCAGTTGGGGCAGACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTACC
CTAGCTGACCCCTTCACCTCTCCCCCTCCCTTTTCCTTTGTTTTGGGATTCAGAAAACTGCTTGTCAGAGACTGTTTATTTTTTATTAAA

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000355014_chr1_156142617_+_15558nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGA
GAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAAC
TACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGC
GACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTG
TTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGA
TTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAG
GACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCC
TCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTA
ACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTG
CTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTC
AACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTT
GAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAAC
CGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATG
GAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGAC
GAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCG
GCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTG
CGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCG
GCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTG
GCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAG
GGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTG
ACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGC
TCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAG
CCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCC
CCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCT
GATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTAT
ACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAG
GCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCC
CCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGAC
TGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAG
CAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATT
AAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCA
GCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGG
GCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGC
ATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTC
ACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAG
GTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCT
GCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAGGCCGGGGCTGCGGTGCAGGCACCTGG
CCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCTTTCTCCCCTGAGAGGAGCTTCTGCTA
CTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCCCTTCTACCAAGCACATGAGCTCTCTA
ACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCTTCAGTTCTGGCCATTCCAGGGACCCT
CCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGAACACCAAACATCTAAACAATCATATG
CTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCTCCCAGGGTCATGCAGGGATCTGCTCC
CTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCACCTTTCTTCTTGCTTCAGTTGGGGCA
GACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTACCCTAGCTGACCCCTTCACCTCTCCCC

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000368285_chr1_156142617_+_15558nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGA
GAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAAC
TACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGC
GACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTG
TTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGA
TTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAG
GACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCC
TCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTA
ACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTG
CTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTC
AACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTT
GAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAAC
CGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATG
GAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGAC
GAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCG
GCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTG
CGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCG
GCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTG
GCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAG
GGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTG
ACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGC
TCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAG
CCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCC
CCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCT
GATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTAT
ACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAG
GCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCC
CCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGAC
TGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAG
CAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATT
AAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCA
GCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGG
GCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGC
ATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTC
ACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAG
GTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCT
GCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAGGCCGGGGCTGCGGTGCAGGCACCTGG
CCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCTTTCTCCCCTGAGAGGAGCTTCTGCTA
CTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCCCTTCTACCAAGCACATGAGCTCTCTA
ACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCTTCAGTTCTGGCCATTCCAGGGACCCT
CCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGAACACCAAACATCTAAACAATCATATG
CTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCTCCCAGGGTCATGCAGGGATCTGCTCC
CTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCACCTTTCTTCTTGCTTCAGTTGGGGCA
GACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTACCCTAGCTGACCCCTTCACCTCTCCCC

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000368284_chr1_156142617_+_15557nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGA
GAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAAC
TACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGC
GACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTG
TTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGA
TTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAG
GACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCC
TCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTA
ACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTG
CTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTC
AACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTT
GAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAAC
CGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATG
GAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGAC
GAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCG
GCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTG
CGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCG
GCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTG
GCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAG
GGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTG
ACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGC
TCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAG
CCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCC
CCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCT
GATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTAT
ACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAG
GCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCC
CCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGAC
TGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAG
CAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATT
AAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCA
GCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGG
GCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGC
ATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTC
ACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAG
GTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCT
GCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAGGCCGGGGCTGCGGTGCAGGCACCTGG
CCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCTTTCTCCCCTGAGAGGAGCTTCTGCTA
CTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCCCTTCTACCAAGCACATGAGCTCTCTA
ACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCTTCAGTTCTGGCCATTCCAGGGACCCT
CCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGAACACCAAACATCTAAACAATCATATG
CTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCTCCCAGGGTCATGCAGGGATCTGCTCC
CTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCACCTTTCTTCTTGCTTCAGTTGGGGCA
GACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTACCCTAGCTGACCCCTTCACCTCTCCCC

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000368286_chr1_156142617_+_15557nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGA
GAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAAC
TACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGC
GACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTG
TTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGA
TTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAG
GACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCC
TCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTA
ACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTG
CTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTC
AACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTT
GAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAAC
CGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATG
GAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGAC
GAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCG
GCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTG
CGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCG
GCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTG
GCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAG
GGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTG
ACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGC
TCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAG
CCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCC
CCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCT
GATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTAT
ACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAG
GCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCC
CCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGAC
TGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAG
CAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATT
AAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCA
GCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGG
GCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGC
ATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTC
ACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAG
GTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCT
GCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAGGCCGGGGCTGCGGTGCAGGCACCTGG
CCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCTTTCTCCCCTGAGAGGAGCTTCTGCTA
CTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCCCTTCTACCAAGCACATGAGCTCTCTA
ACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCTTCAGTTCTGGCCATTCCAGGGACCCT
CCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGAACACCAAACATCTAAACAATCATATG
CTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCTCCCAGGGTCATGCAGGGATCTGCTCC
CTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCACCTTTCTTCTTGCTTCAGTTGGGGCA
GACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTACCCTAGCTGACCCCTTCACCTCTCCCC

>In-frame_RYR1_ENST00000359596_chr19_39058557_+_SEMA4A_ENST00000368282_chr1_156142617_+_15566nt
ATGGGTGACGCAGAAGGCGAAGACGAGGTCCAGTTCCTGCGGACGGACGATGAGGTGGTCCTGCAGTGCAGCGCTACCGTGCTCAAGGAG
CAGCTCAAGCTCTGCCTGGCCGCCGAGGGCTTCGGCAACCGCCTGTGCTTCCTGGAGCCCACTAGCAACGCGCAGAATGTGCCCCCCGAT
CTGGCCATCTGTTGCTTCGTCCTGGAGCAGTCCCTGTCTGTGCGAGCCCTGCAGGAGATGCTGGCTAACACGGTGGAGGCTGGCGTGGAG
TCATCCCAGGGCGGGGGACACAGGACGCTCCTGTATGGCCATGCCATCCTGCTCCGGCATGCACACAGCCGCATGTATCTGAGCTGCCTC
ACCACCTCCCGCTCCATGACTGACAAGCTGGCCTTCGATGTGGGACTGCAGGAGGACGCAACAGGAGAGGCTTGCTGGTGGACCATGCAC
CCAGCCTCCAAGCAGAGGTCTGAAGGAGAAAAGGTCCGCGTTGGGGATGACATCATCCTTGTCAGTGTCTCCTCCGAGCGCTACCTGCAC
CTGTCGACCGCCAGTGGGGAGCTCCAGGTTGACGCTTCCTTCATGCAGACACTATGGAACATGAACCCCATCTGCTCCCGCTGCGAAGAG
GGCTTCGTGACGGGAGGTCACGTCCTCCGCCTCTTTCATGGACATATGGATGAGTGTCTGACCATTTCCCCTGCTGACAGTGATGACCAG
CGCAGACTTGTCTACTATGAGGGGGGAGCTGTGTGCACTCATGCCCGCTCCCTCTGGAGGCTGGAGCCACTGAGAATCAGCTGGAGTGGG
AGCCACCTGCGCTGGGGCCAGCCACTCCGAGTCCGGCATGTCACTACCGGGCAGTACCTAGCGCTCACCGAGGACCAGGGCCTGGTGGTG
GTTGACGCCAGCAAGGCTCACACCAAGGCTACCTCCTTCTGCTTCCGCATCTCCAAGGAGAAGCTGGATGTGGCCCCCAAGCGGGATGTG
GAGGGCATGGGCCCCCCTGAGATCAAGTACGGGGAGTCACTGTGCTTCGTGCAGCATGTGGCCTCAGGACTGTGGCTCACCTATGCTGCT
CCAGACCCCAAGGCCCTGCGGCTCGGCGTGCTCAAGAAGAAGGCCATGCTGCACCAGGAGGGCCACATGGACGACGCACTGTCGCTGACC
CGCTGCCAGCAGGAGGAGTCCCAGGCCGCCCGCATGATCCACAGCACCAATGGCCTATACAACCAGTTCATCAAGAGCCTGGACAGCTTC
AGCGGGAAGCCACGGGGCTCGGGGCCACCCGCTGGCACGGCGCTGCCCATCGAGGGCGTTATCCTGAGCCTGCAGGACCTCATCATCTAC
TTCGAGCCTCCCTCCGAGGACTTGCAGCACGAGGAGAAGCAGAGCAAGCTGCGAAGCCTGCGCAACCGCCAGAGCCTCTTCCAGGAGGAG
GGGATGCTCTCCATGGTCCTGAATTGCATAGACCGCCTAAATGTCTACACCACTGCTGCCCACTTTGCTGAGTTTGCAGGGGAGGAGGCA
GCCGAGTCCTGGAAAGAGATTGTGAATCTTCTCTATGAACTCCTAGCTTCTCTAATCCGTGGCAATCGTAGCAACTGTGCCCTCTTCTCC
ACAAACTTGGACTGGCTGGTCAGCAAGCTGGATCGGCTGGAGGCCTCGTCTGGCATCCTGGAGGTCCTGTACTGTGTCCTCATTGAGAGT
CCAGAGGTTCTGAACATCATCCAGGAGAATCACATCAAGTCCATCATCTCCCTCCTGGACAAGCATGGGAGGAACCACAAGGTCCTGGAC
GTGCTATGCTCCCTGTGTGTGTGTAATGGTGTGGCTGTACGCTCCAACCAAGATCTTATTACTGAGAACTTGCTGCCTGGCCGTGAGCTT
CTGCTGCAGACAAACCTCATCAACTATGTCACCAGCATCCGCCCCAACATCTTTGTGGGCCGAGCGGAAGGCACCACGCAGTACAGCAAA
TGGTACTTTGAGGTGATGGTGGACGAGGTGACTCCATTTCTGACAGCTCAGGCCACCCACTTGCGGGTGGGCTGGGCCCTCACCGAGGGC
TACACCCCCTACCCTGGGGCCGGCGAGGGCTGGGGCGGCAACGGGGTCGGCGATGACCTCTATTCCTACGGCTTTGATGGACTGCATCTC
TGGACAGGACACGTGGCACGCCCAGTGACTTCCCCAGGGCAGCACCTCCTGGCCCCTGAAGACGTGATCAGCTGCTGCCTGGACCTCAGC
GTGCCGTCCATCTCCTTCCGCATCAACGGCTGCCCCGTGCAGGGTGTCTTTGAGTCCTTCAACCTGGACGGGCTCTTCTTCCCTGTTGTC
AGCTTCTCGGCTGGTGTCAAGGTGCGGTTCCTCCTTGGTGGCCGCCATGGTGAATTCAAGTTCCTGCCCCCACCTGGCTATGCTCCATGC
CATGAGGCTGTGCTCCCTCGAGAGCGACTCCATCTTGAACCCATCAAGGAGTATCGACGGGAGGGGCCCCGGGGGCCTCACCTGGTGGGC
CCCAGTCGCTGCCTCTCACACACCGACTTCGTGCCCTGCCCTGTGGACACTGTCCAGATTGTCCTGCCGCCCCATCTGGAGCGCATTCGG
GAGAAGCTGGCGGAGAACATCCACGAGCTCTGGGCGCTAACCCGCATCGAGCAGGGCTGGACCTACGGCCCGGTTCGGGATGACAACAAG
AGGCTGCACCCGTGTCTTGTGGACTTCCACAGCCTTCCAGAGCCTGAGAGGAACTACAACCTGCAGATGTCTGGGGAGACGCTCAAGACT
CTGCTGGCTCTGGGCTGCCACGTGGGCATGGCGGATGAGAAGGCGGAGGACAACCTGAAGAAGACAAAACTCCCCAAGACGTATATGATG
AGCAATGGGTACAAGCCGGCTCCGCTGGACCTGAGCCACGTGCGGCTGACGCCGGCGCAGACGACACTGGTGGACCGTCTGGCAGAAAAT
GGGCACAACGTGTGGGCCCGAGACCGCGTGGGCCAGGGCTGGAGCTACAGCGCAGTGCAGGACATCCCAGCGCGCCGAAACCCTCGGCTG
GTGCCCTACCGCCTGCTGGATGAAGCCACCAAGCGCAGCAACCGGGACAGCCTCTGCCAGGCCGTGCGCACCCTCCTGGGCTACGGCTAC
AACATCGAGCCTCCTGACCAGGAGCCCAGTCAGGTGGAGAACCAGTCTCGTTGTGACCGGGTGCGCATCTTCCGGGCAGAGAAATCCTAT
ACAGTGCAGAGCGGCCGCTGGTACTTCGAGTTTGAAGCAGTCACCACAGGCGAGATGCGCGTGGGCTGGGCGAGGCCCGAGCTGAGGCCT
GATGTAGAGCTGGGAGCTGACGAGCTGGCCTATGTCTTCAATGGGCACCGCGGCCAGCGCTGGCACTTGGGCAGTGAACCATTTGGGCGC
CCCTGGCAGCCGGGCGATGTCGTTGGCTGTATGATCGACCTCACAGAGAACACCATTATCTTCACCCTCAATGGCGAGGTCCTCATGTCT
GACTCAGGCTCCGAAACAGCCTTCCGGGAGATTGAGATTGGGGACGGCTTCCTGCCCGTCTGCAGCTTGGGACCTGGCCAGGTGGGTCAT
CTGAACCTGGGCCAGGACGTGAGCTCTCTGAGGTTCTTTGCCATCTGTGGCCTCCAGGAAGGCTTCGAGCCATTTGCCATCAACATGCAG
CGCCCAGTCACCACCTGGTTCAGCAAAGGCCTGCCCCAGTTTGAGCCAGTGCCCCTTGAACACCCTCACTATGAGGTATCCCGAGTGGAC
GGCACTGTGGACACGCCCCCCTGCCTGCGCCTGACCCACCGCACCTGGGGCTCCCAGAACAGCCTGGTGGAGATGCTTTTCCTGCGGCTG
AGCCTCCCAGTCCAGTTCCACCAGCACTTCCGCTGCACTGCAGGGGCCACCCCGCTGGCACCTCCTGGCCTGCAGCCCCCCGCCGAGGAC
GAGGCCCGGGCGGCGGAACCCGACCCTGACTACGAAAACCTGCGCCGCTCAGCTGGGGGCTGGAGCGAGGCAGAGAACGGCAAAGAAGGG
ACTGCGAAGGAGGGCGCCCCCGGGGGCACCCCGCAGGCGGGGGGAGAGGCGCAGCCCGCCAGGGCGGAGAATGAGAAGGATGCCACCACC
GAGAAGAACAAGAAGAGAGGCTTCTTATTCAAGGCCAAGAAGGTCGCCATGATGACCCAGCCACCGGCCACCCCCACGCTGCCCCGACTC
CCTCACGACGTGGTGCCTGCAGACAACCGCGATGACCCCGAGATCATCCTCAACACCACCACGTACTATTACTCCGTGAGGGTCTTTGCT
GGACAGGAGCCCAGCTGCGTGTGGGCGGGCTGGGTCACCCCTGACTACCATCAGCACGACATGAGCTTCGACCTCAGCAAGGTCCGGGTC
GTGACGGTGACCATGGGGGATGAACAAGGCAACGTCCACAGCAGCCTCAAGTGTAGCAACTGCTACATGGTGTGGGGCGGAGACTTTGTG
AGTCCCGGGCAGCAGGGCCGGATCAGCCACACGGACCTTGTCATTGGGTGCCTGGTGGACTTGGCCACTGGCTTAATGACCTTTACAGCC
AATGGCAAAGAGAGCAACACCTTTTTCCAGGTGGAACCCAACACTAAGCTATTTCCTGCCGTCTTCGTCCTGCCCACCCACCAGAACGTC
ATCCAGTTTGAGCTGGGGAAGCAGAAGAACATCATGCCGTTGTCAGCCGCCATGTTCCAAAGCGAGCGCAAGAACCCGGCCCCGCAGTGC
CCACCGCGGCTGGAGATGCAGATGCTGATGCCAGTGTCCTGGAGCCGCATGCCCAACCACTTCCTGCAGGTGGAGACGAGGCGTGCCGGC
GAGCGGCTGGGCTGGGCCGTGCAGTGCCAGGAGCCGCTGACCATGATGGCGCTGCACATCCCCGAGGAGAACCGGTGCATGGACATCCTG
GAGCTGTCGGAGCGCCTGGACCTGCAGCGCTTCCACTCGCACACCCTGCGCCTCTACCGCGCTGTGTGCGCCCTGGGCAACAATCGCGTG
GCGCACGCTCTGTGCAGCCACGTAGACCAAGCTCAGCTGCTGCACGCCCTGGAGGACGCGCACCTGCCAGGCCCACTGCGCGCAGGCTAC
TATGACCTCCTCATCAGCATCCACCTCGAAAGTGCCTGCCGCAGCCGCCGCTCCATGCTCTCTGAATACATCGTGCCCCTCACGCCTGAG
ACCCGCGCCATCACGCTCTTCCCTCCTGGAAGGAGCACAGAAAATGGTCACCCCCGGCATGGCCTGCCGGGAGTTGGAGTCACCACTTCG
CTGAGGCCCCCGCATCATTTCTCGCCCCCCTGTTTCGTGGCCGCTCTGCCAGCTGCTGGGGCAGCAGAGGCCCCGGCCCGCCTCAGCCCT
GCCATCCCGCTGGAGGCCCTGCGGGACAAGGCACTGAGGATGCTGGGGGAGGCGGTGCGCGACGGTGGGCAGCACGCTCGCGACCCCGTC
GGGGGCTCCGTGGAGTTCCAGTTTGTGCCTGTGCTCAAGCTCGTGTCCACCCTGCTGGTGATGGGCATCTTTGGCGATGAGGATGTGAAA
CAGATCTTGAAGATGATTGAGCCTGAGGTCTTCACTGAGGAAGAAGAGGAGGAGGACGAGGAGGAAGAGGGTGAAGAGGAAGATGAGGAG
GAGAAGGAGGAGGATGAGGAGGAAACAGCACAGGAAAAGGAAGATGAGGAAAAAGAGGAAGAGGAGGCAGCAGAAGGGGAGAAAGAAGAA
GGCTTGGAGGAAGGGCTGCTCCAGATGAAGTTGCCAGAGTCTGTGAAGTTACAGATGTGCCACCTGCTGGAGTATTTCTGTGACCAAGAG
CTGCAGCACCGTGTGGAGTCCCTGGCAGCCTTTGCGGAGCGCTATGTGGACAAGCTCCAGGCCAACCAGCGGAGCCGCTATGGCCTCCTC
ATAAAAGCCTTCAGCATGACCGCAGCAGAGACTGCAAGACGTACCCGCGAGTTCCGCTCCCCACCCCAGGAACAGATCAATATGCTATTG
CAATTCAAAGATGGTACAGATGAGGAAGACTGTCCTCTCCCTGAAGAGATTCGACAGGATTTGCTTGACTTTCATCAAGACCTGCTGGCA
CACTGTGGAATTCAGCTAGATGGAGAGGAGGAGGAACCAGAGGAAGAGACCACCCTGGGCAGCCGCCTCATGAGCCTGTTGGAGAAAGTG
CGGCTGGTGAAGAAGAAGGAAGAGAAACCTGAGGAGGAGCGGTCAGCAGAGGAGAGCAAACCCCGGTCCCTGCAGGAGCTGGTGTCCCAC
ATGGTGGTGCGCTGGGCCCAAGAGGACTTCGTGCAGAGCCCCGAGCTGGTGCGGGCCATGTTCAGCCTCCTGCACCGGCAGTACGACGGG
CTGGGTGAGCTGCTGCGTGCCCTGCCGCGGGCGTACACCATCTCACCGTCCTCCGTGGAAGACACCATGAGCCTGCTCGAGTGCCTCGGC
CAGATCCGCTCGCTGCTCATCGTGCAGATGGGCCCCCAGGAGGAGAACCTCATGATCCAGAGCATCGGGAACATCATGAACAACAAAGTC
TTCTACCAACACCCGAACCTGATGAGGGCGCTGGGCATGCACGAGACGGTCATGGAGGTCATGGTCAACGTCCTCGGGGGCGGCGAGTCC
AAGGAGATCCGCTTCCCCAAGATGGTGACAAGCTGCTGCCGCTTCCTCTGCTATTTCTGCCGAATCAGCCGGCAGAACCAGCGCTCCATG
TTTGACCACCTGAGCTACCTGCTGGAGAACAGTGGCATCGGCCTGGGCATGCAGGGCTCCACGCCCCTGGACGTGGCTGCTGCCTCCGTC
ATTGACAACAATGAGCTGGCCTTGGCATTGCAGGAGCAGGACCTGGAAAAGGTTGTGTCCTACCTGGCAGGCTGTGGCCTCCAGAGCTGC
CCCATGCTTGTGGCCAAAGGGTACCCAGACATTGGCTGGAACCCCTGTGGTGGAGAGCGCTACCTGGACTTCCTGCGCTTTGCTGTCTTC
GTCAACGGCGAGAGCGTGGAGGAGAACGCCAATGTGGTGGTGCGGCTGCTCATCCGGAAGCCTGAGTGCTTCGGACCCGCCCTGCGGGGT
GAGGGTGGCTCAGGGCTGCTGGCTGCCATCGAAGAGGCCATCCGCATCTCCGAGGACCCTGCGAGGGATGGCCCAGGCATCCGCAGGGAC
CGGCGGCGCGAGCACTTTGGTGAGGAACCGCCTGAAGAAAACCGGGTGCACCTGGGACACGCCATCATGTCCTTCTATGCCGCCTTGATC
GACCTGCTCGGACGCTGTGCACCAGAGATGCATCTAATCCAAGCCGGCAAGGGTGAGGCCCTGCGGATCCGCGCCATCCTCCGCTCCCTT
GTGCCCTTGGAGGACCTTGTGGGCATCATCAGCCTCCCACTGCAGATTCCCACCCTGGGCAAAGATGGGGCTCTGGTGCAGCCAAAGATG
TCAGCATCCTTCGTGCCGGACCACAAGGCGTCCATGGTGCTCTTCCTGGACCGTGTGTATGGCATCGAGAACCAGGACTTCTTGCTGCAC
GTGCTGGACGTGGGGTTCCTGCCCGACATGAGGGCAGCCGCCTCGCTGGACACGGCCACTTTCAGCACCACCGAGATGGCGCTGGCGCTG
AACCGCTACCTGTGCCTGGCCGTGCTGCCGCTCATCACCAAGTGTGCGCCGCTCTTTGCGGGCACAGAACACCGCGCCATCATGGTGGAC
TCTATGCTGCATACCGTGTACCGCCTGTCTCGGGGTCGTTCGCTCACCAAGGCGCAGCGTGACGTCATCGAGGACTGCCTCATGTCGCTC
TGCAGGTACATCCGCCCGTCGATGCTGCAGCACCTGTTGCGCCGCCTGGTGTTCGACGTGCCCATCCTCAACGAGTTCGCCAAGATGCCA
CTCAAGCTCCTCACCAACCACTATGAGCGCTGTTGGAAGTACTACTGCCTACCCACGGGCTGGGCCAACTTCGGGGTCACCTCAGAGGAG
GAGCTGCACCTCACACGGAAACTCTTCTGGGGCATCTTTGACTCTCTGGCCCATAAGAAATACGACCCGGAGCTGTACCGCATGGCCATG
CCTTGTCTGTGCGCCATTGCCGGGGCTCTGCCCCCCGACTATGTGGATGCCTCATACTCATCTAAGGCAGAGAAAAAGGCCACAGTGGAT
GCTGAAGGCAACTTTGATCCCCGGCCTGTGGAGACCCTCAATGTGATCATCCCGGAGAAGCTGGACTCCTTCATTAACAAGTTTGCGGAG
TACACACACGAGAAGTGGGCCTTCGACAAGATCCAGAACAACTGGTCCTATGGAGAGAACATAGACGAGGAGCTGAAGACCCACCCCATG
CTGAGGCCCTACAAGACCTTTTCAGAGAAGGACAAAGAGATTTACCGCTGGCCCATCAAGGAGTCCCTGAAGGCCATGATTGCCTGGGAA
TGGACGATAGAGAAGGCCAGGGAGGGTGAGGAGGAGAAGACGGAAAAGAAAAAAACGCGGAAGATATCACAAAGTGCCCAGACCTATGAT
CCTCGAGAAGGCTACAACCCTCAGCCCCCCGACCTTAGTGCTGTTACCCTGTCCCGGGAGCTGCAGGCCATGGCAGAACAACTGGCAGAA
AATTACCACAACACGTGGGGACGGAAGAAGAAGCAGGAGCTGGAAGCCAAAGGCGGTGGGACCCACCCCCTGCTGGTCCCCTACGACACG
CTCACGGCCAAGGAGAAGGCACGAGATCGAGAGAAGGCCCAGGAGCTACTGAAATTCCTGCAGATGAATGGCTACGCGGTTACAAGAGGC
CTTAAGGACATGGAACTGGACTCGTCTTCCATTGAAAAGCGGTTTGCCTTTGGCTTCCTGCAGCAGCTGCTGCGCTGGATGGACATTTCT
CAGGAGTTCATTGCCCACCTGGAGGCTGTGGTCAGCAGTGGGCGAGTGGAAAAGTCCCCACATGAACAGGAGATTAAATTCTTTGCCAAG
ATCCTGCTCCCTTTGATCAACCAGTACTTCACCAACCACTGCCTCTATTTCTTGTCCACTCCGGCTAAAGTGCTGGGCAGCGGTGGCCAC
GCCTCTAACAAGGAGAAGGAAATGATCACCAGCCTCTTCTGCAAACTTGCTGCTCTCGTCCGCCACCGAGTCTCTCTCTTTGGGACAGAC
GCCCCAGCTGTGGTCAACTGTCTTCACATCCTGGCCCGCTCCCTGGATGCCAGGACAGTGATGAAGTCAGGCCCTGAGATCGTGAAGGCT
GGCCTCCGCTCCTTCTTCGAGAGTGCCTCGGAGGACATCGAGAAGATGGTGGAGAACCTGCGGCTGGGCAAGGTGTCGCAGGCGCGCACC
CAGGTGAAAGGCGTGGGCCAGAACCTCACCTACACCACTGTGGCACTGCTGCCGGTCCTCACCACCCTCTTCCAGCACATCGCCCAGCAC
CAGTTCGGAGATGACGTCATCCTGGACGACGTCCAGGTCTCTTGCTACCGAACGCTGTGCAGTATCTACTCCCTGGGAACCACCAAGAAC
ACTTATGTGGAAAAGCTTCGGCCAGCCCTCGGGGAGTGCCTGGCCCGTCTGGCAGCAGCCATGCCGGTGGCGTTCCTGGAGCCGCAGCTG
AACGAGTACAACGCCTGCTCCGTGTACACCACCAAGTCTCCGCGGGAGCGGGCCATCCTGGGGCTCCCCAACAGTGTGGAGGAGATGTGT
CCCGACATCCCGGTGCTGGAGCGGCTCATGGCAGACATTGGGGGGCTGGCCGAGTCAGGTGCCCGCTACACAGAGATGCCGCATGTCATC
GAGATCACGCTGCCCATGCTATGCAGCTACCTGCCCCGATGGTGGGAGCGCGGGCCCGAGGCACCCCCTTCCGCCCTGCCCGCCGGCGCC
CCCCCACCCTGCACAGCTGTCACCTCTGACCACCTCAACTCCCTGCTGGGGAATATCCTGAGAATCATCGTCAACAACCTGGGCATTGAC
GAGGCCTCCTGGATGAAGCGGCTGGCTGTGTTCGCACAGCCCATTGTGAGCCGTGCACGGCCGGAGCTCCTGCAGTCCCACTTCATCCCA
ACTATCGGGCGGCTGCGCAAGAGGGCAGGGAAGGTGGTGTCCGAGGAGGAGCAGCTGCGCCTGGAGGCCAAGGCGGAGGCCCAGGAGGGC
GAGCTGCTGGTGCGGGACGAGTTCTCTGTGCTCTGCCGGGACCTCTACGCCCTGTATCCGCTGCTCATCCGCTACGTGGACAACAACAGG
GCGCAGTGGCTGACGGAGCCGAATCCCAGCGCGGAGGAGCTGTTCAGGATGGTGGGCGAGATCTTCATCTACTGGTCCAAGTCCCACAAC
TTCAAGCGCGAGGAGCAGAACTTTGTGGTCCAGAATGAGATCAACAACATGTCCTTCCTGACTGCTGACAACAAAAGCAAAATGGCTAAG
GCGGGAGATATACAGTCCGGTGGCTCGGACCAGGAACGCACCAAGAAGAAGCGCCGGGGGGACCGGTACTCTGTGCAGACGTCACTGATC
GTGGCCACACTGAAGAAGATGCTGCCCATCGGCCTGAATATGTGTGCGCCCACCGACCAAGACCTCATCACGCTGGCCAAGACCCGTTAC
GCCCTGAAAGACACAGATGAGGAGGTCCGGGAATTTCTGCACAACAACCTTCACCTTCAGGGAAAGGTCGAAGGCTCCCCGTCTCTGCGC
TGGCAGATGGCTCTGTACCGGGGCGTCCCGGGTCGCGAGGAGGACGCCGATGACCCCGAGAAAATCGTGCGCAGAGTCCAGGAAGTGTCA
GCCGTGCTCTACTACCTGGACCAGACCGAGCACCCTTACAAGTCTAAGAAGGCCGTGTGGCACAAGCTTTTGTCCAAACAGCGCCGGCGG
GCAGTCGTGGCCTGTTTCCGTATGACGCCCCTGTACAACCTGCCCACGCACCGGGCATGTAACATGTTCCTGGAGAGCTACAAGGCTGCA
TGGATCCTGACTGAAGACCACAGTTTTGAGGACCGCATGATAGATGACCTTTCAAAAGCTGGGGAGCAGGAGGAGGAGGAGGAAGAGGTG
GAAGAGAAGAAGCCAGACCCCCTGCACCAGTTGGTCCTGCACTTCAGCCGCACTGCCCTGACGGAAAAGAGCAAACTGGATGAGGATTAC
CTGTACATGGCCTATGCTGATATCATGGCAAAGAGCTGCCACCTGGAGGAGGGAGGGGAGAACGGTGAAGCTGAAGAGGAGGTTGAGGTC
TCCTTTGAGGAGAAACAGATGGAGAAGCAGAGGCTCTTGTACCAGCAAGCACGGCTGCACACCCGGGGGGCGGCCGAGATGGTGCTGCAG
ATGATCAGTGCCTGCAAAGGAGAGACAGGTGCCATGGTGTCCTCCACCCTGAAGCTGGGCATCTCCATCCTCAATGGAGGCAATGCTGAG
GTCCAGCAGAAAATGCTGGATTATCTTAAGGACAAGAAGGAAGTTGGCTTCTTCCAGAGTATCCAGGCACTGATGCAAACATGCAGCGTC
CTGGATCTCAATGCCTTTGAGAGACAGAACAAGGCCGAGGGGCTGGGCATGGTGAATGAGGATGGCACTGTCATCAATCGCCAGAACGGA
GAGAAGGTCATGGCGGATGATGAATTCACACAAGACCTGTTCCGATTCCTACAATTGCTCTGTGAGGGGCACAATAATGATTTCCAGAAC
TACCTACGGACACAGACAGGGAACACGACCACTATTAACATCATCATTTGCACTGTGGACTACCTCCTGCGGCTGCAGGAATCCATCAGC
GACTTCTACTGGTACTACTCGGGCAAGGATGTCATTGAAGAGCAGGGCAAGAGGAACTTCTCCAAAGCCATGTCGGTGGCTAAGCAGGTG
TTCAACAGCCTCACTGAGTACATCCAGGGTCCCTGCACCGGGAACCAGCAGAGCCTGGCGCACAGTCGCCTATGGGACGCAGTGGTGGGA
TTCCTGCACGTGTTCGCCCACATGATGATGAAGCTCGCTCAGGACTCAAGCCAGATCGAGCTGCTGAAGGAGCTGCTGGATCTGCAGAAG
GACATGGTGGTGATGTTGCTGTCGCTACTAGAAGGGAACGTGGTGAACGGCATGATCGCCCGGCAGATGGTGGACATGCTCGTGGAATCC
TCATCCAATGTGGAGATGATCCTCAAGTTCTTCGACATGTTCCTGAAACTCAAGGACATTGTGGGCTCTGAAGCCTTCCAGGACTACGTA
ACGGATCCCCGTGGCCTCATCTCCAAGAAGGACTTCCAGAAGGCCATGGACAGCCAGAAGCAGTTCAGCGGTCCAGAAATCCAGTTCCTG
CTTTCGTGCTCCGAAGCGGATGAGAACGAAATGATCAACTGCGAAGAGTTCGCCAACCGCTTCCAGGAGCCAGCACGCGACATCGGCTTC
AACGTGGCGGTGCTGCTGACCAACCTGTCGGAGCATGTGCCGCATGACCCTCGCCTGCACAACTTCCTGGAGCTGGCCGAGAGCATCCTT
GAGTACTTCCGCCCCTACCTGGGCCGCATCGAGATCATGGGCGCGTCACGCCGCATCGAGCGCATCTACTTCGAGATCTCAGAGACCAAC
CGCGCCCAGTGGGAGATGCCCCAGGTGAAGGAGTCCAAGCGCCAGTTCATCTTCGACGTGGTGAACGAGGGCGGCGAGGCTGAGAAGATG
GAGCTCTTCGTGAGTTTCTGCGAGGACACCATCTTCGAGATGCAGATCGCCGCGCAGATCTCGGAGCCCGAGGGCGAGCCGGAGACCGAC
GAGGACGAGGGCGCGGGCGCGGCGGAGGCGGGCGCGGAAGGCGCGGAGGAGGGCGCGGCGGGGCTCGAGGGCACGGCGGCCACGGCGGCG
GCGGGGGCGACGGCGCGGGTTGTGGCGGCCGCAGGCCGGGCCCTGCGAGGCCTCAGCTACCGCAGCCTGCGGCGGCGCGTGCGGCGGCTG
CGGCGGCTTACGGCCCGCGAGGCGGCCACCGCAGTGGCGGCGCTGCTCTGGGCAGCAGTGACGCGCGCTGGGGCCGCTGGCGCGGGGGCG
GCGGCGGGCGCGCTGGGCCTGCTCTGGGGCTCGCTGTTCGGCGGCGGCCTGGTGGAGGGCGCCAAGAAGGTGACGGTGACCGAGCTCCTG
GCAGGCATGCCCGACCCCACCAGCGACGAGGTGCACGGCGAGCAGCCGGCCGGGCCGGGCGGAGACGCAGACGGCGAGGGTGCCAGCGAG
GGCGCTGGAGACGCCGCGGAGGGCGCTGGAGACGAGGAGGAGGCGGTGCACGAGGCCGGGCCGGGCGGTGCCGACGGGGCGGTGGCCGTG
ACCGATGGGGGCCCCTTCCGGCCCGAAGGGGCTGGCGGTCTCGGGGACATGGGGGACACGACGCCTGCGGAACCGCCCACACCCGAGGGC
TCTCCCATCCTCAAGAGGAAATTGGGGGTGGATGGAGTGGAGGAGGAGCTCCCGCCAGAGCCAGAGCCCGAGCCGGAACCAGAGCTGGAG
CCGGAGAAAGCCGATGCCGAGAATGGGGAGAAGGAAGAAGTTCCCGAGCCCACACCAGAGCCCCCCAAGAAGCAAGCACCTCCCTCACCC
CCTCCAAAGAAGGAGGAAGCTGGAGGCGAATTCTGGGGAGAACTGGAGGTGCAGAGGGTGAAGTTCCTGTGCTCAGTGGGCCCCTCCTCT
GATAAGGCCCTGACCTTCATGAAGGACCATTTCCTGATGGATGAGCAAGTGGTGGGGACGCCCCTGCTGGTGAAATCTGGCGTGGAGTAT
ACACGGCTTGCAGTGGAGACAGCCCAGGGCCTTGATGGGCACAGCCATCTTGTCATGTACCTGGGAACCACCACAGGGTCGCTCCACAAG
GCTGTGGTAAGTGGGGACAGCAGTGCTCATCTGGTGGAAGAGATTCAGCTGTTCCCTGACCCTGAACCTGTTCGCAACCTGCAGCTGGCC
CCCACCCAGGGTGCAGTGTTTGTAGGCTTCTCAGGAGGTGTCTGGAGGGTGCCCCGAGCCAACTGTAGTGTCTATGAGAGCTGTGTGGAC
TGTGTCCTTGCCCGGGACCCCCACTGTGCCTGGGACCCTGAGTCCCGAACCTGTTGCCTCCTGTCTGCCCCCAACCTGAACTCCTGGAAG
CAGGACATGGAGCGGGGGAACCCAGAGTGGGCATGTGCCAGTGGCCCCATGAGCAGGAGCCTTCGGCCTCAGAGCCGCCCGCAAATCATT
AAAGAAGTCCTGGCTGTCCCCAACTCCATCCTGGAGCTCCCCTGCCCCCACCTGTCAGCCTTGGCCTCTTATTATTGGAGTCATGGCCCA
GCAGCAGTCCCAGAAGCCTCTTCCACTGTCTACAATGGCTCCCTCTTGCTGATAGTGCAGGATGGAGTTGGGGGTCTCTACCAGTGCTGG
GCAACTGAGAATGGCTTTTCATACCCTGTGATCTCCTACTGGGTGGACAGCCAGGACCAGACCCTGGCCCTGGATCCTGAACTGGCAGGC
ATCCCCCGGGAGCATGTGAAGGTCCCGTTGACCAGGGTCAGTGGTGGGGCCGCCCTGGCTGCCCAGCAGTCCTACTGGCCCCACTTTGTC
ACTGTCACTGTCCTCTTTGCCTTAGTGCTTTCAGGAGCCCTCATCATCCTCGTGGCCTCCCCATTGAGAGCACTCCGGGCTCGGGGCAAG
GTTCAGGGCTGTGAGACCCTGCGCCCTGGGGAGAAGGCCCCGTTAAGCAGAGAGCAACACCTCCAGTCTCCCAAGGAATGCAGGACCTCT
GCCAGTGATGTGGACGCTGACAACAACTGCCTAGGCACTGAGGTAGCTTAAACTCTAGGCACAGGCCGGGGCTGCGGTGCAGGCACCTGG
CCATGCTGGCTGGGCGGCCCAAGCACAGCCCTGACTAGGATGACAGCAGCACAAAAGACCACCTTTCTCCCCTGAGAGGAGCTTCTGCTA
CTCTGCATCACTGATGACACTCAGCAGGGTGATGCACAGCAGTCTGCCTCCCCTATGGGACTCCCTTCTACCAAGCACATGAGCTCTCTA
ACAGGGTGGGGGCTACCCCCAGACCTGCTCCTACACTGATATTGAAGAACCTGGAGAGGATCCTTCAGTTCTGGCCATTCCAGGGACCCT
CCAGAAACACAGTGTTTCAAGAGACCCTAAAAAACCTGCCTGTCCCAGGACCCTATGGTAATGAACACCAAACATCTAAACAATCATATG
CTAACATGCCACTCCTGGAAACTCCACTCTGAAGCTGCCGCTTTGGACACCAACACTCCCTTCTCCCAGGGTCATGCAGGGATCTGCTCC
CTCCTGCTTCCCTTACCAGTCGTGCACCGCTGACTCCCAGGAAGTCTTTCCTGAAGTCTGACCACCTTTCTTCTTGCTTCAGTTGGGGCA
GACTCTGATCCCTTCTGCCCTGGCAGAATGGCAGGGGTAATCTGAGCCTTCTTCACTCCTTTACCCTAGCTGACCCCTTCACCTCTCCCC


Top

FusionGenePPI for RYR1_SEMA4A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RYR1TRDN, HOMER1, FKBP1A, RYR2, S100A1, HOMER2, HOMER3, ANK1, CALM1SEMA4ADDX54


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+921053614_364345485034CALM
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+931063614_364345535039CALM
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+921053614_364345485034CALM
HgeneRYR1chr19:39058557chr1:156142617ENST00000355481+92105669_68045485034FKBP1A
HgeneRYR1chr19:39058557chr1:156142617ENST00000359596+93106669_68045535039FKBP1A
HgeneRYR1chr19:39058557chr1:156142617ENST00000360985+92105669_68045485034FKBP1A


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RYR1_SEMA4A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneRYR1P21817DB00201CaffeineRyanodine receptor 1small moleculeapproved
HgeneRYR1P21817DB01219DantroleneRyanodine receptor 1small moleculeapproved|investigational
HgeneRYR1P21817DB04786SuraminRyanodine receptor 1small moleculeapproved|investigational
HgeneRYR1P21817DB09085TetracaineRyanodine receptor 1small moleculeapproved|vet_approved

Top

RelatedDiseases for RYR1_SEMA4A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRYR1C0024591Malignant hyperpyrexia due to anesthesia49CTD_human;HPO;ORPHANET;UNIPROT
HgeneRYR1C0751951Central Core Myopathy (disorder)37CTD_human;ORPHANET;UNIPROT
HgeneRYR1C1850674MINICORE MYOPATHY WITH EXTERNAL OPHTHALMOPLEGIA (disorder)3CTD_human;ORPHANET;UNIPROT
HgeneRYR1C0007134Renal Cell Carcinoma1CTD_human
HgeneRYR1C0752282Congenital Structural Myopathy1CTD_human
TgeneSEMA4AC1853214RETINITIS PIGMENTOSA 351CTD_human;UNIPROT