FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32430

FusionGeneSummary for RWDD1_CEP85L

check button Fusion gene summary
Fusion gene informationFusion gene name: RWDD1_CEP85L
Fusion gene ID: 32430
HgeneTgene
Gene symbol

RWDD1

CEP85L

Gene ID

51389

387119

Gene nameRWD domain containing 1centrosomal protein 85 like
SynonymsCGI-24|PTD013C6orf204|NY-BR-15|bA57K17.2
Cytomap

6q22.1

6q22.31

Type of geneprotein-codingprotein-coding
DescriptionRWD domain-containing protein 1DRG family-regulatory protein 2centrosomal protein of 85 kDa-likecentrosomal protein 85kDa-likeserologically defined breast cancer antigen NY-BR-15
Modification date2018052320180523
UniProtAcc

Q9H446

Q5SZL2

Ensembl transtripts involved in fusion geneENST00000466444, ENST00000392526, 
ENST00000487832, ENST00000517800, 
ENST00000368491, ENST00000368488, 
ENST00000360290, ENST00000392500, 
ENST00000419517, ENST00000472713, 
Fusion gene scores* DoF score4 X 3 X 4=484 X 4 X 3=48
# samples 44
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RWDD1 [Title/Abstract] AND CEP85L [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-SG-A6Z7-01ARWDD1chr6

116906020

+CEP85Lchr6

118845083

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000466444ENST00000368491RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
In-frameENST00000466444ENST00000368488RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
In-frameENST00000466444ENST00000360290RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
In-frameENST00000466444ENST00000392500RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
In-frameENST00000466444ENST00000419517RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
5CDS-intronENST00000466444ENST00000472713RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
5UTR-3CDSENST00000392526ENST00000368491RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
5UTR-3CDSENST00000392526ENST00000368488RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
5UTR-3CDSENST00000392526ENST00000360290RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
5UTR-3CDSENST00000392526ENST00000392500RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
5UTR-3CDSENST00000392526ENST00000419517RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
5UTR-intronENST00000392526ENST00000472713RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
5UTR-3CDSENST00000487832ENST00000368491RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
5UTR-3CDSENST00000487832ENST00000368488RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
5UTR-3CDSENST00000487832ENST00000360290RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
5UTR-3CDSENST00000487832ENST00000392500RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
5UTR-3CDSENST00000487832ENST00000419517RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
5UTR-intronENST00000487832ENST00000472713RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
intron-3CDSENST00000517800ENST00000368491RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
intron-3CDSENST00000517800ENST00000368488RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
intron-3CDSENST00000517800ENST00000360290RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
intron-3CDSENST00000517800ENST00000392500RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
intron-3CDSENST00000517800ENST00000419517RWDD1chr6

116906020

+CEP85Lchr6

118845083

-
intron-intronENST00000517800ENST00000472713RWDD1chr6

116906020

+CEP85Lchr6

118845083

-

Top

FusionProtFeatures for RWDD1_CEP85L


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RWDD1

Q9H446

CEP85L

Q5SZL2

Protects DRG2 from proteolytic degradation.{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCEP85Lchr6:116906020chr6:118845083ENST00000360290-26439_682238395Coiled coilOntology_term=ECO:0000255
TgeneCEP85Lchr6:116906020chr6:118845083ENST00000368488-314439_682343809Coiled coilOntology_term=ECO:0000255
TgeneCEP85Lchr6:116906020chr6:118845083ENST00000368491-213439_682340806Coiled coilOntology_term=ECO:0000255
TgeneCEP85Lchr6:116906020chr6:118845083ENST00000392500-48439_682343500Coiled coilOntology_term=ECO:0000255
TgeneCEP85Lchr6:116906020chr6:118845083ENST00000419517-26439_682340497Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRWDD1chr6:116906020chr6:118845083ENST00000392526+5910_114-6148DomainRWD
HgeneRWDD1chr6:116906020chr6:118845083ENST00000466444+3710_11490244DomainRWD
HgeneRWDD1chr6:116906020chr6:118845083ENST00000487832+4810_114-6148DomainRWD


Top

FusionGeneSequence for RWDD1_CEP85L


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000368491_chr6_118845083_-_556aa
MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQ
VLTGSSRQSYSPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQHAMLGHYVNCEDSYVASLQPQYENTSLQTP
FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEEKLKTRDRYISSLKKKCQKESEQNKEKQRRIETLEKYLADLPT
LDDVQSQSLQLQILEEKNKNLQEALIDTEKKLEEIKKQCQDKETQLICQKKKEKELVTTVQSLQQKVERCLEDGIRLPMLDAKQLQNEND
NLRQQNETASKIIDSQQDEIDRMILEIQSMQGKLSKEKLTTQKMMEELEKKERNVQRLTKALLENQRQTDETCSLLDQGQEPDQSRQQTV
LSKRPLFDLTVIDQLFKEMSCCLFDLKALCSILNQRAQGKEPNLSLLLGIRSMNCSAEETENDHSTETLTKKLSDVCQLRRDIDELRTTI

>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000368488_chr6_118845083_-_556aa
MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQ
VLTGSSRQSYSPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQHAMLGHYVNCEDSYVASLQPQYENTSLQTP
FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEEKLKTRDRYISSLKKKCQKESEQNKEKQRRIETLEKYLADLPT
LDDVQSQSLQLQILEEKNKNLQEALIDTEKKLEEIKKQCQDKETQLICQKKKEKELVTTVQSLQQKVERCLEDGIRLPMLDAKQLQNEND
NLRQQNETASKIIDSQQDEIDRMILEIQSMQGKLSKEKLTTQKMMEELEKKERNVQRLTKALLENQRQTDETCSLLDQGQEPDQSRQQTV
LSKRPLFDLTVIDQLFKEMSCCLFDLKALCSILNQRAQGKEPNLSLLLGIRSMNCSAEETENDHSTETLTKKLSDVCQLRRDIDELRTTI

>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000360290_chr6_118845083_-_247aa
MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQ
VLTGSSRQSYSPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQHAMLGHYVNCEDSYVASLQPQYENTSLQTP

>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000392500_chr6_118845083_-_247aa
MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQ
VLTGSSRQSYSPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQHAMLGHYVNCEDSYVASLQPQYENTSLQTP

>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000419517_chr6_118845083_-_247aa
MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQ
VLTGSSRQSYSPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQHAMLGHYVNCEDSYVASLQPQYENTSLQTP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000368491_chr6_118845083_-_1668nt
ATGACAGATTACGGCGAGGAGCAGCGCAACGAGCTGGAGGCCCTGGAGTCCATCTACCCTGACTCCTTCACAGTATTATCAGAAAATCCA
CCCAGCTTCACCATTACTGTGACGTCTGAGGCTGGAGAAAATGATGAAACTGTCCAGACTACCCTCAAGTTTACATACAGTGAAAAATAC
CCAGATGAAGCTCCCCTTTATGAAATATTCTCCCAGGAAAATCTAGAAGATAATGATGTCTCAGACATTTTAAAATTACTAGCATTACAG
GTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGTAAGTGGGAATCAATGTTGAAAATAAAAGAAGGACTT
CTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTGCATGAGAGGATAAGGGATAATGAATTACGGGCTCAA
CATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTGCAGCCACAATATGAGAACACTTCACTCCAGACACCA
TTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTTGCATCTACTGAGAAAGAAGTTTTACAGCTTAATGAG
TTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAAAAACTTAAAACTAGAGATCGATACATCAGTAGTCTG
AAAAAGAAATGCCAGAAGGAATCTGAACAAAACAAAGAAAAGCAGAGAAGAATTGAGACCTTGGAAAAGTATCTGGCTGATCTTCCAACT
CTAGATGATGTACAGAGTCAGAGTCTACAGCTGCAGATTCTGGAAGAAAAAAATAAGAATTTACAAGAGGCTTTGATAGATACAGAAAAA
AAACTTGAAGAGATCAAAAAGCAGTGTCAAGATAAAGAGACACAGTTAATATGCCAGAAAAAGAAAGAAAAGGAGTTAGTAACTACCGTT
CAGAGTTTGCAACAAAAAGTAGAAAGATGCCTTGAAGATGGAATCCGCCTTCCCATGTTAGATGCAAAACAGCTTCAGAATGAAAATGAT
AATCTCAGACAACAAAATGAGACTGCTAGTAAGATAATAGACAGCCAACAAGATGAGATTGACAGAATGATTTTAGAAATTCAGTCTATG
CAAGGAAAGCTTTCTAAAGAGAAACTGACCACTCAAAAGATGATGGAAGAGCTGGAAAAGAAAGAAAGAAATGTACAGAGATTAACAAAA
GCATTGCTTGAAAACCAAAGACAAACAGATGAGACATGCTCTTTATTGGATCAGGGCCAGGAACCTGACCAATCTAGGCAGCAGACAGTT
CTTTCCAAACGGCCACTATTTGATTTGACTGTGATTGATCAGCTGTTCAAGGAAATGTCCTGTTGTTTGTTTGACTTGAAAGCATTGTGT
AGTATTCTTAATCAGCGTGCTCAGGGCAAGGAGCCTAATCTTTCATTATTACTGGGAATAAGATCAATGAACTGTTCAGCTGAAGAGACT
GAGAATGACCACAGCACAGAAACACTCACTAAAAAGCTGTCAGATGTGTGCCAGTTACGAAGAGACATTGATGAATTAAGGACTACAATA

>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000368488_chr6_118845083_-_1668nt
ATGACAGATTACGGCGAGGAGCAGCGCAACGAGCTGGAGGCCCTGGAGTCCATCTACCCTGACTCCTTCACAGTATTATCAGAAAATCCA
CCCAGCTTCACCATTACTGTGACGTCTGAGGCTGGAGAAAATGATGAAACTGTCCAGACTACCCTCAAGTTTACATACAGTGAAAAATAC
CCAGATGAAGCTCCCCTTTATGAAATATTCTCCCAGGAAAATCTAGAAGATAATGATGTCTCAGACATTTTAAAATTACTAGCATTACAG
GTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGTAAGTGGGAATCAATGTTGAAAATAAAAGAAGGACTT
CTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTGCATGAGAGGATAAGGGATAATGAATTACGGGCTCAA
CATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTGCAGCCACAATATGAGAACACTTCACTCCAGACACCA
TTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTTGCATCTACTGAGAAAGAAGTTTTACAGCTTAATGAG
TTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAAAAACTTAAAACTAGAGATCGATACATCAGTAGTCTG
AAAAAGAAATGCCAGAAGGAATCTGAACAAAACAAAGAAAAGCAGAGAAGAATTGAGACCTTGGAAAAGTATCTGGCTGATCTTCCAACT
CTAGATGATGTACAGAGTCAGAGTCTACAGCTGCAGATTCTGGAAGAAAAAAATAAGAATTTACAAGAGGCTTTGATAGATACAGAAAAA
AAACTTGAAGAGATCAAAAAGCAGTGTCAAGATAAAGAGACACAGTTAATATGCCAGAAAAAGAAAGAAAAGGAGTTAGTAACTACCGTT
CAGAGTTTGCAACAAAAAGTAGAAAGATGCCTTGAAGATGGAATCCGCCTTCCCATGTTAGATGCAAAACAGCTTCAGAATGAAAATGAT
AATCTCAGACAACAAAATGAGACTGCTAGTAAGATAATAGACAGCCAACAAGATGAGATTGACAGAATGATTTTAGAAATTCAGTCTATG
CAAGGAAAGCTTTCTAAAGAGAAACTGACCACTCAAAAGATGATGGAAGAGCTGGAAAAGAAAGAAAGAAATGTACAGAGATTAACAAAA
GCATTGCTTGAAAACCAAAGACAAACAGATGAGACATGCTCTTTATTGGATCAGGGCCAGGAACCTGACCAATCTAGGCAGCAGACAGTT
CTTTCCAAACGGCCACTATTTGATTTGACTGTGATTGATCAGCTGTTCAAGGAAATGTCCTGTTGTTTGTTTGACTTGAAAGCATTGTGT
AGTATTCTTAATCAGCGTGCTCAGGGCAAGGAGCCTAATCTTTCATTATTACTGGGAATAAGATCAATGAACTGTTCAGCTGAAGAGACT
GAGAATGACCACAGCACAGAAACACTCACTAAAAAGCTGTCAGATGTGTGCCAGTTACGAAGAGACATTGATGAATTAAGGACTACAATA

>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000360290_chr6_118845083_-_741nt
ATGACAGATTACGGCGAGGAGCAGCGCAACGAGCTGGAGGCCCTGGAGTCCATCTACCCTGACTCCTTCACAGTATTATCAGAAAATCCA
CCCAGCTTCACCATTACTGTGACGTCTGAGGCTGGAGAAAATGATGAAACTGTCCAGACTACCCTCAAGTTTACATACAGTGAAAAATAC
CCAGATGAAGCTCCCCTTTATGAAATATTCTCCCAGGAAAATCTAGAAGATAATGATGTCTCAGACATTTTAAAATTACTAGCATTACAG
GTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGTAAGTGGGAATCAATGTTGAAAATAAAAGAAGGACTT
CTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTGCATGAGAGGATAAGGGATAATGAATTACGGGCTCAA
CATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTGCAGCCACAATATGAGAACACTTCACTCCAGACACCA
TTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTTGCATCTACTGAGAAAGAAGTTTTACAGCTTAATGAG
TTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAAAAAGTAGGTTTTTCTAATAAAGTTGAATTAGGTCAA

>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000392500_chr6_118845083_-_741nt
ATGACAGATTACGGCGAGGAGCAGCGCAACGAGCTGGAGGCCCTGGAGTCCATCTACCCTGACTCCTTCACAGTATTATCAGAAAATCCA
CCCAGCTTCACCATTACTGTGACGTCTGAGGCTGGAGAAAATGATGAAACTGTCCAGACTACCCTCAAGTTTACATACAGTGAAAAATAC
CCAGATGAAGCTCCCCTTTATGAAATATTCTCCCAGGAAAATCTAGAAGATAATGATGTCTCAGACATTTTAAAATTACTAGCATTACAG
GTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGTAAGTGGGAATCAATGTTGAAAATAAAAGAAGGACTT
CTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTGCATGAGAGGATAAGGGATAATGAATTACGGGCTCAA
CATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTGCAGCCACAATATGAGAACACTTCACTCCAGACACCA
TTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTTGCATCTACTGAGAAAGAAGTTTTACAGCTTAATGAG
TTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAAAAAGTAGGTTTTTCTAATAAAGTTGAATTAGGTCAA

>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000419517_chr6_118845083_-_741nt
ATGACAGATTACGGCGAGGAGCAGCGCAACGAGCTGGAGGCCCTGGAGTCCATCTACCCTGACTCCTTCACAGTATTATCAGAAAATCCA
CCCAGCTTCACCATTACTGTGACGTCTGAGGCTGGAGAAAATGATGAAACTGTCCAGACTACCCTCAAGTTTACATACAGTGAAAAATAC
CCAGATGAAGCTCCCCTTTATGAAATATTCTCCCAGGAAAATCTAGAAGATAATGATGTCTCAGACATTTTAAAATTACTAGCATTACAG
GTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGTAAGTGGGAATCAATGTTGAAAATAAAAGAAGGACTT
CTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTGCATGAGAGGATAAGGGATAATGAATTACGGGCTCAA
CATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTGCAGCCACAATATGAGAACACTTCACTCCAGACACCA
TTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTTGCATCTACTGAGAAAGAAGTTTTACAGCTTAATGAG
TTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAAAAAGTAGGTTTTTCTAATAAAGTTGAATTAGGTCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000368491_chr6_118845083_-_6517nt
AGAACGAGTCGAACGTGGAAGTAGGGAGCAGGCGGAGGCCGGCGCGGAGCTGCAGTTAAGCAAGCCGGGTCTGGCTTTGGGCCCTGGGCC
TTCCAGCCGGGGACTCTGCGCCTGCGCCCGCCTGGCCGCCGCCCGCTCTCCCGGCGCGGCAGCTGTCTGGGCTGCTGCGCGCCGCCTAGG
TGTCTGGGCGATCTATGGGCAAGAGCAAGGGCCACGATGACAGATTACGGCGAGGAGCAGCGCAACGAGCTGGAGGCCCTGGAGTCCATC
TACCCTGACTCCTTCACAGTATTATCAGAAAATCCACCCAGCTTCACCATTACTGTGACGTCTGAGGCTGGAGAAAATGATGAAACTGTC
CAGACTACCCTCAAGTTTACATACAGTGAAAAATACCCAGATGAAGCTCCCCTTTATGAAATATTCTCCCAGGAAAATCTAGAAGATAAT
GATGTCTCAGACATTTTAAAATTACTAGCATTACAGGTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGT
AAGTGGGAATCAATGTTGAAAATAAAAGAAGGACTTCTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTG
CATGAGAGGATAAGGGATAATGAATTACGGGCTCAACATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTG
CAGCCACAATATGAGAACACTTCACTCCAGACACCATTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTT
GCATCTACTGAGAAAGAAGTTTTACAGCTTAATGAGTTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAA
AAACTTAAAACTAGAGATCGATACATCAGTAGTCTGAAAAAGAAATGCCAGAAGGAATCTGAACAAAACAAAGAAAAGCAGAGAAGAATT
GAGACCTTGGAAAAGTATCTGGCTGATCTTCCAACTCTAGATGATGTACAGAGTCAGAGTCTACAGCTGCAGATTCTGGAAGAAAAAAAT
AAGAATTTACAAGAGGCTTTGATAGATACAGAAAAAAAACTTGAAGAGATCAAAAAGCAGTGTCAAGATAAAGAGACACAGTTAATATGC
CAGAAAAAGAAAGAAAAGGAGTTAGTAACTACCGTTCAGAGTTTGCAACAAAAAGTAGAAAGATGCCTTGAAGATGGAATCCGCCTTCCC
ATGTTAGATGCAAAACAGCTTCAGAATGAAAATGATAATCTCAGACAACAAAATGAGACTGCTAGTAAGATAATAGACAGCCAACAAGAT
GAGATTGACAGAATGATTTTAGAAATTCAGTCTATGCAAGGAAAGCTTTCTAAAGAGAAACTGACCACTCAAAAGATGATGGAAGAGCTG
GAAAAGAAAGAAAGAAATGTACAGAGATTAACAAAAGCATTGCTTGAAAACCAAAGACAAACAGATGAGACATGCTCTTTATTGGATCAG
GGCCAGGAACCTGACCAATCTAGGCAGCAGACAGTTCTTTCCAAACGGCCACTATTTGATTTGACTGTGATTGATCAGCTGTTCAAGGAA
ATGTCCTGTTGTTTGTTTGACTTGAAAGCATTGTGTAGTATTCTTAATCAGCGTGCTCAGGGCAAGGAGCCTAATCTTTCATTATTACTG
GGAATAAGATCAATGAACTGTTCAGCTGAAGAGACTGAGAATGACCACAGCACAGAAACACTCACTAAAAAGCTGTCAGATGTGTGCCAG
TTACGAAGAGACATTGATGAATTAAGGACTACAATATCAGACCGCTATGCTCAGGACATGGGAGACAACTGCATTACTCAGTGATCAAGT
GTTAGTCCCACAGCAATAATGACCTGTTGTTTAAATGCTGCTGTGTTATGGAGCCATAATGGAAGGTTGCAAGTGACATGACTTGCACTT
AGGGATTTTTTTTCTGTGGATTTGTTTTGTTGAAGGGGAGAAGGGAAGTGAAGAGATTTTGAAGGGGCTTATCTAATCAGGCAAAAAGAA
AAAAAATCAAATTACCTTTGGAAAATATGATAAAATCTACAAGGAAAAAAATGTCTATATTCTCAAACTACTGATTGTAGGACCAAGCTG
TGAAGAGTACCCTTCACATGAAGGAGTAGGATTCCTTTTAATCCTATAGCTTTGTGTGTTTGTGTGTGCATGTATGTGTGTTGTTGTGTG
TGTGTGCACGTGCTTTATTCACAAATTTATAAGGGTTTCTAGGGTCAGAGCAGAGCTTCTGAGAAAGGCACACGCTGTTTATTCTTATAT
TTCTTTCATATAGAAGCTTGTGTTGTACTTTGGGATTTTCAGTGGCTGGCTGAACAAGAGTTCAAACAGCAGGCAAGTGTTGTCATGGTA
GTACAGGAGGCAAAACCATTTATATTTTGAACACTTACTGCACTGATAGGATGTTTGTGGTTGAGCTGATTTTAGTACTGTAGATAGGTC
AGCTGTTTTTCCAGAGTGATTGTGGATTTCCCAAGAGGTGTGAAATTTTGACGTGATGCTCTTTTTCCTTAGCATTGTAATGTATGTGTT
ACAAGAAAGGTTAACATAACTTGAACTAATTTTAACATGTTCCTTACTATTTACAATTTTTTATTTATATGTTTTATATATATACATATA
TAAATGTAAACAAAGCCATATATAATTAATAAAGGCATTGGATCATTATTATAAAAGGAAGATTAACAAAGTTACCCTGGAACAATAGCT
TACTTATCCAAATCTCAACATTTACATTTTAACAGTTTTGTATGTTTCAAAGTTGAAACTACTGTAAGAGAAAGCCAATACTATTTATAT
CTGAATCAACAGTAGCATAAACATTTTTTAATTGAGATTGTATTTTAATCCCTTTTGTTAAAGTACATTAACAACAGTTTTTCACAGGAT
ATGAACTTGGCGAAATTAGTTCTTAATCTGAATTACAGGGTATTACTATGAAATGCAGTTGATTTTGCAGTAGACGTACAGTCATTTAAA
CTTCCAAATGAGTGTTGTCCATGTTTCTGTTGGTATTTTGGAAGGATTATACATTTTATTGCCTTCAGCATTGATTATGTTCTTTTGAAT
ATACTTAGTTTTGGCGAAAGCCTTGTCCTTTGTAAGTTGGTTTGATCTTGTGATGCAACCAAGTCTCATTTAGGTCAAGACTAAATAAGA
GATGGAGGGGTAGAGGGTGTGACTCAAGCAGGATAATATTGATTTGATAAAGAGCATATCACATGCCTGTTTTCTTGCCAGATAAAGGGC
ATAGCACATGCCTGTTTTCTTATATACTAGAATAAAGGCTCTCCTAGGAAAGATTTTTCTTAAATATTTAAAAGTGAAAATGTGAGACAA
GGCCTTCAAGGAGACTACCCAGGAAGATACACAGTTTAAAATGTTGGCTATACAGCTCTCAATAGATTATTTTATAGTTATAGTTGAATA
ATCAGTTATAATACACTGTAAAGAAATCAGATTTTCCTTCTGTTTGGTGTCTGAGTCCTTCCTGCTCTTCTTACTTCTGAGAATCTGGGC
ACTAAGAAATCAGTAAGTACATTGTAGTGCTCCTGCATCCCAGAGTCCTTAACCTAAGGAGGGTCTTAGTCACTGGTAAGAACTTGGCTT
TCTAATTATATTCACTTGGTTTTTAACATTAGTAGCTTGACGATAATCAGGGTATAGTAAATTTCCACCAAAAATGTGATGCGAAGAATT
CTGCCTTGGTCCTTTATGGTAAAACAGATAATAACGTCTAAAATAGATCAGCCACAAGTGCAGCAAATATTTTTACACTCTCTTTGAATA
GAATCCCAACCACCCTCCCCCATGATTTTAGAAATAAAGGCTTCCTAAAATAATAGAACAAATTGGCAAACAATCACTAATTGGACCAGT
AGGTTCTTACTTAAATATCTCTCCTAGATTTTTAGTGTATGTTTTGGGATTTTATGGGTTTATTTATTTTTTTTTTTTTAAGCAGACGTT
ACAGTTTGTTTTAATCTACTATAGATACGTTTTTGTTTTTTGGCTTAGTTGGGGATAAAATAATTTATTTGTAAGTTAGCTTTCTAAAAC
TTAGAGAAAGTAATTTAATTCACGTATCTTAAAAATAAAATTCCAAAGTTAAAAAATTTCTGACTTAGTAGGAAGTTAACAAAACTACTG
CTGATGCATTTCAGTTTCCAAAATCTGTACCCTCCCCCCATAAAAAAGGGAGTTAAGATGTGCTAGTTTAAGTAGTTAGCTGAATTATAG
ATTGATCCTCTTAAAATCTGGAGTTTGTAAAGGGGCCTACATAAACAGTAGATAGACTTGGAGGGATTTTGTGGGGGAATTGAAACTAAT
AGTATTCTATCTAGTTTGTCAGTATTTACTTTTTGATTTTTATTTTTCAGAAAATTTTCCTTTCCCAGGACACCCTCTTGTATTAGAATA
TCCTCTTCTGTATCACATTAAAAACAGATTTTACTGTTAGACCAAATAAGATGGGCAAATAGCAACACTAGAGCATCTCACCCAGTTTGA
ACTAGGATGTTCGTGGAAGTTATGACACCAATATATTCCTGAAATGAAAATTAACCTAAATTTTAAAGTGAATCTATTTGAAAATTTACT
TAGATAATGAAACCTCGTTTTAATTGTGCTTTTTGTGAATCCAACACTTGTTTGCTTAGAAAGTATCTTATCCAGTATTAATATTTTGTT
CTTTTGGGTTTTAAAGTTGAGCTTATTCAGCCTCAATCACATTACAGCAAGCATAAAGTAACAGTTGACTCAATGAAAGACCCAAATTGC
CTGTACAGATAAAATTCACTGAATCAAAGGCACAATAGCTATCTTTTCACTTGAGCTCAGAAAAGTAAAATGGCTTAATTTGAACTATTA
ATTTTCAGTGGCCTCTAATTAAACAAAAACAAAAAACCACAAATACTGGCTAGGTAAGATATTCCTGAGGTCATTTTAAAAGAAGTGTGG
CACCTAGGATTCAATATTTAATGCTAACAGTATTATATTTTAGTGAAATTTATTTTGGTGGTGACAGTTTATTAAACCTAATTAGACTTC
TTTCAATAGCTTGTTGTAGAGACAATCTCAAGGGCTGGAAAGTGTTGCTAAAATGAATGTCATACATTTCTGATATACTAAGGAGCTTAT
AAAGTAATTCTTTCATAGTGCAAGAATTATTAATTTCTTAGAGGATGTTTTTAAAGGAGCTACTTAATTGGGAAAATGTTCTTTAAATAT
CAGTAATAGTTCATTAAGTAACATAGTAGCTAAGAACATGGACTATATTTTCACAGCATAGTTCAGCTTAGGCACACCTTTAGTTTGGAT
TATTGGCATTCTCTTACGTAGGAATTATATCATTGTAGATATGTAATTATGGTAATAAGCAATTTTCATAACCATGCTCACTCAGACTAT
ATCATTTGAAACTGCCATGTTTCCATTTTTGACAATTCATGTTCACAAAACAACAGGAACAATTTCCTATTTGGTATAAAGAGCAAAATT
TCCAACTTTGCCCCAAAATGCCATGGGTGGCATATTGCCATATGATTATATCATATATTTAATCATGTATGGGAAAGATTTTGGATTTTT
TTTCTTATTTAAAAAAGTGCTAAATATAAGAATATAGTTTTAAATCAGCAAGTCTAATAACACTATTGCAGCTGTACACAGAGAGAACCT
TTTGTGCCTTTTTGCCTGCAGTAAGCATTTATTTCTATTTTACATGAGTTCTAAGAATGTTGATGATTATTGCACCTTGTTCTTCTGTAT
ATAAACTTGATTAAGGAATTTTTTTTTTTAAAGCAAGGAGCCGTTTTTTGTTACTAGGTGGATACCTTAGTAAACATGAGGGGAATTATC
AGATAGATGTCTTTGGAGCCCAGCCTTCCCTGTGTAGTGAGCTGGAAACTCCTTTAGATTGTATTCATTGGTGTGTATGTATATGTACAT
ATATGTATAAATAGTTAAATACATAAACATAAAACTTAACATCGCATTGTTGTGATGACAAGAAGTAGTAAGGTGCTAGGTGGTTACATT
AAAAAGCACAGCACAGTGTATAATCAGTCACTATGACTGGTGGTTTTGTAAGCTGGGTTCAGTTTTTGAACCACCCAGAATACCTCATGT
GTAAATACAGTGTTCATGACTTAATTGAAATACAGTTATTGTTTAAAAAAAAAAAAAAAGAATGTGAAGCCACTGGTTGGCTTATGCCTT
CTGATCTATCATTCTTGCCTCTTTTTTTGTAAAGGGGTTTTCTTCTTGTTGTTCTGTTTTTTAATAGGGTTTACAGCTAGAATTTTGAAT
GCCAAAGTTCTATTTATTAAATTAAGAAAAAAGTTTTCAATGTTAATGGCTAGTATTTTTCCACTGGACTATTGTTTGTTGATGTTGGAA

>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000368488_chr6_118845083_-_6508nt
AGAACGAGTCGAACGTGGAAGTAGGGAGCAGGCGGAGGCCGGCGCGGAGCTGCAGTTAAGCAAGCCGGGTCTGGCTTTGGGCCCTGGGCC
TTCCAGCCGGGGACTCTGCGCCTGCGCCCGCCTGGCCGCCGCCCGCTCTCCCGGCGCGGCAGCTGTCTGGGCTGCTGCGCGCCGCCTAGG
TGTCTGGGCGATCTATGGGCAAGAGCAAGGGCCACGATGACAGATTACGGCGAGGAGCAGCGCAACGAGCTGGAGGCCCTGGAGTCCATC
TACCCTGACTCCTTCACAGTATTATCAGAAAATCCACCCAGCTTCACCATTACTGTGACGTCTGAGGCTGGAGAAAATGATGAAACTGTC
CAGACTACCCTCAAGTTTACATACAGTGAAAAATACCCAGATGAAGCTCCCCTTTATGAAATATTCTCCCAGGAAAATCTAGAAGATAAT
GATGTCTCAGACATTTTAAAATTACTAGCATTACAGGTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGT
AAGTGGGAATCAATGTTGAAAATAAAAGAAGGACTTCTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTG
CATGAGAGGATAAGGGATAATGAATTACGGGCTCAACATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTG
CAGCCACAATATGAGAACACTTCACTCCAGACACCATTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTT
GCATCTACTGAGAAAGAAGTTTTACAGCTTAATGAGTTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAA
AAACTTAAAACTAGAGATCGATACATCAGTAGTCTGAAAAAGAAATGCCAGAAGGAATCTGAACAAAACAAAGAAAAGCAGAGAAGAATT
GAGACCTTGGAAAAGTATCTGGCTGATCTTCCAACTCTAGATGATGTACAGAGTCAGAGTCTACAGCTGCAGATTCTGGAAGAAAAAAAT
AAGAATTTACAAGAGGCTTTGATAGATACAGAAAAAAAACTTGAAGAGATCAAAAAGCAGTGTCAAGATAAAGAGACACAGTTAATATGC
CAGAAAAAGAAAGAAAAGGAGTTAGTAACTACCGTTCAGAGTTTGCAACAAAAAGTAGAAAGATGCCTTGAAGATGGAATCCGCCTTCCC
ATGTTAGATGCAAAACAGCTTCAGAATGAAAATGATAATCTCAGACAACAAAATGAGACTGCTAGTAAGATAATAGACAGCCAACAAGAT
GAGATTGACAGAATGATTTTAGAAATTCAGTCTATGCAAGGAAAGCTTTCTAAAGAGAAACTGACCACTCAAAAGATGATGGAAGAGCTG
GAAAAGAAAGAAAGAAATGTACAGAGATTAACAAAAGCATTGCTTGAAAACCAAAGACAAACAGATGAGACATGCTCTTTATTGGATCAG
GGCCAGGAACCTGACCAATCTAGGCAGCAGACAGTTCTTTCCAAACGGCCACTATTTGATTTGACTGTGATTGATCAGCTGTTCAAGGAA
ATGTCCTGTTGTTTGTTTGACTTGAAAGCATTGTGTAGTATTCTTAATCAGCGTGCTCAGGGCAAGGAGCCTAATCTTTCATTATTACTG
GGAATAAGATCAATGAACTGTTCAGCTGAAGAGACTGAGAATGACCACAGCACAGAAACACTCACTAAAAAGCTGTCAGATGTGTGCCAG
TTACGAAGAGACATTGATGAATTAAGGACTACAATATCAGACCGCTATGCTCAGGACATGGGAGACAACTGCATTACTCAGTGATCAAGT
GTTAGTCCCACAGCAATAATGACCTGTTGTTTAAATGCTGCTGTGTTATGGAGCCATAATGGAAGGTTGCAAGTGACATGACTTGCACTT
AGGGATTTTTTTTCTGTGGATTTGTTTTGTTGAAGGGGAGAAGGGAAGTGAAGAGATTTTGAAGGGGCTTATCTAATCAGGCAAAAAGAA
AAAAAATCAAATTACCTTTGGAAAATATGATAAAATCTACAAGGAAAAAAATGTCTATATTCTCAAACTACTGATTGTAGGACCAAGCTG
TGAAGAGTACCCTTCACATGAAGGAGTAGGATTCCTTTTAATCCTATAGCTTTGTGTGTTTGTGTGTGCATGTATGTGTGTTGTTGTGTG
TGTGTGCACGTGCTTTATTCACAAATTTATAAGGGTTTCTAGGGTCAGAGCAGAGCTTCTGAGAAAGGCACACGCTGTTTATTCTTATAT
TTCTTTCATATAGAAGCTTGTGTTGTACTTTGGGATTTTCAGTGGCTGGCTGAACAAGAGTTCAAACAGCAGGCAAGTGTTGTCATGGTA
GTACAGGAGGCAAAACCATTTATATTTTGAACACTTACTGCACTGATAGGATGTTTGTGGTTGAGCTGATTTTAGTACTGTAGATAGGTC
AGCTGTTTTTCCAGAGTGATTGTGGATTTCCCAAGAGGTGTGAAATTTTGACGTGATGCTCTTTTTCCTTAGCATTGTAATGTATGTGTT
ACAAGAAAGGTTAACATAACTTGAACTAATTTTAACATGTTCCTTACTATTTACAATTTTTTATTTATATGTTTTATATATATACATATA
TAAATGTAAACAAAGCCATATATAATTAATAAAGGCATTGGATCATTATTATAAAAGGAAGATTAACAAAGTTACCCTGGAACAATAGCT
TACTTATCCAAATCTCAACATTTACATTTTAACAGTTTTGTATGTTTCAAAGTTGAAACTACTGTAAGAGAAAGCCAATACTATTTATAT
CTGAATCAACAGTAGCATAAACATTTTTTAATTGAGATTGTATTTTAATCCCTTTTGTTAAAGTACATTAACAACAGTTTTTCACAGGAT
ATGAACTTGGCGAAATTAGTTCTTAATCTGAATTACAGGGTATTACTATGAAATGCAGTTGATTTTGCAGTAGACGTACAGTCATTTAAA
CTTCCAAATGAGTGTTGTCCATGTTTCTGTTGGTATTTTGGAAGGATTATACATTTTATTGCCTTCAGCATTGATTATGTTCTTTTGAAT
ATACTTAGTTTTGGCGAAAGCCTTGTCCTTTGTAAGTTGGTTTGATCTTGTGATGCAACCAAGTCTCATTTAGGTCAAGACTAAATAAGA
GATGGAGGGGTAGAGGGTGTGACTCAAGCAGGATAATATTGATTTGATAAAGAGCATATCACATGCCTGTTTTCTTGCCAGATAAAGGGC
ATAGCACATGCCTGTTTTCTTATATACTAGAATAAAGGCTCTCCTAGGAAAGATTTTTCTTAAATATTTAAAAGTGAAAATGTGAGACAA
GGCCTTCAAGGAGACTACCCAGGAAGATACACAGTTTAAAATGTTGGCTATACAGCTCTCAATAGATTATTTTATAGTTATAGTTGAATA
ATCAGTTATAATACACTGTAAAGAAATCAGATTTTCCTTCTGTTTGGTGTCTGAGTCCTTCCTGCTCTTCTTACTTCTGAGAATCTGGGC
ACTAAGAAATCAGTAAGTACATTGTAGTGCTCCTGCATCCCAGAGTCCTTAACCTAAGGAGGGTCTTAGTCACTGGTAAGAACTTGGCTT
TCTAATTATATTCACTTGGTTTTTAACATTAGTAGCTTGACGATAATCAGGGTATAGTAAATTTCCACCAAAAATGTGATGCGAAGAATT
CTGCCTTGGTCCTTTATGGTAAAACAGATAATAACGTCTAAAATAGATCAGCCACAAGTGCAGCAAATATTTTTACACTCTCTTTGAATA
GAATCCCAACCACCCTCCCCCATGATTTTAGAAATAAAGGCTTCCTAAAATAATAGAACAAATTGGCAAACAATCACTAATTGGACCAGT
AGGTTCTTACTTAAATATCTCTCCTAGATTTTTAGTGTATGTTTTGGGATTTTATGGGTTTATTTATTTTTTTTTTTTTAAGCAGACGTT
ACAGTTTGTTTTAATCTACTATAGATACGTTTTTGTTTTTTGGCTTAGTTGGGGATAAAATAATTTATTTGTAAGTTAGCTTTCTAAAAC
TTAGAGAAAGTAATTTAATTCACGTATCTTAAAAATAAAATTCCAAAGTTAAAAAATTTCTGACTTAGTAGGAAGTTAACAAAACTACTG
CTGATGCATTTCAGTTTCCAAAATCTGTACCCTCCCCCCATAAAAAAGGGAGTTAAGATGTGCTAGTTTAAGTAGTTAGCTGAATTATAG
ATTGATCCTCTTAAAATCTGGAGTTTGTAAAGGGGCCTACATAAACAGTAGATAGACTTGGAGGGATTTTGTGGGGGAATTGAAACTAAT
AGTATTCTATCTAGTTTGTCAGTATTTACTTTTTGATTTTTATTTTTCAGAAAATTTTCCTTTCCCAGGACACCCTCTTGTATTAGAATA
TCCTCTTCTGTATCACATTAAAAACAGATTTTACTGTTAGACCAAATAAGATGGGCAAATAGCAACACTAGAGCATCTCACCCAGTTTGA
ACTAGGATGTTCGTGGAAGTTATGACACCAATATATTCCTGAAATGAAAATTAACCTAAATTTTAAAGTGAATCTATTTGAAAATTTACT
TAGATAATGAAACCTCGTTTTAATTGTGCTTTTTGTGAATCCAACACTTGTTTGCTTAGAAAGTATCTTATCCAGTATTAATATTTTGTT
CTTTTGGGTTTTAAAGTTGAGCTTATTCAGCCTCAATCACATTACAGCAAGCATAAAGTAACAGTTGACTCAATGAAAGACCCAAATTGC
CTGTACAGATAAAATTCACTGAATCAAAGGCACAATAGCTATCTTTTCACTTGAGCTCAGAAAAGTAAAATGGCTTAATTTGAACTATTA
ATTTTCAGTGGCCTCTAATTAAACAAAAACAAAAAACCACAAATACTGGCTAGGTAAGATATTCCTGAGGTCATTTTAAAAGAAGTGTGG
CACCTAGGATTCAATATTTAATGCTAACAGTATTATATTTTAGTGAAATTTATTTTGGTGGTGACAGTTTATTAAACCTAATTAGACTTC
TTTCAATAGCTTGTTGTAGAGACAATCTCAAGGGCTGGAAAGTGTTGCTAAAATGAATGTCATACATTTCTGATATACTAAGGAGCTTAT
AAAGTAATTCTTTCATAGTGCAAGAATTATTAATTTCTTAGAGGATGTTTTTAAAGGAGCTACTTAATTGGGAAAATGTTCTTTAAATAT
CAGTAATAGTTCATTAAGTAACATAGTAGCTAAGAACATGGACTATATTTTCACAGCATAGTTCAGCTTAGGCACACCTTTAGTTTGGAT
TATTGGCATTCTCTTACGTAGGAATTATATCATTGTAGATATGTAATTATGGTAATAAGCAATTTTCATAACCATGCTCACTCAGACTAT
ATCATTTGAAACTGCCATGTTTCCATTTTTGACAATTCATGTTCACAAAACAACAGGAACAATTTCCTATTTGGTATAAAGAGCAAAATT
TCCAACTTTGCCCCAAAATGCCATGGGTGGCATATTGCCATATGATTATATCATATATTTAATCATGTATGGGAAAGATTTTGGATTTTT
TTTCTTATTTAAAAAAGTGCTAAATATAAGAATATAGTTTTAAATCAGCAAGTCTAATAACACTATTGCAGCTGTACACAGAGAGAACCT
TTTGTGCCTTTTTGCCTGCAGTAAGCATTTATTTCTATTTTACATGAGTTCTAAGAATGTTGATGATTATTGCACCTTGTTCTTCTGTAT
ATAAACTTGATTAAGGAATTTTTTTTTTTAAAGCAAGGAGCCGTTTTTTGTTACTAGGTGGATACCTTAGTAAACATGAGGGGAATTATC
AGATAGATGTCTTTGGAGCCCAGCCTTCCCTGTGTAGTGAGCTGGAAACTCCTTTAGATTGTATTCATTGGTGTGTATGTATATGTACAT
ATATGTATAAATAGTTAAATACATAAACATAAAACTTAACATCGCATTGTTGTGATGACAAGAAGTAGTAAGGTGCTAGGTGGTTACATT
AAAAAGCACAGCACAGTGTATAATCAGTCACTATGACTGGTGGTTTTGTAAGCTGGGTTCAGTTTTTGAACCACCCAGAATACCTCATGT
GTAAATACAGTGTTCATGACTTAATTGAAATACAGTTATTGTTTAAAAAAAAAAAAAAAGAATGTGAAGCCACTGGTTGGCTTATGCCTT
CTGATCTATCATTCTTGCCTCTTTTTTTGTAAAGGGGTTTTCTTCTTGTTGTTCTGTTTTTTAATAGGGTTTACAGCTAGAATTTTGAAT
GCCAAAGTTCTATTTATTAAATTAAGAAAAAAGTTTTCAATGTTAATGGCTAGTATTTTTCCACTGGACTATTGTTTGTTGATGTTGGAA

>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000360290_chr6_118845083_-_1158nt
AGAACGAGTCGAACGTGGAAGTAGGGAGCAGGCGGAGGCCGGCGCGGAGCTGCAGTTAAGCAAGCCGGGTCTGGCTTTGGGCCCTGGGCC
TTCCAGCCGGGGACTCTGCGCCTGCGCCCGCCTGGCCGCCGCCCGCTCTCCCGGCGCGGCAGCTGTCTGGGCTGCTGCGCGCCGCCTAGG
TGTCTGGGCGATCTATGGGCAAGAGCAAGGGCCACGATGACAGATTACGGCGAGGAGCAGCGCAACGAGCTGGAGGCCCTGGAGTCCATC
TACCCTGACTCCTTCACAGTATTATCAGAAAATCCACCCAGCTTCACCATTACTGTGACGTCTGAGGCTGGAGAAAATGATGAAACTGTC
CAGACTACCCTCAAGTTTACATACAGTGAAAAATACCCAGATGAAGCTCCCCTTTATGAAATATTCTCCCAGGAAAATCTAGAAGATAAT
GATGTCTCAGACATTTTAAAATTACTAGCATTACAGGTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGT
AAGTGGGAATCAATGTTGAAAATAAAAGAAGGACTTCTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTG
CATGAGAGGATAAGGGATAATGAATTACGGGCTCAACATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTG
CAGCCACAATATGAGAACACTTCACTCCAGACACCATTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTT
GCATCTACTGAGAAAGAAGTTTTACAGCTTAATGAGTTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAA
AAAGTAGGTTTTTCTAATAAAGTTGAATTAGGTCAACAACATTTCCTCAGCATATAATTATTTGTCTGTCATTTACCCTGTCAGGTGTCA
TGCCAGGTTATGTATACATTTATGTGGAGGTGATTAATTTTGTAGTAACTTTTGAGAAGCCCTCTGCTGTCTGCAGAAATCCAAGGATTT

>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000392500_chr6_118845083_-_1158nt
AGAACGAGTCGAACGTGGAAGTAGGGAGCAGGCGGAGGCCGGCGCGGAGCTGCAGTTAAGCAAGCCGGGTCTGGCTTTGGGCCCTGGGCC
TTCCAGCCGGGGACTCTGCGCCTGCGCCCGCCTGGCCGCCGCCCGCTCTCCCGGCGCGGCAGCTGTCTGGGCTGCTGCGCGCCGCCTAGG
TGTCTGGGCGATCTATGGGCAAGAGCAAGGGCCACGATGACAGATTACGGCGAGGAGCAGCGCAACGAGCTGGAGGCCCTGGAGTCCATC
TACCCTGACTCCTTCACAGTATTATCAGAAAATCCACCCAGCTTCACCATTACTGTGACGTCTGAGGCTGGAGAAAATGATGAAACTGTC
CAGACTACCCTCAAGTTTACATACAGTGAAAAATACCCAGATGAAGCTCCCCTTTATGAAATATTCTCCCAGGAAAATCTAGAAGATAAT
GATGTCTCAGACATTTTAAAATTACTAGCATTACAGGTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGT
AAGTGGGAATCAATGTTGAAAATAAAAGAAGGACTTCTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTG
CATGAGAGGATAAGGGATAATGAATTACGGGCTCAACATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTG
CAGCCACAATATGAGAACACTTCACTCCAGACACCATTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTT
GCATCTACTGAGAAAGAAGTTTTACAGCTTAATGAGTTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAA
AAAGTAGGTTTTTCTAATAAAGTTGAATTAGGTCAACAACATTTCCTCAGCATATAATTATTTGTCTGTCATTTACCCTGTCAGGTGTCA
TGCCAGGTTATGTATACATTTATGTGGAGGTGATTAATTTTGTAGTAACTTTTGAGAAGCCCTCTGCTGTCTGCAGAAATCCAAGGATTT

>In-frame_RWDD1_ENST00000466444_chr6_116906020_+_CEP85L_ENST00000419517_chr6_118845083_-_957nt
AGAACGAGTCGAACGTGGAAGTAGGGAGCAGGCGGAGGCCGGCGCGGAGCTGCAGTTAAGCAAGCCGGGTCTGGCTTTGGGCCCTGGGCC
TTCCAGCCGGGGACTCTGCGCCTGCGCCCGCCTGGCCGCCGCCCGCTCTCCCGGCGCGGCAGCTGTCTGGGCTGCTGCGCGCCGCCTAGG
TGTCTGGGCGATCTATGGGCAAGAGCAAGGGCCACGATGACAGATTACGGCGAGGAGCAGCGCAACGAGCTGGAGGCCCTGGAGTCCATC
TACCCTGACTCCTTCACAGTATTATCAGAAAATCCACCCAGCTTCACCATTACTGTGACGTCTGAGGCTGGAGAAAATGATGAAACTGTC
CAGACTACCCTCAAGTTTACATACAGTGAAAAATACCCAGATGAAGCTCCCCTTTATGAAATATTCTCCCAGGAAAATCTAGAAGATAAT
GATGTCTCAGACATTTTAAAATTACTAGCATTACAGGTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGT
AAGTGGGAATCAATGTTGAAAATAAAAGAAGGACTTCTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTG
CATGAGAGGATAAGGGATAATGAATTACGGGCTCAACATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTG
CAGCCACAATATGAGAACACTTCACTCCAGACACCATTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTT
GCATCTACTGAGAAAGAAGTTTTACAGCTTAATGAGTTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAA


Top

FusionGenePPI for RWDD1_CEP85L


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RWDD1DRG1, NUDT18, DRG2, XPO1, EGFRCEP85LMARK2, ITSN1, CEP128, CNTRL, KLHL40, PHKG2, PIGT


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneRWDD1chr6:116906020chr6:118845083ENST00000392526+59142_197-6148DRG2
HgeneRWDD1chr6:116906020chr6:118845083ENST00000466444+37142_19790244DRG2
HgeneRWDD1chr6:116906020chr6:118845083ENST00000487832+48142_197-6148DRG2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RWDD1_CEP85L


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RWDD1_CEP85L


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource