FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32404

FusionGeneSummary for RUNX1_PROS1

check button Fusion gene summary
Fusion gene informationFusion gene name: RUNX1_PROS1
Fusion gene ID: 32404
HgeneTgene
Gene symbol

RUNX1

PROS1

Gene ID

861

5627

Gene namerunt related transcription factor 1protein S
SynonymsAML1|AML1-EVI-1|AMLCR1|CBF2alpha|CBFA2|EVI-1|PEBP2aB|PEBP2alphaPROS|PS21|PS22|PS23|PS24|PS25|PSA|THPH5|THPH6
Cytomap

21q22.12

3q11.1

Type of geneprotein-codingprotein-coding
Descriptionrunt-related transcription factor 1AML1-EVI-1 fusion proteinPEA2-alpha BPEBP2-alpha BSL3-3 enhancer factor 1 alpha B subunitSL3/AKV core-binding factor alpha B subunitacute myeloid leukemia 1 proteincore-binding factor, runt domain, alpha subunit 2vitamin K-dependent protein Sprotein S (alpha)protein Savitamin K-dependent plasma protein S
Modification date2018052720180522
UniProtAcc

Q01196

P07225

Ensembl transtripts involved in fusion geneENST00000344691, ENST00000325074, 
ENST00000437180, ENST00000300305, 
ENST00000399240, ENST00000486278, 
ENST00000494829, ENST00000358356, 
ENST00000394236, ENST00000407433, 
Fusion gene scores* DoF score23 X 25 X 7=40253 X 2 X 3=18
# samples 533
** MAII scorelog2(53/4025*10)=-2.92492451843878
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RUNX1 [Title/Abstract] AND PROS1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRUNX1

GO:0030097

hemopoiesis

21873977

HgeneRUNX1

GO:0045893

positive regulation of transcription, DNA-templated

10207087|14970218

HgeneRUNX1

GO:0045944

positive regulation of transcription by RNA polymerase II

9199349|10207087|14970218|21873977


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCOADTCGA-A6-6654-01ARUNX1chr21

36206707

-PROS1chr3

93646251

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000344691ENST00000394236RUNX1chr21

36206707

-PROS1chr3

93646251

-
5CDS-5UTRENST00000344691ENST00000407433RUNX1chr21

36206707

-PROS1chr3

93646251

-
In-frameENST00000325074ENST00000394236RUNX1chr21

36206707

-PROS1chr3

93646251

-
5CDS-5UTRENST00000325074ENST00000407433RUNX1chr21

36206707

-PROS1chr3

93646251

-
Frame-shitENST00000437180ENST00000394236RUNX1chr21

36206707

-PROS1chr3

93646251

-
5CDS-5UTRENST00000437180ENST00000407433RUNX1chr21

36206707

-PROS1chr3

93646251

-
In-frameENST00000300305ENST00000394236RUNX1chr21

36206707

-PROS1chr3

93646251

-
5CDS-5UTRENST00000300305ENST00000407433RUNX1chr21

36206707

-PROS1chr3

93646251

-
intron-3CDSENST00000399240ENST00000394236RUNX1chr21

36206707

-PROS1chr3

93646251

-
intron-5UTRENST00000399240ENST00000407433RUNX1chr21

36206707

-PROS1chr3

93646251

-
intron-3CDSENST00000486278ENST00000394236RUNX1chr21

36206707

-PROS1chr3

93646251

-
intron-5UTRENST00000486278ENST00000407433RUNX1chr21

36206707

-PROS1chr3

93646251

-
intron-3CDSENST00000494829ENST00000394236RUNX1chr21

36206707

-PROS1chr3

93646251

-
intron-5UTRENST00000494829ENST00000407433RUNX1chr21

36206707

-PROS1chr3

93646251

-
In-frameENST00000358356ENST00000394236RUNX1chr21

36206707

-PROS1chr3

93646251

-
5CDS-5UTRENST00000358356ENST00000407433RUNX1chr21

36206707

-PROS1chr3

93646251

-

Top

FusionProtFeatures for RUNX1_PROS1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RUNX1

Q01196

PROS1

P07225

Anticoagulant plasma protein; it is a cofactor toactivated protein C in the degradation of coagulation factors Vaand VIIIa. It helps to prevent coagulation and stimulatingfibrinolysis.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRUNX1chr21:36206707chr3:93646251ENST00000300305-6850_178268481DomainRunt
HgeneRUNX1chr21:36206707chr3:93646251ENST00000325074-5750_178256469DomainRunt
HgeneRUNX1chr21:36206707chr3:93646251ENST00000344691-4650_178241454DomainRunt
HgeneRUNX1chr21:36206707chr3:93646251ENST00000358356-4550_178241251DomainRunt
HgeneRUNX1chr21:36206707chr3:93646251ENST00000437180-7950_178268481DomainRunt
TgenePROS1chr21:36206707chr3:93646251ENST00000394236-015117_15525677DomainEGF-like 1
TgenePROS1chr21:36206707chr3:93646251ENST00000394236-015157_20025677DomainEGF-like 2%3B calcium-binding
TgenePROS1chr21:36206707chr3:93646251ENST00000394236-015201_24225677DomainEGF-like 3%3B calcium-binding
TgenePROS1chr21:36206707chr3:93646251ENST00000394236-015243_28325677DomainEGF-like 4%3B calcium-binding
TgenePROS1chr21:36206707chr3:93646251ENST00000394236-015299_47525677DomainLaminin G-like 1
TgenePROS1chr21:36206707chr3:93646251ENST00000394236-01542_8725677DomainGla
TgenePROS1chr21:36206707chr3:93646251ENST00000394236-015484_66625677DomainLaminin G-like 2
TgenePROS1chr21:36206707chr3:93646251ENST00000394236-01588_11625677RegionNote=Thrombin-sensitive

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRUNX1chr21:36206707chr3:93646251ENST00000300305-68187_453268481Compositional biasNote=Pro/Ser/Thr-rich
HgeneRUNX1chr21:36206707chr3:93646251ENST00000325074-57187_453256469Compositional biasNote=Pro/Ser/Thr-rich
HgeneRUNX1chr21:36206707chr3:93646251ENST00000344691-46187_453241454Compositional biasNote=Pro/Ser/Thr-rich
HgeneRUNX1chr21:36206707chr3:93646251ENST00000358356-45187_453241251Compositional biasNote=Pro/Ser/Thr-rich
HgeneRUNX1chr21:36206707chr3:93646251ENST00000437180-79187_453268481Compositional biasNote=Pro/Ser/Thr-rich


Top

FusionGeneSequence for RUNX1_PROS1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RUNX1_ENST00000344691_chr21_36206707_-_PROS1_ENST00000394236_chr3_93646251_-_893aa
MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFK
VVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQVLSKQQASQVLVRKRRANSLLEETKQGNL
ERECIEELCNKEEAREVFENDPETDTFTPKYLVCLRSFQTGLFTAARQSTNATPDLRSCVNAIPDQCSPLPCNEDGTMSCKDGKASFTCT
CKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRT
NLKSKSCEDIDECSENMCAQLCVNYPGGYTCTCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKTELLYLAEQFAGVVLTLKFRLPEISRFS
AEFDFRTTDSEGVILYAESIDHSAWLLIALRGGKIEVQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLF
KPENGLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYTPGSGIAQFHIDTNNVSSAE
GWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVITRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIET

>In-frame_RUNX1_ENST00000325074_chr21_36206707_-_PROS1_ENST00000394236_chr3_93646251_-_908aa
MPAAPRGPAQGEAAARTRSRDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVL
PTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRA
IKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQVLSKQQASQVLVRK
RRANSLLEETKQGNLERECIEELCNKEEAREVFENDPETDTFTPKYLVCLRSFQTGLFTAARQSTNATPDLRSCVNAIPDQCSPLPCNED
GTMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKN
IPGDFECECPEGYRTNLKSKSCEDIDECSENMCAQLCVNYPGGYTCTCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKTELLYLAEQFAGV
VLTLKFRLPEISRFSAEFDFRTTDSEGVILYAESIDHSAWLLIALRGGKIEVQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKI
AKEAVMDINKPGPLFKPENGLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYTPGSG
IAQFHIDTNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVITRIQALSLCSDQQSHLEFRV
NRNNLELSTPLKIETISHEDLQRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFTNGCMEVNINGVQLDLDEAISKHNDIRAHSCPSV

>In-frame_RUNX1_ENST00000300305_chr21_36206707_-_PROS1_ENST00000394236_chr3_93646251_-_920aa
MASDSIFESFPSYPQCFMRECILGMNPSRDVHDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELV
RTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVF
TNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQVL
SKQQASQVLVRKRRANSLLEETKQGNLERECIEELCNKEEAREVFENDPETDTFTPKYLVCLRSFQTGLFTAARQSTNATPDLRSCVNAI
PDQCSPLPCNEDGTMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSL
KPSICGTAVCKNIPGDFECECPEGYRTNLKSKSCEDIDECSENMCAQLCVNYPGGYTCTCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKT
ELLYLAEQFAGVVLTLKFRLPEISRFSAEFDFRTTDSEGVILYAESIDHSAWLLIALRGGKIEVQLKNEHTSKITTGGDVINNGLWNMVS
VEELEHSISIKIAKEAVMDINKPGPLFKPENGLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLV
TVEKGSYTPGSGIAQFHIDTNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVITRIQALSL
CSDQQSHLEFRVNRNNLELSTPLKIETISHEDLQRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFTNGCMEVNINGVQLDLDEAISK

>In-frame_RUNX1_ENST00000358356_chr21_36206707_-_PROS1_ENST00000394236_chr3_93646251_-_893aa
MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFK
VVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQVLSKQQASQVLVRKRRANSLLEETKQGNL
ERECIEELCNKEEAREVFENDPETDTFTPKYLVCLRSFQTGLFTAARQSTNATPDLRSCVNAIPDQCSPLPCNEDGTMSCKDGKASFTCT
CKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRT
NLKSKSCEDIDECSENMCAQLCVNYPGGYTCTCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKTELLYLAEQFAGVVLTLKFRLPEISRFS
AEFDFRTTDSEGVILYAESIDHSAWLLIALRGGKIEVQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLF
KPENGLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYTPGSGIAQFHIDTNNVSSAE
GWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVITRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIET


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RUNX1_ENST00000344691_chr21_36206707_-_PROS1_ENST00000394236_chr3_93646251_-_2679nt
ATGCGTATCCCCGTAGATGCCAGCACGAGCCGCCGCTTCACGCCGCCTTCCACCGCGCTGAGCCCAGGCAAGATGAGCGAGGCGTTGCCG
CTGGGCGCCCCGGACGCCGGCGCTGCCCTGGCCGGCAAGCTGAGGAGCGGCGACCGCAGCATGGTGGAGGTGCTGGCCGACCACCCGGGC
GAGCTGGTGCGCACCGACAGCCCCAACTTCCTCTGCTCCGTGCTGCCTACGCACTGGCGCTGCAACAAGACCCTGCCCATCGCTTTCAAG
GTGGTGGCCCTAGGGGATGTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCT
ACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATC
ACTGTCTTCACAAACCCACCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAGACATCGG
CAGAAACTAGATGATCAGACCAAGCCCGGGAGCTTGTCCTTTTCCGAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGCACAGCCATGAGG
GTCAGCCCACACCACCCAGCCCCCACGCCCAACCCTCGTGCCTCCCTGAACCACTCCACTGCCTTTAACCCTCAGCCTCAGAGTCAGATG
CAGGTTTTGTCAAAGCAACAGGCTTCACAAGTCCTGGTTAGGAAGCGTCGTGCAAATTCTTTACTTGAAGAAACCAAACAGGGTAATCTT
GAAAGAGAATGCATCGAAGAACTGTGCAATAAAGAAGAAGCCAGGGAGGTCTTTGAAAATGACCCGGAAACGGATTATTTTTATCCAAAA
TACTTAGTTTGTCTTCGCTCTTTTCAAACTGGGTTATTCACTGCTGCACGTCAGTCAACTAATGCTTATCCTGACCTAAGAAGCTGTGTC
AATGCCATTCCAGACCAGTGTAGTCCTCTGCCATGCAATGAAGATGGATATATGAGCTGCAAAGATGGAAAAGCTTCTTTTACTTGCACT
TGTAAACCAGGTTGGCAAGGAGAAAAGTGTGAATTTGACATAAATGAATGCAAAGATCCCTCAAATATAAATGGAGGTTGCAGTCAAATT
TGTGATAATACACCTGGAAGTTACCACTGTTCCTGTAAAAATGGTTTTGTTATGCTTTCAAATAAGAAAGATTGTAAAGATGTGGATGAA
TGCTCTTTGAAGCCAAGCATTTGTGGCACAGCTGTGTGCAAGAACATCCCAGGAGATTTTGAATGTGAATGCCCCGAAGGCTACAGATAT
AATCTCAAATCAAAGTCTTGTGAAGATATAGATGAATGCTCTGAGAACATGTGTGCTCAGCTTTGTGTCAATTACCCTGGAGGTTACACT
TGCTATTGTGATGGGAAGAAAGGATTCAAACTTGCCCAAGATCAGAAGAGTTGTGAGGTTGTTTCAGTGTGCCTTCCCTTGAACCTTGAC
ACAAAGTATGAATTACTTTACTTGGCGGAGCAGTTTGCAGGGGTTGTTTTATATTTAAAATTTCGTTTGCCAGAAATCAGCAGATTTTCA
GCAGAATTTGATTTCCGGACATATGATTCAGAAGGCGTGATACTGTACGCAGAATCTATCGATCACTCAGCGTGGCTCCTGATTGCACTT
CGTGGTGGAAAGATTGAAGTTCAGCTTAAGAATGAACATACATCCAAAATCACAACTGGAGGTGATGTTATTAATAATGGTCTATGGAAT
ATGGTGTCTGTGGAAGAATTAGAACATAGTATTAGCATTAAAATAGCTAAAGAAGCTGTGATGGATATAAATAAACCTGGACCCCTTTTT
AAGCCGGAAAATGGATTGCTGGAAACCAAAGTATACTTTGCAGGATTCCCTCGGAAAGTGGAAAGTGAACTCATTAAACCGATTAACCCT
CGTCTAGATGGATGTATACGAAGCTGGAATTTGATGAAGCAAGGAGCTTCTGGAATAAAGGAAATTATTCAAGAAAAACAAAATAAGCAT
TGCCTGGTTACTGTGGAGAAGGGCTCCTACTATCCTGGTTCTGGAATTGCTCAATTTCACATAGATTATAATAATGTATCCAGTGCTGAG
GGTTGGCATGTAAATGTGACCTTGAATATTCGTCCATCCACGGGCACTGGTGTTATGCTTGCCTTGGTTTCTGGTAACAACACAGTGCCC
TTTGCTGTGTCCTTGGTGGACTCCACCTCTGAAAAATCACAGGATATTCTGTTATCTGTTGAAAATACTGTAATATATCGGATACAGGCC
CTAAGTCTATGTTCCGATCAACAATCTCATCTGGAATTTAGAGTCAACAGAAACAATCTGGAGTTGTCGACACCACTTAAAATAGAAACC
ATCTCCCATGAAGACCTTCAAAGACAACTTGCCGTCTTGGACAAAGCAATGAAAGCAAAAGTGGCCACATACCTGGGTGGCCTTCCAGAT
GTTCCATTCAGTGCCACACCAGTGAATGCCTTTTATAATGGCTGCATGGAAGTGAATATTAATGGTGTACAGTTGGATCTGGATGAAGCC

>In-frame_RUNX1_ENST00000325074_chr21_36206707_-_PROS1_ENST00000394236_chr3_93646251_-_2724nt
ATGCCCGCAGCACCGCGGGGACCGGCGCAGGGGGAAGCGGCCGCCCGCACGCGAAGCCGGGATGCCAGCACGAGCCGCCGCTTCACGCCG
CCTTCCACCGCGCTGAGCCCAGGCAAGATGAGCGAGGCGTTGCCGCTGGGCGCCCCGGACGCCGGCGCTGCCCTGGCCGGCAAGCTGAGG
AGCGGCGACCGCAGCATGGTGGAGGTGCTGGCCGACCACCCGGGCGAGCTGGTGCGCACCGACAGCCCCAACTTCCTCTGCTCCGTGCTG
CCTACGCACTGGCGCTGCAACAAGACCCTGCCCATCGCTTTCAAGGTGGTGGCCCTAGGGGATGTTCCAGATGGCACTCTGGTCACTGTG
ATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACCTCAGG
TTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCACCGCAAGTCGCCACCTACCACAGAGCC
ATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGATCAGACCAAGCCCGGGAGCTTGTCCTTTTCC
GAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGCACAGCCATGAGGGTCAGCCCACACCACCCAGCCCCCACGCCCAACCCTCGTGCCTCC
CTGAACCACTCCACTGCCTTTAACCCTCAGCCTCAGAGTCAGATGCAGGTTTTGTCAAAGCAACAGGCTTCACAAGTCCTGGTTAGGAAG
CGTCGTGCAAATTCTTTACTTGAAGAAACCAAACAGGGTAATCTTGAAAGAGAATGCATCGAAGAACTGTGCAATAAAGAAGAAGCCAGG
GAGGTCTTTGAAAATGACCCGGAAACGGATTATTTTTATCCAAAATACTTAGTTTGTCTTCGCTCTTTTCAAACTGGGTTATTCACTGCT
GCACGTCAGTCAACTAATGCTTATCCTGACCTAAGAAGCTGTGTCAATGCCATTCCAGACCAGTGTAGTCCTCTGCCATGCAATGAAGAT
GGATATATGAGCTGCAAAGATGGAAAAGCTTCTTTTACTTGCACTTGTAAACCAGGTTGGCAAGGAGAAAAGTGTGAATTTGACATAAAT
GAATGCAAAGATCCCTCAAATATAAATGGAGGTTGCAGTCAAATTTGTGATAATACACCTGGAAGTTACCACTGTTCCTGTAAAAATGGT
TTTGTTATGCTTTCAAATAAGAAAGATTGTAAAGATGTGGATGAATGCTCTTTGAAGCCAAGCATTTGTGGCACAGCTGTGTGCAAGAAC
ATCCCAGGAGATTTTGAATGTGAATGCCCCGAAGGCTACAGATATAATCTCAAATCAAAGTCTTGTGAAGATATAGATGAATGCTCTGAG
AACATGTGTGCTCAGCTTTGTGTCAATTACCCTGGAGGTTACACTTGCTATTGTGATGGGAAGAAAGGATTCAAACTTGCCCAAGATCAG
AAGAGTTGTGAGGTTGTTTCAGTGTGCCTTCCCTTGAACCTTGACACAAAGTATGAATTACTTTACTTGGCGGAGCAGTTTGCAGGGGTT
GTTTTATATTTAAAATTTCGTTTGCCAGAAATCAGCAGATTTTCAGCAGAATTTGATTTCCGGACATATGATTCAGAAGGCGTGATACTG
TACGCAGAATCTATCGATCACTCAGCGTGGCTCCTGATTGCACTTCGTGGTGGAAAGATTGAAGTTCAGCTTAAGAATGAACATACATCC
AAAATCACAACTGGAGGTGATGTTATTAATAATGGTCTATGGAATATGGTGTCTGTGGAAGAATTAGAACATAGTATTAGCATTAAAATA
GCTAAAGAAGCTGTGATGGATATAAATAAACCTGGACCCCTTTTTAAGCCGGAAAATGGATTGCTGGAAACCAAAGTATACTTTGCAGGA
TTCCCTCGGAAAGTGGAAAGTGAACTCATTAAACCGATTAACCCTCGTCTAGATGGATGTATACGAAGCTGGAATTTGATGAAGCAAGGA
GCTTCTGGAATAAAGGAAATTATTCAAGAAAAACAAAATAAGCATTGCCTGGTTACTGTGGAGAAGGGCTCCTACTATCCTGGTTCTGGA
ATTGCTCAATTTCACATAGATTATAATAATGTATCCAGTGCTGAGGGTTGGCATGTAAATGTGACCTTGAATATTCGTCCATCCACGGGC
ACTGGTGTTATGCTTGCCTTGGTTTCTGGTAACAACACAGTGCCCTTTGCTGTGTCCTTGGTGGACTCCACCTCTGAAAAATCACAGGAT
ATTCTGTTATCTGTTGAAAATACTGTAATATATCGGATACAGGCCCTAAGTCTATGTTCCGATCAACAATCTCATCTGGAATTTAGAGTC
AACAGAAACAATCTGGAGTTGTCGACACCACTTAAAATAGAAACCATCTCCCATGAAGACCTTCAAAGACAACTTGCCGTCTTGGACAAA
GCAATGAAAGCAAAAGTGGCCACATACCTGGGTGGCCTTCCAGATGTTCCATTCAGTGCCACACCAGTGAATGCCTTTTATAATGGCTGC
ATGGAAGTGAATATTAATGGTGTACAGTTGGATCTGGATGAAGCCATTTCTAAACATAATGATATTAGAGCTCACTCATGTCCATCAGTT

>In-frame_RUNX1_ENST00000300305_chr21_36206707_-_PROS1_ENST00000394236_chr3_93646251_-_2760nt
ATGGCTTCAGACAGCATATTTGAGTCATTTCCTTCGTACCCACAGTGCTTCATGAGAGAATGCATACTTGGAATGAATCCTTCTAGAGAC
GTCCACGATGCCAGCACGAGCCGCCGCTTCACGCCGCCTTCCACCGCGCTGAGCCCAGGCAAGATGAGCGAGGCGTTGCCGCTGGGCGCC
CCGGACGCCGGCGCTGCCCTGGCCGGCAAGCTGAGGAGCGGCGACCGCAGCATGGTGGAGGTGCTGGCCGACCACCCGGGCGAGCTGGTG
CGCACCGACAGCCCCAACTTCCTCTGCTCCGTGCTGCCTACGCACTGGCGCTGCAACAAGACCCTGCCCATCGCTTTCAAGGTGGTGGCC
CTAGGGGATGTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCTACCGCAGCC
ATGAAGAACCAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGTCTTC
ACAAACCCACCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAGACATCGGCAGAAACTA
GATGATCAGACCAAGCCCGGGAGCTTGTCCTTTTCCGAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGCACAGCCATGAGGGTCAGCCCA
CACCACCCAGCCCCCACGCCCAACCCTCGTGCCTCCCTGAACCACTCCACTGCCTTTAACCCTCAGCCTCAGAGTCAGATGCAGGTTTTG
TCAAAGCAACAGGCTTCACAAGTCCTGGTTAGGAAGCGTCGTGCAAATTCTTTACTTGAAGAAACCAAACAGGGTAATCTTGAAAGAGAA
TGCATCGAAGAACTGTGCAATAAAGAAGAAGCCAGGGAGGTCTTTGAAAATGACCCGGAAACGGATTATTTTTATCCAAAATACTTAGTT
TGTCTTCGCTCTTTTCAAACTGGGTTATTCACTGCTGCACGTCAGTCAACTAATGCTTATCCTGACCTAAGAAGCTGTGTCAATGCCATT
CCAGACCAGTGTAGTCCTCTGCCATGCAATGAAGATGGATATATGAGCTGCAAAGATGGAAAAGCTTCTTTTACTTGCACTTGTAAACCA
GGTTGGCAAGGAGAAAAGTGTGAATTTGACATAAATGAATGCAAAGATCCCTCAAATATAAATGGAGGTTGCAGTCAAATTTGTGATAAT
ACACCTGGAAGTTACCACTGTTCCTGTAAAAATGGTTTTGTTATGCTTTCAAATAAGAAAGATTGTAAAGATGTGGATGAATGCTCTTTG
AAGCCAAGCATTTGTGGCACAGCTGTGTGCAAGAACATCCCAGGAGATTTTGAATGTGAATGCCCCGAAGGCTACAGATATAATCTCAAA
TCAAAGTCTTGTGAAGATATAGATGAATGCTCTGAGAACATGTGTGCTCAGCTTTGTGTCAATTACCCTGGAGGTTACACTTGCTATTGT
GATGGGAAGAAAGGATTCAAACTTGCCCAAGATCAGAAGAGTTGTGAGGTTGTTTCAGTGTGCCTTCCCTTGAACCTTGACACAAAGTAT
GAATTACTTTACTTGGCGGAGCAGTTTGCAGGGGTTGTTTTATATTTAAAATTTCGTTTGCCAGAAATCAGCAGATTTTCAGCAGAATTT
GATTTCCGGACATATGATTCAGAAGGCGTGATACTGTACGCAGAATCTATCGATCACTCAGCGTGGCTCCTGATTGCACTTCGTGGTGGA
AAGATTGAAGTTCAGCTTAAGAATGAACATACATCCAAAATCACAACTGGAGGTGATGTTATTAATAATGGTCTATGGAATATGGTGTCT
GTGGAAGAATTAGAACATAGTATTAGCATTAAAATAGCTAAAGAAGCTGTGATGGATATAAATAAACCTGGACCCCTTTTTAAGCCGGAA
AATGGATTGCTGGAAACCAAAGTATACTTTGCAGGATTCCCTCGGAAAGTGGAAAGTGAACTCATTAAACCGATTAACCCTCGTCTAGAT
GGATGTATACGAAGCTGGAATTTGATGAAGCAAGGAGCTTCTGGAATAAAGGAAATTATTCAAGAAAAACAAAATAAGCATTGCCTGGTT
ACTGTGGAGAAGGGCTCCTACTATCCTGGTTCTGGAATTGCTCAATTTCACATAGATTATAATAATGTATCCAGTGCTGAGGGTTGGCAT
GTAAATGTGACCTTGAATATTCGTCCATCCACGGGCACTGGTGTTATGCTTGCCTTGGTTTCTGGTAACAACACAGTGCCCTTTGCTGTG
TCCTTGGTGGACTCCACCTCTGAAAAATCACAGGATATTCTGTTATCTGTTGAAAATACTGTAATATATCGGATACAGGCCCTAAGTCTA
TGTTCCGATCAACAATCTCATCTGGAATTTAGAGTCAACAGAAACAATCTGGAGTTGTCGACACCACTTAAAATAGAAACCATCTCCCAT
GAAGACCTTCAAAGACAACTTGCCGTCTTGGACAAAGCAATGAAAGCAAAAGTGGCCACATACCTGGGTGGCCTTCCAGATGTTCCATTC
AGTGCCACACCAGTGAATGCCTTTTATAATGGCTGCATGGAAGTGAATATTAATGGTGTACAGTTGGATCTGGATGAAGCCATTTCTAAA

>In-frame_RUNX1_ENST00000358356_chr21_36206707_-_PROS1_ENST00000394236_chr3_93646251_-_2679nt
ATGCGTATCCCCGTAGATGCCAGCACGAGCCGCCGCTTCACGCCGCCTTCCACCGCGCTGAGCCCAGGCAAGATGAGCGAGGCGTTGCCG
CTGGGCGCCCCGGACGCCGGCGCTGCCCTGGCCGGCAAGCTGAGGAGCGGCGACCGCAGCATGGTGGAGGTGCTGGCCGACCACCCGGGC
GAGCTGGTGCGCACCGACAGCCCCAACTTCCTCTGCTCCGTGCTGCCTACGCACTGGCGCTGCAACAAGACCCTGCCCATCGCTTTCAAG
GTGGTGGCCCTAGGGGATGTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCT
ACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATC
ACTGTCTTCACAAACCCACCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAGACATCGG
CAGAAACTAGATGATCAGACCAAGCCCGGGAGCTTGTCCTTTTCCGAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGCACAGCCATGAGG
GTCAGCCCACACCACCCAGCCCCCACGCCCAACCCTCGTGCCTCCCTGAACCACTCCACTGCCTTTAACCCTCAGCCTCAGAGTCAGATG
CAGGTTTTGTCAAAGCAACAGGCTTCACAAGTCCTGGTTAGGAAGCGTCGTGCAAATTCTTTACTTGAAGAAACCAAACAGGGTAATCTT
GAAAGAGAATGCATCGAAGAACTGTGCAATAAAGAAGAAGCCAGGGAGGTCTTTGAAAATGACCCGGAAACGGATTATTTTTATCCAAAA
TACTTAGTTTGTCTTCGCTCTTTTCAAACTGGGTTATTCACTGCTGCACGTCAGTCAACTAATGCTTATCCTGACCTAAGAAGCTGTGTC
AATGCCATTCCAGACCAGTGTAGTCCTCTGCCATGCAATGAAGATGGATATATGAGCTGCAAAGATGGAAAAGCTTCTTTTACTTGCACT
TGTAAACCAGGTTGGCAAGGAGAAAAGTGTGAATTTGACATAAATGAATGCAAAGATCCCTCAAATATAAATGGAGGTTGCAGTCAAATT
TGTGATAATACACCTGGAAGTTACCACTGTTCCTGTAAAAATGGTTTTGTTATGCTTTCAAATAAGAAAGATTGTAAAGATGTGGATGAA
TGCTCTTTGAAGCCAAGCATTTGTGGCACAGCTGTGTGCAAGAACATCCCAGGAGATTTTGAATGTGAATGCCCCGAAGGCTACAGATAT
AATCTCAAATCAAAGTCTTGTGAAGATATAGATGAATGCTCTGAGAACATGTGTGCTCAGCTTTGTGTCAATTACCCTGGAGGTTACACT
TGCTATTGTGATGGGAAGAAAGGATTCAAACTTGCCCAAGATCAGAAGAGTTGTGAGGTTGTTTCAGTGTGCCTTCCCTTGAACCTTGAC
ACAAAGTATGAATTACTTTACTTGGCGGAGCAGTTTGCAGGGGTTGTTTTATATTTAAAATTTCGTTTGCCAGAAATCAGCAGATTTTCA
GCAGAATTTGATTTCCGGACATATGATTCAGAAGGCGTGATACTGTACGCAGAATCTATCGATCACTCAGCGTGGCTCCTGATTGCACTT
CGTGGTGGAAAGATTGAAGTTCAGCTTAAGAATGAACATACATCCAAAATCACAACTGGAGGTGATGTTATTAATAATGGTCTATGGAAT
ATGGTGTCTGTGGAAGAATTAGAACATAGTATTAGCATTAAAATAGCTAAAGAAGCTGTGATGGATATAAATAAACCTGGACCCCTTTTT
AAGCCGGAAAATGGATTGCTGGAAACCAAAGTATACTTTGCAGGATTCCCTCGGAAAGTGGAAAGTGAACTCATTAAACCGATTAACCCT
CGTCTAGATGGATGTATACGAAGCTGGAATTTGATGAAGCAAGGAGCTTCTGGAATAAAGGAAATTATTCAAGAAAAACAAAATAAGCAT
TGCCTGGTTACTGTGGAGAAGGGCTCCTACTATCCTGGTTCTGGAATTGCTCAATTTCACATAGATTATAATAATGTATCCAGTGCTGAG
GGTTGGCATGTAAATGTGACCTTGAATATTCGTCCATCCACGGGCACTGGTGTTATGCTTGCCTTGGTTTCTGGTAACAACACAGTGCCC
TTTGCTGTGTCCTTGGTGGACTCCACCTCTGAAAAATCACAGGATATTCTGTTATCTGTTGAAAATACTGTAATATATCGGATACAGGCC
CTAAGTCTATGTTCCGATCAACAATCTCATCTGGAATTTAGAGTCAACAGAAACAATCTGGAGTTGTCGACACCACTTAAAATAGAAACC
ATCTCCCATGAAGACCTTCAAAGACAACTTGCCGTCTTGGACAAAGCAATGAAAGCAAAAGTGGCCACATACCTGGGTGGCCTTCCAGAT
GTTCCATTCAGTGCCACACCAGTGAATGCCTTTTATAATGGCTGCATGGAAGTGAATATTAATGGTGTACAGTTGGATCTGGATGAAGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_RUNX1_ENST00000344691_chr21_36206707_-_PROS1_ENST00000394236_chr3_93646251_-_5465nt
CATAGAGCCAGCGGGCGCGGGCGGGACGGGCGCCCCGCGGCCGGACCCAGCCAGGGCACCACGCTGCCCGGCCCTGCGCCGCCAGGCACT
TCTTTCCGGGGCTCCTAGGGACGCCAGAAGGAAGTCAACCTCTGCTGCTTCTCCTTGGCCTGCGTTGGACCTTCCTTTTTTTGTTGTTTT
TTTTTGTTTTTCCCCTTTCTTCCTTTTGAATTAACTGGCTTCTTGGCTGGATGTTTTCAACTTCTTTCCTGGCTGCGAACTTTTCCCCAA
TTGTTTTCCTTTTACAACAGGGGGAGAAAGTGCTCTGTGGTCCGAGGCGAGCCGTGAAGTTGCGTGTGCGTGGCAGTGTGCGTGGCAGGA
TGTGCGTGCGTGTGTAACCCGAGCCGCCCGATCTGTTTCGATCTGCGCCGCGGAGCCCTCCCTCAAGGCCCGCTCCACCTGCTGCGGTTA
CGCGGCGCTCGTGGGTGTTCGTGCCTCGGAGCAGCTAACCGGCGGGTGCTGGGCGACGGTGGAGGAGTATCGTCTCGCTGCTGCCCGAGT
CAGGGCTGAGTCACCCAGCTGATGTAGACAGTGGCTGCCTTCCGAAGAGTGCGTGTTTGCATGTGTGTGACTCTGCGGCTGCTCAACTCC
CAACAAACCAGAGGACCAGCCACAAACTTAACCAACATCCCCAAACCCGAGTTCACAGATGTGGGAGAGCTGTAGAACCCTGAGTGTCAT
CGACTGGGCCTTCTTATGATTGTTGTTTTAAGATTAGCTGAAGATCTCTGAAACGCTGAATTTTCTGCACTGAGCGTTTTGACAGAATTC
ATTGAGAGAACAGAGAACATGACAAGTACTTCTAGCTCAGCACTGCTCCAACTACTGAAGCTGATTTTCAAGGCTACTTAAAAAAATCTG
CAGCGTACATTAATGGATTTCTGTTGTGTTTAAATTCTCCACAGATTGTATTGTAAATATTTTATGAAGTAGAGCATATGTATATATTTA
TATATACGTGCACATACATTAGTAGCACTACCTTTGGAAGTCTCAGCTCTTGCTTTTCGGGACTGAAGCCAGTTTTGCATGATAAAAGTG
GCCTTGTTACGGGAGATAATTGTGTTCTGTTGGGACTTTAGACAAAACTCACCTGCAAAAAACTGACAGGCATTAACTACTGGAACTTCC
AAATAATGTGTTTGCTGATCGTTTTACTCTTCGCATAAATATTTTAGGAAGTGTATGAGAATTTTGCCTTCAGGAACTTTTCTAACAGCC
AAAGACAGAACTTAACCTCTGCAAGCAAGATTCGTGGAAGATAGTCTCCACTTTTTAATGCACTAAGCAATCGGTTGCTAGGAGCCCATC
CTGGGTCAGAGGCCGATCCGCAGAACCAGAACGTTTTCCCCTCCTGGACTGTTAGTAACTTAGTCTCCCTCCTCCCCTAACCACCCCCGC
CCCCCCCCACCCCCCGCAGTAATAAAGGCCCCTGAACGTGTATGTTGGTCTCCCGGGAGCTGCTTGCTGAAGATCCGCGCCCCTGTCGCC
GTCTGGTAGGAGCTGTTTGCAGGGTCCTAACTCAATCGGCTTGTTGTGATGCGTATCCCCGTAGATGCCAGCACGAGCCGCCGCTTCACG
CCGCCTTCCACCGCGCTGAGCCCAGGCAAGATGAGCGAGGCGTTGCCGCTGGGCGCCCCGGACGCCGGCGCTGCCCTGGCCGGCAAGCTG
AGGAGCGGCGACCGCAGCATGGTGGAGGTGCTGGCCGACCACCCGGGCGAGCTGGTGCGCACCGACAGCCCCAACTTCCTCTGCTCCGTG
CTGCCTACGCACTGGCGCTGCAACAAGACCCTGCCCATCGCTTTCAAGGTGGTGGCCCTAGGGGATGTTCCAGATGGCACTCTGGTCACT
GTGATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACCTC
AGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCACCGCAAGTCGCCACCTACCACAGA
GCCATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGATCAGACCAAGCCCGGGAGCTTGTCCTTT
TCCGAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGCACAGCCATGAGGGTCAGCCCACACCACCCAGCCCCCACGCCCAACCCTCGTGCC
TCCCTGAACCACTCCACTGCCTTTAACCCTCAGCCTCAGAGTCAGATGCAGGTTTTGTCAAAGCAACAGGCTTCACAAGTCCTGGTTAGG
AAGCGTCGTGCAAATTCTTTACTTGAAGAAACCAAACAGGGTAATCTTGAAAGAGAATGCATCGAAGAACTGTGCAATAAAGAAGAAGCC
AGGGAGGTCTTTGAAAATGACCCGGAAACGGATTATTTTTATCCAAAATACTTAGTTTGTCTTCGCTCTTTTCAAACTGGGTTATTCACT
GCTGCACGTCAGTCAACTAATGCTTATCCTGACCTAAGAAGCTGTGTCAATGCCATTCCAGACCAGTGTAGTCCTCTGCCATGCAATGAA
GATGGATATATGAGCTGCAAAGATGGAAAAGCTTCTTTTACTTGCACTTGTAAACCAGGTTGGCAAGGAGAAAAGTGTGAATTTGACATA
AATGAATGCAAAGATCCCTCAAATATAAATGGAGGTTGCAGTCAAATTTGTGATAATACACCTGGAAGTTACCACTGTTCCTGTAAAAAT
GGTTTTGTTATGCTTTCAAATAAGAAAGATTGTAAAGATGTGGATGAATGCTCTTTGAAGCCAAGCATTTGTGGCACAGCTGTGTGCAAG
AACATCCCAGGAGATTTTGAATGTGAATGCCCCGAAGGCTACAGATATAATCTCAAATCAAAGTCTTGTGAAGATATAGATGAATGCTCT
GAGAACATGTGTGCTCAGCTTTGTGTCAATTACCCTGGAGGTTACACTTGCTATTGTGATGGGAAGAAAGGATTCAAACTTGCCCAAGAT
CAGAAGAGTTGTGAGGTTGTTTCAGTGTGCCTTCCCTTGAACCTTGACACAAAGTATGAATTACTTTACTTGGCGGAGCAGTTTGCAGGG
GTTGTTTTATATTTAAAATTTCGTTTGCCAGAAATCAGCAGATTTTCAGCAGAATTTGATTTCCGGACATATGATTCAGAAGGCGTGATA
CTGTACGCAGAATCTATCGATCACTCAGCGTGGCTCCTGATTGCACTTCGTGGTGGAAAGATTGAAGTTCAGCTTAAGAATGAACATACA
TCCAAAATCACAACTGGAGGTGATGTTATTAATAATGGTCTATGGAATATGGTGTCTGTGGAAGAATTAGAACATAGTATTAGCATTAAA
ATAGCTAAAGAAGCTGTGATGGATATAAATAAACCTGGACCCCTTTTTAAGCCGGAAAATGGATTGCTGGAAACCAAAGTATACTTTGCA
GGATTCCCTCGGAAAGTGGAAAGTGAACTCATTAAACCGATTAACCCTCGTCTAGATGGATGTATACGAAGCTGGAATTTGATGAAGCAA
GGAGCTTCTGGAATAAAGGAAATTATTCAAGAAAAACAAAATAAGCATTGCCTGGTTACTGTGGAGAAGGGCTCCTACTATCCTGGTTCT
GGAATTGCTCAATTTCACATAGATTATAATAATGTATCCAGTGCTGAGGGTTGGCATGTAAATGTGACCTTGAATATTCGTCCATCCACG
GGCACTGGTGTTATGCTTGCCTTGGTTTCTGGTAACAACACAGTGCCCTTTGCTGTGTCCTTGGTGGACTCCACCTCTGAAAAATCACAG
GATATTCTGTTATCTGTTGAAAATACTGTAATATATCGGATACAGGCCCTAAGTCTATGTTCCGATCAACAATCTCATCTGGAATTTAGA
GTCAACAGAAACAATCTGGAGTTGTCGACACCACTTAAAATAGAAACCATCTCCCATGAAGACCTTCAAAGACAACTTGCCGTCTTGGAC
AAAGCAATGAAAGCAAAAGTGGCCACATACCTGGGTGGCCTTCCAGATGTTCCATTCAGTGCCACACCAGTGAATGCCTTTTATAATGGC
TGCATGGAAGTGAATATTAATGGTGTACAGTTGGATCTGGATGAAGCCATTTCTAAACATAATGATATTAGAGCTCACTCATGTCCATCA
GTTTGGAAAAAGACAAAGAATTCTTAAGGCATCTTTTCTCTGCTTATAATACCTTTTCCTTGTGTGTAATTATACTTATGTTTCAATAAC
AGCTGAAGGGTTTTATTTACAATGTGCAGTCTTTGATTATTTTGTGGTCCTTTCCTGGGATTTTTAAAAGGTCCTTTGTCAAGGAAAAAA
ATTCTGTTGTGATATAAATCACAGTAAAGAAATTCTTACTTCTCTTGCTATCTAAGAATAGTGAAAAATAACAATTTTAAATTTGAATTT
TTTTCCTACAAATGACAGTTTCAATTTTTGTTTGTAAAACTAAATTTTAATTTTATCATCATGAACTAGTGTCTAAATACCTATGTTTTT
TTCAGAAAGCAAGGAAGTAAACTCAAACAAAAGTGCGTGTAATTAAATACTATTAATCATAGGCAGATACTATTTTGTTTATGTTTTTGT
TTTTTTCCTGATGAAGGCAGAAGAGATGGTGGTCTATTAAATATGAATTGAATGGAGGGTCCTAATGCCTTATTTCAAAACAATTCCTCA
GGGGGAACAGCTTTGGCTTCATCTTTCTCTTGTGTGGCTTCACATTTAAACCAGTATCTTTATTGAATTAGAAAACAAGTGGGACATATT
TTCCTGAGAGCAGCACAGGAATCTTCTTCTTGGCAGCTGCAGTCTGTCAGGATGAGATATCAGATTAGGTTGGATAGGTGGGGAAATCTG
AAGTGGGTACATTTTTTAAATTTTGCTGTGTGGGTCACACAAGGTCTACATTACAAAAGACAGAATTCAGGGATGGAAAGGAGAATGAAC
AAATGTGGGAGTTCATAGTTTTCCTTGAATCCAACTTTTAATTACCAGAGTAAGTTGCCAAAATGTGATTGTTGAAGTACAAAAGGAACT
ATGAAAACCAGAACAAATTTTAACAAAAGGACAACCACAGAGGGATATAGTGAATATCGTATCATTGTAATCAAAGAAGTAAGGAGGTAA
GATTGCCACGTGCCTGCTGGTACTGTGATGCATTTCAAGTGGCAGTTTTATCACGTTTGAATCTACCATTCATAGCCAGATGTGTATCAG
ATGTTTCACTGACAGTTTTTAACAATAAATTCTTTTCACTGTATTTTATATCACTTATAATAAATCGGTGTATAATTTTAAAATGCATGT

>In-frame_RUNX1_ENST00000325074_chr21_36206707_-_PROS1_ENST00000394236_chr3_93646251_-_3932nt
ATGCCCGCAGCACCGCGGGGACCGGCGCAGGGGGAAGCGGCCGCCCGCACGCGAAGCCGGGATGCCAGCACGAGCCGCCGCTTCACGCCG
CCTTCCACCGCGCTGAGCCCAGGCAAGATGAGCGAGGCGTTGCCGCTGGGCGCCCCGGACGCCGGCGCTGCCCTGGCCGGCAAGCTGAGG
AGCGGCGACCGCAGCATGGTGGAGGTGCTGGCCGACCACCCGGGCGAGCTGGTGCGCACCGACAGCCCCAACTTCCTCTGCTCCGTGCTG
CCTACGCACTGGCGCTGCAACAAGACCCTGCCCATCGCTTTCAAGGTGGTGGCCCTAGGGGATGTTCCAGATGGCACTCTGGTCACTGTG
ATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACCTCAGG
TTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCACCGCAAGTCGCCACCTACCACAGAGCC
ATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGATCAGACCAAGCCCGGGAGCTTGTCCTTTTCC
GAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGCACAGCCATGAGGGTCAGCCCACACCACCCAGCCCCCACGCCCAACCCTCGTGCCTCC
CTGAACCACTCCACTGCCTTTAACCCTCAGCCTCAGAGTCAGATGCAGGTTTTGTCAAAGCAACAGGCTTCACAAGTCCTGGTTAGGAAG
CGTCGTGCAAATTCTTTACTTGAAGAAACCAAACAGGGTAATCTTGAAAGAGAATGCATCGAAGAACTGTGCAATAAAGAAGAAGCCAGG
GAGGTCTTTGAAAATGACCCGGAAACGGATTATTTTTATCCAAAATACTTAGTTTGTCTTCGCTCTTTTCAAACTGGGTTATTCACTGCT
GCACGTCAGTCAACTAATGCTTATCCTGACCTAAGAAGCTGTGTCAATGCCATTCCAGACCAGTGTAGTCCTCTGCCATGCAATGAAGAT
GGATATATGAGCTGCAAAGATGGAAAAGCTTCTTTTACTTGCACTTGTAAACCAGGTTGGCAAGGAGAAAAGTGTGAATTTGACATAAAT
GAATGCAAAGATCCCTCAAATATAAATGGAGGTTGCAGTCAAATTTGTGATAATACACCTGGAAGTTACCACTGTTCCTGTAAAAATGGT
TTTGTTATGCTTTCAAATAAGAAAGATTGTAAAGATGTGGATGAATGCTCTTTGAAGCCAAGCATTTGTGGCACAGCTGTGTGCAAGAAC
ATCCCAGGAGATTTTGAATGTGAATGCCCCGAAGGCTACAGATATAATCTCAAATCAAAGTCTTGTGAAGATATAGATGAATGCTCTGAG
AACATGTGTGCTCAGCTTTGTGTCAATTACCCTGGAGGTTACACTTGCTATTGTGATGGGAAGAAAGGATTCAAACTTGCCCAAGATCAG
AAGAGTTGTGAGGTTGTTTCAGTGTGCCTTCCCTTGAACCTTGACACAAAGTATGAATTACTTTACTTGGCGGAGCAGTTTGCAGGGGTT
GTTTTATATTTAAAATTTCGTTTGCCAGAAATCAGCAGATTTTCAGCAGAATTTGATTTCCGGACATATGATTCAGAAGGCGTGATACTG
TACGCAGAATCTATCGATCACTCAGCGTGGCTCCTGATTGCACTTCGTGGTGGAAAGATTGAAGTTCAGCTTAAGAATGAACATACATCC
AAAATCACAACTGGAGGTGATGTTATTAATAATGGTCTATGGAATATGGTGTCTGTGGAAGAATTAGAACATAGTATTAGCATTAAAATA
GCTAAAGAAGCTGTGATGGATATAAATAAACCTGGACCCCTTTTTAAGCCGGAAAATGGATTGCTGGAAACCAAAGTATACTTTGCAGGA
TTCCCTCGGAAAGTGGAAAGTGAACTCATTAAACCGATTAACCCTCGTCTAGATGGATGTATACGAAGCTGGAATTTGATGAAGCAAGGA
GCTTCTGGAATAAAGGAAATTATTCAAGAAAAACAAAATAAGCATTGCCTGGTTACTGTGGAGAAGGGCTCCTACTATCCTGGTTCTGGA
ATTGCTCAATTTCACATAGATTATAATAATGTATCCAGTGCTGAGGGTTGGCATGTAAATGTGACCTTGAATATTCGTCCATCCACGGGC
ACTGGTGTTATGCTTGCCTTGGTTTCTGGTAACAACACAGTGCCCTTTGCTGTGTCCTTGGTGGACTCCACCTCTGAAAAATCACAGGAT
ATTCTGTTATCTGTTGAAAATACTGTAATATATCGGATACAGGCCCTAAGTCTATGTTCCGATCAACAATCTCATCTGGAATTTAGAGTC
AACAGAAACAATCTGGAGTTGTCGACACCACTTAAAATAGAAACCATCTCCCATGAAGACCTTCAAAGACAACTTGCCGTCTTGGACAAA
GCAATGAAAGCAAAAGTGGCCACATACCTGGGTGGCCTTCCAGATGTTCCATTCAGTGCCACACCAGTGAATGCCTTTTATAATGGCTGC
ATGGAAGTGAATATTAATGGTGTACAGTTGGATCTGGATGAAGCCATTTCTAAACATAATGATATTAGAGCTCACTCATGTCCATCAGTT
TGGAAAAAGACAAAGAATTCTTAAGGCATCTTTTCTCTGCTTATAATACCTTTTCCTTGTGTGTAATTATACTTATGTTTCAATAACAGC
TGAAGGGTTTTATTTACAATGTGCAGTCTTTGATTATTTTGTGGTCCTTTCCTGGGATTTTTAAAAGGTCCTTTGTCAAGGAAAAAAATT
CTGTTGTGATATAAATCACAGTAAAGAAATTCTTACTTCTCTTGCTATCTAAGAATAGTGAAAAATAACAATTTTAAATTTGAATTTTTT
TCCTACAAATGACAGTTTCAATTTTTGTTTGTAAAACTAAATTTTAATTTTATCATCATGAACTAGTGTCTAAATACCTATGTTTTTTTC
AGAAAGCAAGGAAGTAAACTCAAACAAAAGTGCGTGTAATTAAATACTATTAATCATAGGCAGATACTATTTTGTTTATGTTTTTGTTTT
TTTCCTGATGAAGGCAGAAGAGATGGTGGTCTATTAAATATGAATTGAATGGAGGGTCCTAATGCCTTATTTCAAAACAATTCCTCAGGG
GGAACAGCTTTGGCTTCATCTTTCTCTTGTGTGGCTTCACATTTAAACCAGTATCTTTATTGAATTAGAAAACAAGTGGGACATATTTTC
CTGAGAGCAGCACAGGAATCTTCTTCTTGGCAGCTGCAGTCTGTCAGGATGAGATATCAGATTAGGTTGGATAGGTGGGGAAATCTGAAG
TGGGTACATTTTTTAAATTTTGCTGTGTGGGTCACACAAGGTCTACATTACAAAAGACAGAATTCAGGGATGGAAAGGAGAATGAACAAA
TGTGGGAGTTCATAGTTTTCCTTGAATCCAACTTTTAATTACCAGAGTAAGTTGCCAAAATGTGATTGTTGAAGTACAAAAGGAACTATG
AAAACCAGAACAAATTTTAACAAAAGGACAACCACAGAGGGATATAGTGAATATCGTATCATTGTAATCAAAGAAGTAAGGAGGTAAGAT
TGCCACGTGCCTGCTGGTACTGTGATGCATTTCAAGTGGCAGTTTTATCACGTTTGAATCTACCATTCATAGCCAGATGTGTATCAGATG
TTTCACTGACAGTTTTTAACAATAAATTCTTTTCACTGTATTTTATATCACTTATAATAAATCGGTGTATAATTTTAAAATGCATGTGAA

>In-frame_RUNX1_ENST00000300305_chr21_36206707_-_PROS1_ENST00000394236_chr3_93646251_-_4413nt
GGAAAGGGGAACAGTTAAATTTGTAATTTGGGTTGTGTGAAAACTTCTTTGGGCCTCATAAACAACCACAGAACCACAAGTTGGGTAGCC
TGGCAGTGTCAGAAGTCTGAACCCAGCATAGTGGTCAGCAGGCAGGACGAATCACACTGAATGCAAACCACAGGGTTTCGCAGCGTGGTG
AGCATCACCAACCCACAGCCAAGGCGGCGCTGGCTTTTTTTTTTTTTTTAATCTTTAACAATTTGAATATTTGTTTTTACAAAGGTGCAT
TTTTTAATAGGGCTTGGGGAGTCCCAGAGGTATCCAGCAGAGGGGAGAAGAAAGAGAGATGTAGGGCTAGAGGGGTGAGGCTGAAACAGT
GACCTGTCTTGGTTTTCGCTCCGAAGGTAAAAGAAATCATTGAGTCCCCCGCCTTCAGAAGAGGGTGCATTTTCAGGAGGAAGCGATGGC
TTCAGACAGCATATTTGAGTCATTTCCTTCGTACCCACAGTGCTTCATGAGAGAATGCATACTTGGAATGAATCCTTCTAGAGACGTCCA
CGATGCCAGCACGAGCCGCCGCTTCACGCCGCCTTCCACCGCGCTGAGCCCAGGCAAGATGAGCGAGGCGTTGCCGCTGGGCGCCCCGGA
CGCCGGCGCTGCCCTGGCCGGCAAGCTGAGGAGCGGCGACCGCAGCATGGTGGAGGTGCTGGCCGACCACCCGGGCGAGCTGGTGCGCAC
CGACAGCCCCAACTTCCTCTGCTCCGTGCTGCCTACGCACTGGCGCTGCAACAAGACCCTGCCCATCGCTTTCAAGGTGGTGGCCCTAGG
GGATGTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAA
GAACCAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAA
CCCACCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGA
TCAGACCAAGCCCGGGAGCTTGTCCTTTTCCGAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGCACAGCCATGAGGGTCAGCCCACACCA
CCCAGCCCCCACGCCCAACCCTCGTGCCTCCCTGAACCACTCCACTGCCTTTAACCCTCAGCCTCAGAGTCAGATGCAGGTTTTGTCAAA
GCAACAGGCTTCACAAGTCCTGGTTAGGAAGCGTCGTGCAAATTCTTTACTTGAAGAAACCAAACAGGGTAATCTTGAAAGAGAATGCAT
CGAAGAACTGTGCAATAAAGAAGAAGCCAGGGAGGTCTTTGAAAATGACCCGGAAACGGATTATTTTTATCCAAAATACTTAGTTTGTCT
TCGCTCTTTTCAAACTGGGTTATTCACTGCTGCACGTCAGTCAACTAATGCTTATCCTGACCTAAGAAGCTGTGTCAATGCCATTCCAGA
CCAGTGTAGTCCTCTGCCATGCAATGAAGATGGATATATGAGCTGCAAAGATGGAAAAGCTTCTTTTACTTGCACTTGTAAACCAGGTTG
GCAAGGAGAAAAGTGTGAATTTGACATAAATGAATGCAAAGATCCCTCAAATATAAATGGAGGTTGCAGTCAAATTTGTGATAATACACC
TGGAAGTTACCACTGTTCCTGTAAAAATGGTTTTGTTATGCTTTCAAATAAGAAAGATTGTAAAGATGTGGATGAATGCTCTTTGAAGCC
AAGCATTTGTGGCACAGCTGTGTGCAAGAACATCCCAGGAGATTTTGAATGTGAATGCCCCGAAGGCTACAGATATAATCTCAAATCAAA
GTCTTGTGAAGATATAGATGAATGCTCTGAGAACATGTGTGCTCAGCTTTGTGTCAATTACCCTGGAGGTTACACTTGCTATTGTGATGG
GAAGAAAGGATTCAAACTTGCCCAAGATCAGAAGAGTTGTGAGGTTGTTTCAGTGTGCCTTCCCTTGAACCTTGACACAAAGTATGAATT
ACTTTACTTGGCGGAGCAGTTTGCAGGGGTTGTTTTATATTTAAAATTTCGTTTGCCAGAAATCAGCAGATTTTCAGCAGAATTTGATTT
CCGGACATATGATTCAGAAGGCGTGATACTGTACGCAGAATCTATCGATCACTCAGCGTGGCTCCTGATTGCACTTCGTGGTGGAAAGAT
TGAAGTTCAGCTTAAGAATGAACATACATCCAAAATCACAACTGGAGGTGATGTTATTAATAATGGTCTATGGAATATGGTGTCTGTGGA
AGAATTAGAACATAGTATTAGCATTAAAATAGCTAAAGAAGCTGTGATGGATATAAATAAACCTGGACCCCTTTTTAAGCCGGAAAATGG
ATTGCTGGAAACCAAAGTATACTTTGCAGGATTCCCTCGGAAAGTGGAAAGTGAACTCATTAAACCGATTAACCCTCGTCTAGATGGATG
TATACGAAGCTGGAATTTGATGAAGCAAGGAGCTTCTGGAATAAAGGAAATTATTCAAGAAAAACAAAATAAGCATTGCCTGGTTACTGT
GGAGAAGGGCTCCTACTATCCTGGTTCTGGAATTGCTCAATTTCACATAGATTATAATAATGTATCCAGTGCTGAGGGTTGGCATGTAAA
TGTGACCTTGAATATTCGTCCATCCACGGGCACTGGTGTTATGCTTGCCTTGGTTTCTGGTAACAACACAGTGCCCTTTGCTGTGTCCTT
GGTGGACTCCACCTCTGAAAAATCACAGGATATTCTGTTATCTGTTGAAAATACTGTAATATATCGGATACAGGCCCTAAGTCTATGTTC
CGATCAACAATCTCATCTGGAATTTAGAGTCAACAGAAACAATCTGGAGTTGTCGACACCACTTAAAATAGAAACCATCTCCCATGAAGA
CCTTCAAAGACAACTTGCCGTCTTGGACAAAGCAATGAAAGCAAAAGTGGCCACATACCTGGGTGGCCTTCCAGATGTTCCATTCAGTGC
CACACCAGTGAATGCCTTTTATAATGGCTGCATGGAAGTGAATATTAATGGTGTACAGTTGGATCTGGATGAAGCCATTTCTAAACATAA
TGATATTAGAGCTCACTCATGTCCATCAGTTTGGAAAAAGACAAAGAATTCTTAAGGCATCTTTTCTCTGCTTATAATACCTTTTCCTTG
TGTGTAATTATACTTATGTTTCAATAACAGCTGAAGGGTTTTATTTACAATGTGCAGTCTTTGATTATTTTGTGGTCCTTTCCTGGGATT
TTTAAAAGGTCCTTTGTCAAGGAAAAAAATTCTGTTGTGATATAAATCACAGTAAAGAAATTCTTACTTCTCTTGCTATCTAAGAATAGT
GAAAAATAACAATTTTAAATTTGAATTTTTTTCCTACAAATGACAGTTTCAATTTTTGTTTGTAAAACTAAATTTTAATTTTATCATCAT
GAACTAGTGTCTAAATACCTATGTTTTTTTCAGAAAGCAAGGAAGTAAACTCAAACAAAAGTGCGTGTAATTAAATACTATTAATCATAG
GCAGATACTATTTTGTTTATGTTTTTGTTTTTTTCCTGATGAAGGCAGAAGAGATGGTGGTCTATTAAATATGAATTGAATGGAGGGTCC
TAATGCCTTATTTCAAAACAATTCCTCAGGGGGAACAGCTTTGGCTTCATCTTTCTCTTGTGTGGCTTCACATTTAAACCAGTATCTTTA
TTGAATTAGAAAACAAGTGGGACATATTTTCCTGAGAGCAGCACAGGAATCTTCTTCTTGGCAGCTGCAGTCTGTCAGGATGAGATATCA
GATTAGGTTGGATAGGTGGGGAAATCTGAAGTGGGTACATTTTTTAAATTTTGCTGTGTGGGTCACACAAGGTCTACATTACAAAAGACA
GAATTCAGGGATGGAAAGGAGAATGAACAAATGTGGGAGTTCATAGTTTTCCTTGAATCCAACTTTTAATTACCAGAGTAAGTTGCCAAA
ATGTGATTGTTGAAGTACAAAAGGAACTATGAAAACCAGAACAAATTTTAACAAAAGGACAACCACAGAGGGATATAGTGAATATCGTAT
CATTGTAATCAAAGAAGTAAGGAGGTAAGATTGCCACGTGCCTGCTGGTACTGTGATGCATTTCAAGTGGCAGTTTTATCACGTTTGAAT
CTACCATTCATAGCCAGATGTGTATCAGATGTTTCACTGACAGTTTTTAACAATAAATTCTTTTCACTGTATTTTATATCACTTATAATA
AATCGGTGTATAATTTTAAAATGCATGTGAATATCTTTATTATATCAACTGTTTGAATAAAACAAAATTACATAATAGACATTTAACTCT

>In-frame_RUNX1_ENST00000358356_chr21_36206707_-_PROS1_ENST00000394236_chr3_93646251_-_5465nt
CATAGAGCCAGCGGGCGCGGGCGGGACGGGCGCCCCGCGGCCGGACCCAGCCAGGGCACCACGCTGCCCGGCCCTGCGCCGCCAGGCACT
TCTTTCCGGGGCTCCTAGGGACGCCAGAAGGAAGTCAACCTCTGCTGCTTCTCCTTGGCCTGCGTTGGACCTTCCTTTTTTTGTTGTTTT
TTTTTGTTTTTCCCCTTTCTTCCTTTTGAATTAACTGGCTTCTTGGCTGGATGTTTTCAACTTCTTTCCTGGCTGCGAACTTTTCCCCAA
TTGTTTTCCTTTTACAACAGGGGGAGAAAGTGCTCTGTGGTCCGAGGCGAGCCGTGAAGTTGCGTGTGCGTGGCAGTGTGCGTGGCAGGA
TGTGCGTGCGTGTGTAACCCGAGCCGCCCGATCTGTTTCGATCTGCGCCGCGGAGCCCTCCCTCAAGGCCCGCTCCACCTGCTGCGGTTA
CGCGGCGCTCGTGGGTGTTCGTGCCTCGGAGCAGCTAACCGGCGGGTGCTGGGCGACGGTGGAGGAGTATCGTCTCGCTGCTGCCCGAGT
CAGGGCTGAGTCACCCAGCTGATGTAGACAGTGGCTGCCTTCCGAAGAGTGCGTGTTTGCATGTGTGTGACTCTGCGGCTGCTCAACTCC
CAACAAACCAGAGGACCAGCCACAAACTTAACCAACATCCCCAAACCCGAGTTCACAGATGTGGGAGAGCTGTAGAACCCTGAGTGTCAT
CGACTGGGCCTTCTTATGATTGTTGTTTTAAGATTAGCTGAAGATCTCTGAAACGCTGAATTTTCTGCACTGAGCGTTTTGACAGAATTC
ATTGAGAGAACAGAGAACATGACAAGTACTTCTAGCTCAGCACTGCTCCAACTACTGAAGCTGATTTTCAAGGCTACTTAAAAAAATCTG
CAGCGTACATTAATGGATTTCTGTTGTGTTTAAATTCTCCACAGATTGTATTGTAAATATTTTATGAAGTAGAGCATATGTATATATTTA
TATATACGTGCACATACATTAGTAGCACTACCTTTGGAAGTCTCAGCTCTTGCTTTTCGGGACTGAAGCCAGTTTTGCATGATAAAAGTG
GCCTTGTTACGGGAGATAATTGTGTTCTGTTGGGACTTTAGACAAAACTCACCTGCAAAAAACTGACAGGCATTAACTACTGGAACTTCC
AAATAATGTGTTTGCTGATCGTTTTACTCTTCGCATAAATATTTTAGGAAGTGTATGAGAATTTTGCCTTCAGGAACTTTTCTAACAGCC
AAAGACAGAACTTAACCTCTGCAAGCAAGATTCGTGGAAGATAGTCTCCACTTTTTAATGCACTAAGCAATCGGTTGCTAGGAGCCCATC
CTGGGTCAGAGGCCGATCCGCAGAACCAGAACGTTTTCCCCTCCTGGACTGTTAGTAACTTAGTCTCCCTCCTCCCCTAACCACCCCCGC
CCCCCCCCACCCCCCGCAGTAATAAAGGCCCCTGAACGTGTATGTTGGTCTCCCGGGAGCTGCTTGCTGAAGATCCGCGCCCCTGTCGCC
GTCTGGTAGGAGCTGTTTGCAGGGTCCTAACTCAATCGGCTTGTTGTGATGCGTATCCCCGTAGATGCCAGCACGAGCCGCCGCTTCACG
CCGCCTTCCACCGCGCTGAGCCCAGGCAAGATGAGCGAGGCGTTGCCGCTGGGCGCCCCGGACGCCGGCGCTGCCCTGGCCGGCAAGCTG
AGGAGCGGCGACCGCAGCATGGTGGAGGTGCTGGCCGACCACCCGGGCGAGCTGGTGCGCACCGACAGCCCCAACTTCCTCTGCTCCGTG
CTGCCTACGCACTGGCGCTGCAACAAGACCCTGCCCATCGCTTTCAAGGTGGTGGCCCTAGGGGATGTTCCAGATGGCACTCTGGTCACT
GTGATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACCTC
AGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCACCGCAAGTCGCCACCTACCACAGA
GCCATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGATCAGACCAAGCCCGGGAGCTTGTCCTTT
TCCGAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGCACAGCCATGAGGGTCAGCCCACACCACCCAGCCCCCACGCCCAACCCTCGTGCC
TCCCTGAACCACTCCACTGCCTTTAACCCTCAGCCTCAGAGTCAGATGCAGGTTTTGTCAAAGCAACAGGCTTCACAAGTCCTGGTTAGG
AAGCGTCGTGCAAATTCTTTACTTGAAGAAACCAAACAGGGTAATCTTGAAAGAGAATGCATCGAAGAACTGTGCAATAAAGAAGAAGCC
AGGGAGGTCTTTGAAAATGACCCGGAAACGGATTATTTTTATCCAAAATACTTAGTTTGTCTTCGCTCTTTTCAAACTGGGTTATTCACT
GCTGCACGTCAGTCAACTAATGCTTATCCTGACCTAAGAAGCTGTGTCAATGCCATTCCAGACCAGTGTAGTCCTCTGCCATGCAATGAA
GATGGATATATGAGCTGCAAAGATGGAAAAGCTTCTTTTACTTGCACTTGTAAACCAGGTTGGCAAGGAGAAAAGTGTGAATTTGACATA
AATGAATGCAAAGATCCCTCAAATATAAATGGAGGTTGCAGTCAAATTTGTGATAATACACCTGGAAGTTACCACTGTTCCTGTAAAAAT
GGTTTTGTTATGCTTTCAAATAAGAAAGATTGTAAAGATGTGGATGAATGCTCTTTGAAGCCAAGCATTTGTGGCACAGCTGTGTGCAAG
AACATCCCAGGAGATTTTGAATGTGAATGCCCCGAAGGCTACAGATATAATCTCAAATCAAAGTCTTGTGAAGATATAGATGAATGCTCT
GAGAACATGTGTGCTCAGCTTTGTGTCAATTACCCTGGAGGTTACACTTGCTATTGTGATGGGAAGAAAGGATTCAAACTTGCCCAAGAT
CAGAAGAGTTGTGAGGTTGTTTCAGTGTGCCTTCCCTTGAACCTTGACACAAAGTATGAATTACTTTACTTGGCGGAGCAGTTTGCAGGG
GTTGTTTTATATTTAAAATTTCGTTTGCCAGAAATCAGCAGATTTTCAGCAGAATTTGATTTCCGGACATATGATTCAGAAGGCGTGATA
CTGTACGCAGAATCTATCGATCACTCAGCGTGGCTCCTGATTGCACTTCGTGGTGGAAAGATTGAAGTTCAGCTTAAGAATGAACATACA
TCCAAAATCACAACTGGAGGTGATGTTATTAATAATGGTCTATGGAATATGGTGTCTGTGGAAGAATTAGAACATAGTATTAGCATTAAA
ATAGCTAAAGAAGCTGTGATGGATATAAATAAACCTGGACCCCTTTTTAAGCCGGAAAATGGATTGCTGGAAACCAAAGTATACTTTGCA
GGATTCCCTCGGAAAGTGGAAAGTGAACTCATTAAACCGATTAACCCTCGTCTAGATGGATGTATACGAAGCTGGAATTTGATGAAGCAA
GGAGCTTCTGGAATAAAGGAAATTATTCAAGAAAAACAAAATAAGCATTGCCTGGTTACTGTGGAGAAGGGCTCCTACTATCCTGGTTCT
GGAATTGCTCAATTTCACATAGATTATAATAATGTATCCAGTGCTGAGGGTTGGCATGTAAATGTGACCTTGAATATTCGTCCATCCACG
GGCACTGGTGTTATGCTTGCCTTGGTTTCTGGTAACAACACAGTGCCCTTTGCTGTGTCCTTGGTGGACTCCACCTCTGAAAAATCACAG
GATATTCTGTTATCTGTTGAAAATACTGTAATATATCGGATACAGGCCCTAAGTCTATGTTCCGATCAACAATCTCATCTGGAATTTAGA
GTCAACAGAAACAATCTGGAGTTGTCGACACCACTTAAAATAGAAACCATCTCCCATGAAGACCTTCAAAGACAACTTGCCGTCTTGGAC
AAAGCAATGAAAGCAAAAGTGGCCACATACCTGGGTGGCCTTCCAGATGTTCCATTCAGTGCCACACCAGTGAATGCCTTTTATAATGGC
TGCATGGAAGTGAATATTAATGGTGTACAGTTGGATCTGGATGAAGCCATTTCTAAACATAATGATATTAGAGCTCACTCATGTCCATCA
GTTTGGAAAAAGACAAAGAATTCTTAAGGCATCTTTTCTCTGCTTATAATACCTTTTCCTTGTGTGTAATTATACTTATGTTTCAATAAC
AGCTGAAGGGTTTTATTTACAATGTGCAGTCTTTGATTATTTTGTGGTCCTTTCCTGGGATTTTTAAAAGGTCCTTTGTCAAGGAAAAAA
ATTCTGTTGTGATATAAATCACAGTAAAGAAATTCTTACTTCTCTTGCTATCTAAGAATAGTGAAAAATAACAATTTTAAATTTGAATTT
TTTTCCTACAAATGACAGTTTCAATTTTTGTTTGTAAAACTAAATTTTAATTTTATCATCATGAACTAGTGTCTAAATACCTATGTTTTT
TTCAGAAAGCAAGGAAGTAAACTCAAACAAAAGTGCGTGTAATTAAATACTATTAATCATAGGCAGATACTATTTTGTTTATGTTTTTGT
TTTTTTCCTGATGAAGGCAGAAGAGATGGTGGTCTATTAAATATGAATTGAATGGAGGGTCCTAATGCCTTATTTCAAAACAATTCCTCA
GGGGGAACAGCTTTGGCTTCATCTTTCTCTTGTGTGGCTTCACATTTAAACCAGTATCTTTATTGAATTAGAAAACAAGTGGGACATATT
TTCCTGAGAGCAGCACAGGAATCTTCTTCTTGGCAGCTGCAGTCTGTCAGGATGAGATATCAGATTAGGTTGGATAGGTGGGGAAATCTG
AAGTGGGTACATTTTTTAAATTTTGCTGTGTGGGTCACACAAGGTCTACATTACAAAAGACAGAATTCAGGGATGGAAAGGAGAATGAAC
AAATGTGGGAGTTCATAGTTTTCCTTGAATCCAACTTTTAATTACCAGAGTAAGTTGCCAAAATGTGATTGTTGAAGTACAAAAGGAACT
ATGAAAACCAGAACAAATTTTAACAAAAGGACAACCACAGAGGGATATAGTGAATATCGTATCATTGTAATCAAAGAAGTAAGGAGGTAA
GATTGCCACGTGCCTGCTGGTACTGTGATGCATTTCAAGTGGCAGTTTTATCACGTTTGAATCTACCATTCATAGCCAGATGTGTATCAG
ATGTTTCACTGACAGTTTTTAACAATAAATTCTTTTCACTGTATTTTATATCACTTATAATAAATCGGTGTATAATTTTAAAATGCATGT


Top

FusionGenePPI for RUNX1_PROS1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RUNX1SUV39H1, KAT6B, CBFB, AES, PAX5, YAP1, JUN, FOS, SMAD3, SMAD1, SMAD2, SMAD5, VDR, ELF4, ELF2, CEBPB, TLE1, CBFA2T2, TRAF6, FHL2, MYOD1, HIPK2, EP300, HDAC1, HDAC3, KAT6A, TCF12, TCF3, RUNX1T1, NCOR1, SIAH1, UBE2L6, RUNX1, PML, RARA, HDAC2, SIN3A, NR4A2, TRIM33, STUB1, SMARCA4, SMARCB1, SMARCC1, CDK1, TAL1, COPRS, KMT2A, RBM14, SPEN, DNMT1, ELAVL1, CBFA2T3, PRMT1, HLA-DMA, CREBBP, UXT, CTBP2, NOTCH1, MYC, NCOR2, FOXP3, SOX2, CTBP1, HDAC11, RAG1, SPI1, ELF1, CDK6, KLF6, NFATC1, NFATC2, ZNF131, BRCA1, CDK9, FANCD2PROS1F8, F5, NPM1, RPSA, TBK1, FBXO6, C4BPB, ZPBP2, LYZL2, TCTN2, PROC, BMP4


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneRUNX1chr21:36206707chr3:93646251ENST00000300305-68135_143268481DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000300305-68168_177268481DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000300305-6880_84268481DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000325074-57135_143256469DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000325074-57168_177256469DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000325074-5780_84256469DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000344691-46135_143241454DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000344691-46168_177241454DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000344691-4680_84241454DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000358356-45135_143241251DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000358356-45168_177241251DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000358356-4580_84241251DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000437180-79135_143268481DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000437180-79168_177268481DNA
HgeneRUNX1chr21:36206707chr3:93646251ENST00000437180-7980_84268481DNA


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneRUNX1chr21:36206707chr3:93646251ENST00000300305-68362_402268481FOXP3
HgeneRUNX1chr21:36206707chr3:93646251ENST00000325074-57362_402256469FOXP3
HgeneRUNX1chr21:36206707chr3:93646251ENST00000344691-46362_402241454FOXP3
HgeneRUNX1chr21:36206707chr3:93646251ENST00000358356-45362_402241251FOXP3
HgeneRUNX1chr21:36206707chr3:93646251ENST00000437180-79362_402268481FOXP3
HgeneRUNX1chr21:36206707chr3:93646251ENST00000300305-68291_371268481KAT6A
HgeneRUNX1chr21:36206707chr3:93646251ENST00000325074-57291_371256469KAT6A
HgeneRUNX1chr21:36206707chr3:93646251ENST00000344691-46291_371241454KAT6A
HgeneRUNX1chr21:36206707chr3:93646251ENST00000358356-45291_371241251KAT6A
HgeneRUNX1chr21:36206707chr3:93646251ENST00000437180-79291_371268481KAT6A
HgeneRUNX1chr21:36206707chr3:93646251ENST00000300305-68307_400268481KAT6B
HgeneRUNX1chr21:36206707chr3:93646251ENST00000325074-57307_400256469KAT6B
HgeneRUNX1chr21:36206707chr3:93646251ENST00000344691-46307_400241454KAT6B
HgeneRUNX1chr21:36206707chr3:93646251ENST00000358356-45307_400241251KAT6B
HgeneRUNX1chr21:36206707chr3:93646251ENST00000437180-79307_400268481KAT6B


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RUNX1_PROS1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgenePROS1P07225DB00464Sodium Tetradecyl SulfateVitamin K-dependent protein Ssmall moleculeapproved|investigational
TgenePROS1P07225DB00055Drotrecogin alfaVitamin K-dependent protein Sbiotechapproved|investigational|withdrawn
TgenePROS1P07225DB00170MenadioneVitamin K-dependent protein Ssmall moleculeapproved|nutraceutical

Top

RelatedDiseases for RUNX1_PROS1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRUNX1C0023467Leukemia, Myelocytic, Acute2CTD_human;HPO
HgeneRUNX1C0023485Precursor B-Cell Lymphoblastic Leukemia-Lymphoma2CTD_human
HgeneRUNX1C0003873Rheumatoid Arthritis1CTD_human
HgeneRUNX1C0017636Glioblastoma1CTD_human
HgeneRUNX1C0033578Prostatic Neoplasms1CTD_human
HgeneRUNX1C0349639Juvenile Myelomonocytic Leukemia1CTD_human
HgeneRUNX1C1832388Platelet Disorder, Familial, with Associated Myeloid Malignancy1CTD_human;ORPHANET;UNIPROT
HgeneRUNX1C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human
TgenePROS1C3278211THROMBOPHILIA DUE TO PROTEIN S DEFICIENCY, AUTOSOMAL DOMINANT26CTD_human;UNIPROT
TgenePROS1C0035222Respiratory Distress Syndrome, Adult1CTD_human
TgenePROS1C0040038Thromboembolism1CTD_human
TgenePROS1C0040053Thrombosis1CTD_human
TgenePROS1C0338575Sagittal Sinus Thrombosis1CTD_human
TgenePROS1C0600433Activated Protein C Resistance1CTD_human
TgenePROS1C3281092THROMBOPHILIA DUE TO PROTEIN S DEFICIENCY, AUTOSOMAL RECESSIVE1UNIPROT
TgenePROS1C3495559Juvenile arthritis1CTD_human