FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32360

FusionGeneSummary for RTN4RL2_CTNND1

check button Fusion gene summary
Fusion gene informationFusion gene name: RTN4RL2_CTNND1
Fusion gene ID: 32360
HgeneTgene
Gene symbol

RTN4RL2

CTNND1

Gene ID

349667

1500

Gene namereticulon 4 receptor like 2catenin delta 1
SynonymsNGRH1|NgR2BCDS2|CAS|CTNND|P120CAS|P120CTN|p120|p120(CAS)|p120(CTN)
Cytomap

11q12.1

11q12.1

Type of geneprotein-codingprotein-coding
Descriptionreticulon-4 receptor-like 2Nogo-66 receptor homolog 1nogo receptor-like 3nogo-66 receptor-related protein 2catenin delta-1cadherin-associated Src substratecatenin (cadherin-associated protein), delta 1p120 catenin
Modification date2018052320180523
UniProtAcc

Q86UN3

O60716

Ensembl transtripts involved in fusion geneENST00000335099, ENST00000533205, 
ENST00000395120, 
ENST00000524630, 
ENST00000529919, ENST00000399039, 
ENST00000360682, ENST00000361796, 
ENST00000361391, ENST00000530094, 
ENST00000428599, ENST00000361332, 
ENST00000527467, ENST00000415361, 
ENST00000532245, ENST00000532463, 
ENST00000528232, ENST00000529986, 
ENST00000531014, ENST00000358694, 
ENST00000526772, ENST00000532787, 
ENST00000533667, ENST00000529873, 
ENST00000525902, ENST00000529526, 
ENST00000532649, ENST00000426142, 
ENST00000532844, ENST00000528621, 
ENST00000399050, ENST00000526357, 
ENST00000530748, ENST00000534579, 
ENST00000526938, 
Fusion gene scores* DoF score2 X 1 X 2=48 X 7 X 5=280
# samples 29
** MAII scorelog2(2/4*10)=2.32192809488736log2(9/280*10)=-1.63742992061529
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RTN4RL2 [Title/Abstract] AND CTNND1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-09-0367-01ARTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000335099ENST00000524630RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000335099ENST00000529919RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000335099ENST00000399039RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000335099ENST00000360682RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000335099ENST00000361796RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000335099ENST00000361391RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000530094RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000428599RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000361332RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000335099ENST00000527467RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000415361RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000335099ENST00000532245RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000532463RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000528232RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000529986RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000335099ENST00000531014RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000335099ENST00000358694RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000335099ENST00000526772RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000532787RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000335099ENST00000533667RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000335099ENST00000529873RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000335099ENST00000525902RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000335099ENST00000529526RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000335099ENST00000532649RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000426142RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000532844RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000528621RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000399050RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000526357RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000530748RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000534579RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000335099ENST00000526938RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000533205ENST00000524630RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000533205ENST00000529919RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000533205ENST00000399039RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000533205ENST00000360682RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000533205ENST00000361796RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000533205ENST00000361391RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000530094RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000428599RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000361332RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000533205ENST00000527467RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000415361RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000533205ENST00000532245RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000532463RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000528232RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000529986RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000533205ENST00000531014RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000533205ENST00000358694RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000533205ENST00000526772RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000532787RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000533205ENST00000533667RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000533205ENST00000529873RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000533205ENST00000525902RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000533205ENST00000529526RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000533205ENST00000532649RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000426142RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000532844RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000528621RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000399050RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000526357RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000530748RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000534579RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000533205ENST00000526938RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000395120ENST00000524630RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000395120ENST00000529919RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000395120ENST00000399039RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000395120ENST00000360682RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000395120ENST00000361796RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
In-frameENST00000395120ENST00000361391RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000530094RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000428599RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000361332RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000395120ENST00000527467RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000415361RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000395120ENST00000532245RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000532463RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000528232RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000529986RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000395120ENST00000531014RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000395120ENST00000358694RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000395120ENST00000526772RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000532787RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000395120ENST00000533667RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000395120ENST00000529873RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000395120ENST00000525902RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000395120ENST00000529526RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-intronENST00000395120ENST00000532649RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000426142RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000532844RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000528621RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000399050RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000526357RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000530748RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000534579RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+
5CDS-5UTRENST00000395120ENST00000526938RTN4RL2chr11

57235563

+CTNND1chr11

57561482

+

Top

FusionProtFeatures for RTN4RL2_CTNND1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RTN4RL2

Q86UN3

CTNND1

O60716

Cell surface receptor that plays a functionallyredundant role in the inhibition of neurite outgrowth mediated byMAG (By similarity). Plays a functionally redundant role inpostnatal brain development. Contributes to normal axon migrationacross the brain midline and normal formation of the corpuscallosum. Does not seem to play a significant role in regulatingaxon regeneration in the adult central nervous system. Protectsmotoneurons against apoptosis; protection against apoptosis isprobably mediated by MAG (By similarity). Like other familymembers, plays a role in restricting the number dendritic spinesand the number of synapses that are formed during braindevelopment (PubMed:22325200). Signaling mediates activation ofRho and downstream reorganization of the actin cytoskeleton(PubMed:22325200). {ECO:0000250|UniProtKB:Q7M6Z0,ECO:0000250|UniProtKB:Q80WD1, ECO:0000269|PubMed:22325200}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000335099+2347_60171421DomainNote=LRRNT
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000395120+2347_60171194DomainNote=LRRNT
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000335099+23107_129171421RepeatNote=LRR 3
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000335099+23132_153171421RepeatNote=LRR 4
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000335099+2361_82171421RepeatNote=LRR 1
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000335099+2383_104171421RepeatNote=LRR 2
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000395120+23107_129171194RepeatNote=LRR 3
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000395120+23132_153171194RepeatNote=LRR 4
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000395120+2361_82171194RepeatNote=LRR 1
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000395120+2383_104171194RepeatNote=LRR 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000415361+01910_46-36868Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000426142+01710_46-36833Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000525902+01510_46-88617Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526357+11910_4611909Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526772+01410_46-88611Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000527467+01610_46-88646Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528232+01810_46-36839Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528621+11810_4611880Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529526+21910_4611880Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529873+11810_4611888Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529986+01710_46-36833Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530094+01810_46-36862Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530748+11910_4611886Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000531014+01510_46-88640Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532245+01610_46-96833Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532463+01710_46-36833Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532649+21910_4611880Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532787+01710_46-36841Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532844+12010_4611915Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000533667+01410_46-88619Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000534579+21910_4611880Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000358694+219358_39565934RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000358694+219398_43765934RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000358694+219441_47565934RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000358694+219476_51665934RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000358694+219534_57365934RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000358694+219583_62465934RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000358694+219653_69365934RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000358694+219700_73965934RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000358694+219740_78065934RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000358694+219781_82665934RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000360682+220358_39565948RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000360682+220398_43765948RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000360682+220441_47565948RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000360682+220476_51665948RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000360682+220534_57365948RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000360682+220583_62465948RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000360682+220653_69365948RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000360682+220700_73965948RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000360682+220740_78065948RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000360682+220781_82665948RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361332+220358_39565963RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361332+220398_43765963RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361332+220441_47565963RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361332+220476_51665963RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361332+220534_57365963RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361332+220583_62465963RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361332+220653_69365963RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361332+220700_73965963RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361332+220740_78065963RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361332+220781_82665963RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361391+219358_39565942RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361391+219398_43765942RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361391+219441_47565942RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361391+219476_51665942RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361391+219534_57365942RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361391+219583_62465942RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361391+219653_69365942RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361391+219700_73965942RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361391+219740_78065942RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361391+219781_82665942RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361796+219358_39565934RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361796+219398_43765934RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361796+219441_47565934RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361796+219476_51665934RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361796+219534_57365934RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361796+219583_62465934RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361796+219653_69365934RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361796+219700_73965934RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361796+219740_78065934RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361796+219781_82665934RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000399050+221358_39565969RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000399050+221398_43765969RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000399050+221441_47565969RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000399050+221476_51665969RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000399050+221534_57365969RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000399050+221583_62465969RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000399050+221653_69365969RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000399050+221700_73965969RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000399050+221740_78065969RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000399050+221781_82665969RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000415361+019358_395-36868RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000415361+019398_437-36868RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000415361+019441_475-36868RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000415361+019476_516-36868RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000415361+019534_573-36868RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000415361+019583_624-36868RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000415361+019653_693-36868RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000415361+019700_739-36868RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000415361+019740_780-36868RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000415361+019781_826-36868RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000426142+017358_395-36833RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000426142+017398_437-36833RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000426142+017441_475-36833RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000426142+017476_516-36833RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000426142+017534_573-36833RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000426142+017583_624-36833RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000426142+017653_693-36833RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000426142+017700_739-36833RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000426142+017740_780-36833RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000426142+017781_826-36833RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000428599+118358_39565934RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000428599+118398_43765934RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000428599+118441_47565934RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000428599+118476_51665934RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000428599+118534_57365934RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000428599+118583_62465934RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000428599+118653_69365934RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000428599+118700_73965934RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000428599+118740_78065934RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000428599+118781_82665934RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000524630+219358_39565934RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000524630+219398_43765934RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000524630+219441_47565934RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000524630+219476_51665934RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000524630+219534_57365934RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000524630+219583_62465934RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000524630+219653_69365934RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000524630+219700_73965934RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000524630+219740_78065934RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000524630+219781_82665934RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000525902+015358_395-88617RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000525902+015398_437-88617RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000525902+015441_475-88617RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000525902+015476_516-88617RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000525902+015534_573-88617RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000525902+015583_624-88617RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000525902+015653_693-88617RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000525902+015700_739-88617RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000525902+015740_780-88617RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000525902+015781_826-88617RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526357+119358_39511909RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526357+119398_43711909RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526357+119441_47511909RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526357+119476_51611909RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526357+119534_57311909RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526357+119583_62411909RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526357+119653_69311909RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526357+119700_73911909RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526357+119740_78011909RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526357+119781_82611909RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526772+014358_395-88611RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526772+014398_437-88611RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526772+014441_475-88611RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526772+014476_516-88611RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526772+014534_573-88611RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526772+014583_624-88611RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526772+014653_693-88611RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526772+014700_739-88611RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526772+014740_780-88611RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526772+014781_826-88611RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526938+118358_39565919RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526938+118398_43765919RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526938+118441_47565919RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526938+118476_51665919RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526938+118534_57365919RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526938+118583_62465919RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526938+118653_69365919RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526938+118700_73965919RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526938+118740_78065919RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526938+118781_82665919RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000527467+016358_395-88646RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000527467+016398_437-88646RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000527467+016441_475-88646RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000527467+016476_516-88646RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000527467+016534_573-88646RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000527467+016583_624-88646RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000527467+016653_693-88646RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000527467+016700_739-88646RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000527467+016740_780-88646RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000527467+016781_826-88646RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528232+018358_395-36839RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528232+018398_437-36839RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528232+018441_475-36839RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528232+018476_516-36839RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528232+018534_573-36839RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528232+018583_624-36839RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528232+018653_693-36839RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528232+018700_739-36839RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528232+018740_780-36839RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528232+018781_826-36839RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528621+118358_39511880RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528621+118398_43711880RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528621+118441_47511880RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528621+118476_51611880RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528621+118534_57311880RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528621+118583_62411880RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528621+118653_69311880RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528621+118700_73911880RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528621+118740_78011880RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000528621+118781_82611880RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529526+219358_39511880RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529526+219398_43711880RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529526+219441_47511880RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529526+219476_51611880RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529526+219534_57311880RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529526+219583_62411880RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529526+219653_69311880RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529526+219700_73911880RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529526+219740_78011880RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529526+219781_82611880RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529873+118358_39511888RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529873+118398_43711888RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529873+118441_47511888RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529873+118476_51611888RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529873+118534_57311888RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529873+118583_62411888RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529873+118653_69311888RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529873+118700_73911888RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529873+118740_78011888RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529873+118781_82611888RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529986+017358_395-36833RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529986+017398_437-36833RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529986+017441_475-36833RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529986+017476_516-36833RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529986+017534_573-36833RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529986+017583_624-36833RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529986+017653_693-36833RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529986+017700_739-36833RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529986+017740_780-36833RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000529986+017781_826-36833RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530094+018358_395-36862RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530094+018398_437-36862RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530094+018441_475-36862RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530094+018476_516-36862RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530094+018534_573-36862RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530094+018583_624-36862RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530094+018653_693-36862RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530094+018700_739-36862RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530094+018740_780-36862RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530094+018781_826-36862RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530748+119358_39511886RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530748+119398_43711886RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530748+119441_47511886RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530748+119476_51611886RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530748+119534_57311886RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530748+119583_62411886RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530748+119653_69311886RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530748+119700_73911886RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530748+119740_78011886RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000530748+119781_82611886RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000531014+015358_395-88640RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000531014+015398_437-88640RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000531014+015441_475-88640RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000531014+015476_516-88640RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000531014+015534_573-88640RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000531014+015583_624-88640RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000531014+015653_693-88640RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000531014+015700_739-88640RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000531014+015740_780-88640RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000531014+015781_826-88640RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532245+016358_395-96833RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532245+016398_437-96833RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532245+016441_475-96833RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532245+016476_516-96833RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532245+016534_573-96833RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532245+016583_624-96833RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532245+016653_693-96833RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532245+016700_739-96833RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532245+016740_780-96833RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532245+016781_826-96833RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532463+017358_395-36833RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532463+017398_437-36833RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532463+017441_475-36833RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532463+017476_516-36833RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532463+017534_573-36833RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532463+017583_624-36833RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532463+017653_693-36833RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532463+017700_739-36833RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532463+017740_780-36833RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532463+017781_826-36833RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532649+219358_39511880RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532649+219398_43711880RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532649+219441_47511880RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532649+219476_51611880RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532649+219534_57311880RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532649+219583_62411880RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532649+219653_69311880RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532649+219700_73911880RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532649+219740_78011880RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532649+219781_82611880RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532787+017358_395-36841RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532787+017398_437-36841RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532787+017441_475-36841RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532787+017476_516-36841RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532787+017534_573-36841RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532787+017583_624-36841RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532787+017653_693-36841RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532787+017700_739-36841RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532787+017740_780-36841RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532787+017781_826-36841RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532844+120358_39511915RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532844+120398_43711915RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532844+120441_47511915RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532844+120476_51611915RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532844+120534_57311915RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532844+120583_62411915RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532844+120653_69311915RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532844+120700_73911915RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532844+120740_78011915RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000532844+120781_82611915RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000533667+014358_395-88619RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000533667+014398_437-88619RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000533667+014441_475-88619RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000533667+014476_516-88619RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000533667+014534_573-88619RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000533667+014583_624-88619RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000533667+014653_693-88619RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000533667+014700_739-88619RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000533667+014740_780-88619RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000533667+014781_826-88619RepeatNote=ARM 10
TgeneCTNND1chr11:57235563chr11:57561482ENST00000534579+219358_39511880RepeatNote=ARM 1
TgeneCTNND1chr11:57235563chr11:57561482ENST00000534579+219398_43711880RepeatNote=ARM 2
TgeneCTNND1chr11:57235563chr11:57561482ENST00000534579+219441_47511880RepeatNote=ARM 3
TgeneCTNND1chr11:57235563chr11:57561482ENST00000534579+219476_51611880RepeatNote=ARM 4
TgeneCTNND1chr11:57235563chr11:57561482ENST00000534579+219534_57311880RepeatNote=ARM 5
TgeneCTNND1chr11:57235563chr11:57561482ENST00000534579+219583_62411880RepeatNote=ARM 6
TgeneCTNND1chr11:57235563chr11:57561482ENST00000534579+219653_69311880RepeatNote=ARM 7
TgeneCTNND1chr11:57235563chr11:57561482ENST00000534579+219700_73911880RepeatNote=ARM 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000534579+219740_78011880RepeatNote=ARM 9
TgeneCTNND1chr11:57235563chr11:57561482ENST00000534579+219781_82611880RepeatNote=ARM 10

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000335099+23261_312171421DomainNote=LRRCT
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000395120+23261_312171194DomainNote=LRRCT
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000335099+23156_177171421RepeatNote=LRR 5
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000335099+23180_201171421RepeatNote=LRR 6
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000335099+23204_225171421RepeatNote=LRR 7
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000335099+23228_249171421RepeatNote=LRR 8
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000395120+23156_177171194RepeatNote=LRR 5
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000395120+23180_201171194RepeatNote=LRR 6
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000395120+23204_225171194RepeatNote=LRR 7
HgeneRTN4RL2chr11:57235563chr11:57561482ENST00000395120+23228_249171194RepeatNote=LRR 8
TgeneCTNND1chr11:57235563chr11:57561482ENST00000358694+21910_4665934Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000360682+22010_4665948Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361332+22010_4665963Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361391+21910_4665942Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000361796+21910_4665934Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000399050+22110_4665969Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000428599+11810_4665934Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000524630+21910_4665934Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr11:57235563chr11:57561482ENST00000526938+11810_4665919Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for RTN4RL2_CTNND1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000524630_chr11_57561482_+_1040aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRSALRQEK
ALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQ
GIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDKKPDREEIQM

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000529919_chr11_57561482_+_1045aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRS
ALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAK
KLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDKKPD

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000399039_chr11_57561482_+_1045aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRS
ALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAK
KLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDKKPD

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000360682_chr11_57561482_+_1054aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRS
ALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAK
KLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDNNTS

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000361796_chr11_57561482_+_1040aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRSALRQEK
ALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQ
GIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDKKPDREEIQM

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000361391_chr11_57561482_+_1048aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRSALRQEK
ALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQ
GIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDNNTSTPNERG

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000524630_chr11_57561482_+_1040aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRSALRQEK
ALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQ
GIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDKKPDREEIQM

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000529919_chr11_57561482_+_1045aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRS
ALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAK
KLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDKKPD

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000399039_chr11_57561482_+_1045aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRS
ALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAK
KLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDKKPD

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000360682_chr11_57561482_+_1054aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRS
ALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAK
KLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDNNTS

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000361796_chr11_57561482_+_1040aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRSALRQEK
ALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQ
GIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDKKPDREEIQM

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000361391_chr11_57561482_+_1048aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRSALRQEK
ALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQ
GIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDNNTSTPNERG

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000524630_chr11_57561482_+_1040aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRSALRQEK
ALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQ
GIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDKKPDREEIQM

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000529919_chr11_57561482_+_1045aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRS
ALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAK
KLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDKKPD

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000399039_chr11_57561482_+_1045aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRS
ALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAK
KLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDKKPD

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000360682_chr11_57561482_+_1054aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRS
ALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAK
KLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDNNTS

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000361796_chr11_57561482_+_1040aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRSALRQEK
ALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQ
GIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDKKPDREEIQM

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000361391_chr11_57561482_+_1048aa
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLF
SNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQNGRFVGDAD
LERQKFSDLKLNGPQDHSHLLTSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLP
VDASSVSNNTIQTLGRDFRKNGNGGPGPTVGQAGTATLPRNFHYPPDGTSRHTEDGTPGGSDNTGSLSRVTRIEERTRPSMEGYRAPSRQ
DVTGPQPQVRVGGSSVDLHRFHPEPTGLEDDQRSMGTDDLDTGMMSDTGTARRTGTPSDPRRRLRSTEDMIGEEVPSDQYYWAPLAQHER
GSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKN
ISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWE
SVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSTQVHREIPQAERYQEAAPNVANNTGPH
AASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGTELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTTGRYIRSALRQEK
ALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQ
GIEKLVLINKSGNRSEKEVRAAALVLQTIWGTKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSTDDSTLPLIDRNQKSDNNTSTPNERG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000524630_chr11_57561482_+_3120nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000529919_chr11_57561482_+_3135nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTG
GATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAG
AGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCT
GCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTG
AGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAG
AACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAA
AAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTT
GTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAAC
AATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGAT
CGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAAT

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000399039_chr11_57561482_+_3135nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTG
GATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAG
AGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCT
GCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTG
AGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAG
AACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAA
AAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTT
GTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAAC
AATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGAT
CGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAAT

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000360682_chr11_57561482_+_3162nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTG
GATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAG
AGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCT
GCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTG
AGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAG
AACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAA
AAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTT
GTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAAC
AATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCC
ACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTG
ATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATG

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000361796_chr11_57561482_+_3120nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000361391_chr11_57561482_+_3144nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGA
GACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAG

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000524630_chr11_57561482_+_3120nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000529919_chr11_57561482_+_3135nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTG
GATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAG
AGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCT
GCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTG
AGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAG
AACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAA
AAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTT
GTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAAC
AATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGAT
CGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAAT

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000399039_chr11_57561482_+_3135nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTG
GATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAG
AGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCT
GCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTG
AGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAG
AACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAA
AAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTT
GTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAAC
AATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGAT
CGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAAT

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000360682_chr11_57561482_+_3162nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTG
GATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAG
AGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCT
GCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTG
AGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAG
AACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAA
AAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTT
GTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAAC
AATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCC
ACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTG
ATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATG

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000361796_chr11_57561482_+_3120nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000361391_chr11_57561482_+_3144nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGA
GACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAG

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000524630_chr11_57561482_+_3120nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000529919_chr11_57561482_+_3135nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTG
GATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAG
AGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCT
GCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTG
AGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAG
AACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAA
AAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTT
GTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAAC
AATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGAT
CGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAAT

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000399039_chr11_57561482_+_3135nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTG
GATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAG
AGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCT
GCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTG
AGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAG
AACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAA
AAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTT
GTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAAC
AATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGAT
CGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAAT

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000360682_chr11_57561482_+_3162nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTG
GATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAG
AGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCT
GCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTG
AGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAG
AACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAA
AAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTT
GTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAAC
AATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCC
ACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTG
ATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATG

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000361796_chr11_57561482_+_3120nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000361391_chr11_57561482_+_3144nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGA
GACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000524630_chr11_57561482_+_6675nt
TGGGCACACGGACAGACGGACTGACGGACTCTCGAGCGGACAGCGCAGCTAGCGGGGCGCGGGCGCTGGGCGTCGACGGCCAGCCCCAGC
CTTCCCCGCCCCGTCGCGCCCCGCCCCGTCCCGTCGGGGCCGATGGCTCCTCCCGAGGCCCGCAGCCCGGGCGGCGCAGGGTAGAGCGCC
GCGGCCCGGCCACGCAGCCCGGGGACTCCCGGGCCCTCCCGGAGCCCCGCGGGGTCCCCGCCGTGCATCCGGCGGGCTCAGGGAGCGAGT
GGGAGCGCCCTCCCCCCGCTGCCCCCTCCCCCGAGCATCGAGACAAGATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGG
CCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGCTGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGA
GCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCCAGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGC
TGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTCTCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACT
TGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGCTCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGT
CGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATCTTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGA
ACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGACCTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCC
AGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAGCCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGG
GAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACTCGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGA
CAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCTGTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGG
GTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTGGGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACC
CTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGCAGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGG
AGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAGGATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCA
GCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGATGACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGA
TGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCTCGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGG
TGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGAGGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTC
CACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATGCTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCAT
ACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTGCGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACC
ATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAATATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAA
ACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGTGATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATC
TTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTGCATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGG
AGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAATCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCT
CAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTAGTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGA
AGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGGAACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGC
GTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACATGCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAAC
CTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGG
TTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGC
GCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAAC
GGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACT
TGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGG
TTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCT
CAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGA
AGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACC
GGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATT
CCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCT
TGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTC
CTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAA
CTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCA
TATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAG
GAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCA
AGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTG
AAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACC
TTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTG
CTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTA
GAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGT
AGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTC
TGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGC
CTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTT
GCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATT
GAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAAT
CTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGG
GAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAG
CTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCC
ATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCT
TTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTT
TTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTG
CTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTT
TTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTC
CATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTG
GGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAG
AGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCAACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACA
TTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAACATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCAT
AAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTTGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCT
CTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCCAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTAT
ATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTT
ACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGATCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGT
CCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAATGCTTTCTGTATGCCCAAATCTTTAGATTAAAATTATATAGC
TGCTCCTGATGATGGTCCTGTCTTGTTTTATTGAACTAGGACTTGGGTATGAAAACTTTCATGGGCTAGTGAGACCAGGAAATCAACTAG
CTTTTAAAGCTTGATTTGTGTCTAACAATTGTAGTGTTAGATTAGAGGTTGAAGTACAAAGCCAAAAAGCTATTAAGAGTTTACTTTCCA
AAGAGTTTTGATAGCCCTGCTTGAGATGATTTTTATCTAAATAGAAAAGCCTGGCTGCTTGTCAGCAACACTTTATTTCCCTGTTATGTT
CTTATCCTTTGGCATTGAGCTAGATACAAACCCTACTCTTCTCTCTTCCTTCTGGATTGGTCCATTTGTTTATCTCATTCAATAAATATT

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000529919_chr11_57561482_+_5084nt
TGGGCACACGGACAGACGGACTGACGGACTCTCGAGCGGACAGCGCAGCTAGCGGGGCGCGGGCGCTGGGCGTCGACGGCCAGCCCCAGC
CTTCCCCGCCCCGTCGCGCCCCGCCCCGTCCCGTCGGGGCCGATGGCTCCTCCCGAGGCCCGCAGCCCGGGCGGCGCAGGGTAGAGCGCC
GCGGCCCGGCCACGCAGCCCGGGGACTCCCGGGCCCTCCCGGAGCCCCGCGGGGTCCCCGCCGTGCATCCGGCGGGCTCAGGGAGCGAGT
GGGAGCGCCCTCCCCCCGCTGCCCCCTCCCCCGAGCATCGAGACAAGATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGG
CCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGCTGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGA
GCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCCAGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGC
TGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTCTCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACT
TGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGCTCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGT
CGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATCTTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGA
ACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGACCTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCC
AGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAGCCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGG
GAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACTCGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGA
CAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCTGTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGG
GTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTGGGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACC
CTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGCAGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGG
AGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAGGATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCA
GCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGATGACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGA
TGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCTCGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGG
TGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGAGGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTC
CACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATGCTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCAT
ACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTGCGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACC
ATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAATATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAA
ACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGTGATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATC
TTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTGCATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGG
AGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAATCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCT
CAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTAGTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGA
AGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGGAACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGC
GTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACATGCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGT
TCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCT
TATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCC
AGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCC
TGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTA
AACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTT
TGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCA
ACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCAC
TGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTA
CTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAAT
CACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCAT
TGAAGGGAACAACACCCTTGATGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAAT
TGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTT
TCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTG
ACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAG
GGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACT
GACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCC
TAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAAC
TGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAAC
CCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCAT
TTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCT
CTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGG
CCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGAT
TGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTC
ATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAAC
CTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAAT
CCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTC
TGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTG
GGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATC

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000399039_chr11_57561482_+_5492nt
TGGGCACACGGACAGACGGACTGACGGACTCTCGAGCGGACAGCGCAGCTAGCGGGGCGCGGGCGCTGGGCGTCGACGGCCAGCCCCAGC
CTTCCCCGCCCCGTCGCGCCCCGCCCCGTCCCGTCGGGGCCGATGGCTCCTCCCGAGGCCCGCAGCCCGGGCGGCGCAGGGTAGAGCGCC
GCGGCCCGGCCACGCAGCCCGGGGACTCCCGGGCCCTCCCGGAGCCCCGCGGGGTCCCCGCCGTGCATCCGGCGGGCTCAGGGAGCGAGT
GGGAGCGCCCTCCCCCCGCTGCCCCCTCCCCCGAGCATCGAGACAAGATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGG
CCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGCTGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGA
GCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCCAGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGC
TGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTCTCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACT
TGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGCTCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGT
CGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATCTTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGA
ACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGACCTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCC
AGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAGCCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGG
GAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACTCGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGA
CAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCTGTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGG
GTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTGGGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACC
CTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGCAGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGG
AGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAGGATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCA
GCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGATGACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGA
TGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCTCGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGG
TGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGAGGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTC
CACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATGCTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCAT
ACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTGCGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACC
ATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAATATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAA
ACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGTGATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATC
TTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTGCATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGG
AGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAATCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCT
CAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTAGTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGA
AGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGGAACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGC
GTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACATGCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGT
TCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCT
TATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCC
AGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCC
TGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTA
AACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTT
TGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCA
ACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCAC
TGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTA
CTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAAT
CACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCAT
TGAAGGGAACAACACCCTTGATGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAAT
TGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTT
TCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTG
ACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAG
GGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACT
GACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCC
TAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAAC
TGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAAC
CCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCAT
TTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCT
CTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGG
CCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGAT
TGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTC
ATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAAC
CTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAAT
CCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTC
TGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTG
GGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATC
TAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAA
GGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTC
CTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTT
TCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTG
TTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTG

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000360682_chr11_57561482_+_6350nt
TGGGCACACGGACAGACGGACTGACGGACTCTCGAGCGGACAGCGCAGCTAGCGGGGCGCGGGCGCTGGGCGTCGACGGCCAGCCCCAGC
CTTCCCCGCCCCGTCGCGCCCCGCCCCGTCCCGTCGGGGCCGATGGCTCCTCCCGAGGCCCGCAGCCCGGGCGGCGCAGGGTAGAGCGCC
GCGGCCCGGCCACGCAGCCCGGGGACTCCCGGGCCCTCCCGGAGCCCCGCGGGGTCCCCGCCGTGCATCCGGCGGGCTCAGGGAGCGAGT
GGGAGCGCCCTCCCCCCGCTGCCCCCTCCCCCGAGCATCGAGACAAGATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGG
CCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGCTGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGA
GCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCCAGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGC
TGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTCTCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACT
TGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGCTCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGT
CGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATCTTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGA
ACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGACCTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCC
AGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAGCCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGG
GAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACTCGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGA
CAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCTGTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGG
GTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTGGGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACC
CTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGCAGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGG
AGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAGGATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCA
GCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGATGACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGA
TGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCTCGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGG
TGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGAGGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTC
CACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATGCTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCAT
ACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTGCGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACC
ATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAATATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAA
ACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGTGATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATC
TTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTGCATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGG
AGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAATCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCT
CAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTAGTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGA
AGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGGAACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGC
GTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACATGCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGT
TCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCT
TATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCC
AGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCC
TGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTA
AACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTT
TGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCA
ACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCAC
TGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTA
CTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGAT
CGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATG
TGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATA
TGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCC
CTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATT
CCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTG
GAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTAT
ATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGG
GGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACC
CTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTC
CATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTG
ATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAA
GATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCC
CGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCT
GTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCA
TGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGC
AGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAAC
AGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCT
TAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCA
CTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTAT
TTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTG
AGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATT
TCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCA
TCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAAC
AGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCC
CACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAA
ATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCT
TTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCA
ACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAAC
ATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTT
GACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCC
AACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCA
GTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGAT
CAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAA

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000361796_chr11_57561482_+_6308nt
TGGGCACACGGACAGACGGACTGACGGACTCTCGAGCGGACAGCGCAGCTAGCGGGGCGCGGGCGCTGGGCGTCGACGGCCAGCCCCAGC
CTTCCCCGCCCCGTCGCGCCCCGCCCCGTCCCGTCGGGGCCGATGGCTCCTCCCGAGGCCCGCAGCCCGGGCGGCGCAGGGTAGAGCGCC
GCGGCCCGGCCACGCAGCCCGGGGACTCCCGGGCCCTCCCGGAGCCCCGCGGGGTCCCCGCCGTGCATCCGGCGGGCTCAGGGAGCGAGT
GGGAGCGCCCTCCCCCCGCTGCCCCCTCCCCCGAGCATCGAGACAAGATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGG
CCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGCTGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGA
GCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCCAGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGC
TGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTCTCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACT
TGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGCTCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGT
CGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATCTTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGA
ACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGACCTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCC
AGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAGCCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGG
GAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACTCGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGA
CAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCTGTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGG
GTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTGGGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACC
CTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGCAGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGG
AGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAGGATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCA
GCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGATGACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGA
TGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCTCGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGG
TGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGAGGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTC
CACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATGCTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCAT
ACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTGCGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACC
ATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAATATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAA
ACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGTGATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATC
TTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTGCATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGG
AGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAATCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCT
CAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTAGTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGA
AGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGGAACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGC
GTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACATGCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAAC
CTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGG
TTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGC
GCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAAC
GGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACT
TGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGG
TTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCT
CAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGA
AGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACC
GGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATT
CCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCT
TGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTC
CTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAA
CTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCA
TATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAG
GAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCA
AGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTG
AAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACC
TTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTG
CTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTA
GAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGT
AGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTC
TGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGC
CTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTT
GCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATT
GAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAAT
CTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGG
GAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAG
CTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCC
ATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCT
TTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTT
TTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTG
CTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTT
TTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTC
CATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTG
GGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAG
AGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCAACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACA
TTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAACATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCAT
AAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTTGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCT
CTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCCAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTAT
ATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTT
ACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGATCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGT
CCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAATGCTTTCTGTATGCCCAAATCTTTAGATTAAAATTATATAGC

>In-frame_RTN4RL2_ENST00000335099_chr11_57235563_+_CTNND1_ENST00000361391_chr11_57561482_+_6331nt
TGGGCACACGGACAGACGGACTGACGGACTCTCGAGCGGACAGCGCAGCTAGCGGGGCGCGGGCGCTGGGCGTCGACGGCCAGCCCCAGC
CTTCCCCGCCCCGTCGCGCCCCGCCCCGTCCCGTCGGGGCCGATGGCTCCTCCCGAGGCCCGCAGCCCGGGCGGCGCAGGGTAGAGCGCC
GCGGCCCGGCCACGCAGCCCGGGGACTCCCGGGCCCTCCCGGAGCCCCGCGGGGTCCCCGCCGTGCATCCGGCGGGCTCAGGGAGCGAGT
GGGAGCGCCCTCCCCCCGCTGCCCCCTCCCCCGAGCATCGAGACAAGATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGG
CCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGCTGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGA
GCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCCAGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGC
TGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTCTCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACT
TGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGCTCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGT
CGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATCTTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGA
ACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGACCTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCC
AGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAGCCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGG
GAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACTCGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGA
CAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCTGTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGG
GTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTGGGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACC
CTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGCAGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGG
AGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAGGATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCA
GCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGATGACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGA
TGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCTCGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGG
TGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGAGGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTC
CACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATGCTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCAT
ACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTGCGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACC
ATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAATATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAA
ACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGTGATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATC
TTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTGCATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGG
AGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAATCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCT
CAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTAGTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGA
AGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGGAACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGC
GTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACATGCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAAC
CTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGG
TTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGC
GCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAAC
GGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACT
TGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGG
TTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCT
CAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGA
AGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACC
GGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACA
TGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATG
AGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGG
TGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGC
TGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCA
AGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGT
GGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTC
TGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTC
CCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTC
TCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCT
CATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGG
CCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGA
AGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTAT
CCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAA
GGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTC
TGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGAC
CGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTT
TGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTAC
CATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATT
AGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTT
AATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAGGCTATGGGGTAGGAGA
AAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTCTTCCCACTTTCATCTA
CCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACT
CTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGG
ACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCACCTTCCCACCGAACAC
TACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAATGAGTTTTTTATATAAA
TAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTTGCATCTTTGTTACTTC
CTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCAACTCTTTATCAAGCAACA
TTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAACATGGGAGCTTATTGCTAA
TTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTTGACAAAACTAACCTTGAA
TAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCCAACTACGTAATAGGAAAA
TGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGTCCTTTAGTCAGAAGTC
AATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGATCAAGGGTTAAGATCTATG
GGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAATGCTTTCTGTATGCCCAA

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000524630_chr11_57561482_+_6367nt
CGAGACAAGATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCG
GCCCCCAGCTGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCC
CTGCCACCCAGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTG
TGGCTCTTCTCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGG
CACCTGCGCTCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCC
GGCAACATCTTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGC
GATGCTGACCTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGG
ATGCAGGAGCCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGAT
GGGACCACTCGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGAC
GGGTTGCCTGTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGT
CCCTATGTGGGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTAT
CCAGGTGGCAGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCT
AGTAGACAGGATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGG
CTAGAGGATGACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCC
TCTGACCCTCGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAG
CATGAGCGAGGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTG
ATCGCCATGCTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAG
ACTGACGTGCGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCT
CTCAAGAATATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGA
AAGGCTCGTGATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGAC
CATGCACTGCATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATT
GAGTGGGAATCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGT
GATGGTTTAGTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGC
CTTCTTCGGAACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACT
GGGCCACATGCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCT
AAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACT
CCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGT
CAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTG
GCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCT
TGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGA
GAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAG
ACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCC
CGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAA
ATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTG
GATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATC
TGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCT
GCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCC
CTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCA
GTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTA
CATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCT
TTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTG
GCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAAC
CTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTC
CTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAA
GGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTC
CCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTA
CATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCC
CGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGC
CCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCT
TTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGAC
TCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTG
CCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCC
TTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCC
TTATATATTGAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCC
CCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAA
AATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGG
GTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAA
CCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTT
TTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTT
CTTCCCTGCTTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAG
CTCAGCCCCAACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCT
GAAGTTGAACATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTC
TGCAACATTTGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAAC
TACCAATCCCAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAG
GCTATATGCAGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTG
CTGCAGAGATCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAAT
TTATGTGAAATGCTTTCTGTATGCCCAAATCTTTAGATTAAAATTATATAGCTGCTCCTGATGATGGTCCTGTCTTGTTTTATTGAACTA
GGACTTGGGTATGAAAACTTTCATGGGCTAGTGAGACCAGGAAATCAACTAGCTTTTAAAGCTTGATTTGTGTCTAACAATTGTAGTGTT
AGATTAGAGGTTGAAGTACAAAGCCAAAAAGCTATTAAGAGTTTACTTTCCAAAGAGTTTTGATAGCCCTGCTTGAGATGATTTTTATCT
AAATAGAAAAGCCTGGCTGCTTGTCAGCAACACTTTATTTCCCTGTTATGTTCTTATCCTTTGGCATTGAGCTAGATACAAACCCTACTC

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000529919_chr11_57561482_+_4776nt
CGAGACAAGATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCG
GCCCCCAGCTGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCC
CTGCCACCCAGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTG
TGGCTCTTCTCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGG
CACCTGCGCTCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCC
GGCAACATCTTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGC
GATGCTGACCTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGG
ATGCAGGAGCCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGAT
GGGACCACTCGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGAC
GGGTTGCCTGTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGT
CCCTATGTGGGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTAT
CCAGGTGGCAGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCT
AGTAGACAGGATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGG
CTAGAGGATGACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCC
TCTGACCCTCGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAG
CATGAGCGAGGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTG
ATCGCCATGCTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAG
ACTGACGTGCGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCT
CTCAAGAATATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGA
AAGGCTCGTGATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGAC
CATGCACTGCATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATT
GAGTGGGAATCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGT
GATGGTTTAGTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGC
CTTCTTCGGAACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACT
GGGCCACATGCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAAC
GATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTT
CTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATAC
ATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCT
GGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGA
GGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAG
GCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCA
GCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTG
AATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAG
AAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGA
GACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGAAGATTTAGCACCAC
TATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGT
GCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTG
TCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGAT
TAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGG
AAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAG
GGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATT
GGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCA
GGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTC
CTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAG
ACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAG
TCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACT
AAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTG
GGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTC
TTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTT
CAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGA
AGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCC
CTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTAT
TATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCC

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000399039_chr11_57561482_+_5184nt
CGAGACAAGATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCG
GCCCCCAGCTGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCC
CTGCCACCCAGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTG
TGGCTCTTCTCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGG
CACCTGCGCTCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCC
GGCAACATCTTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGC
GATGCTGACCTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGG
ATGCAGGAGCCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGAT
GGGACCACTCGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGAC
GGGTTGCCTGTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGT
CCCTATGTGGGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTAT
CCAGGTGGCAGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCT
AGTAGACAGGATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGG
CTAGAGGATGACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCC
TCTGACCCTCGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAG
CATGAGCGAGGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTG
ATCGCCATGCTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAG
ACTGACGTGCGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCT
CTCAAGAATATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGA
AAGGCTCGTGATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGAC
CATGCACTGCATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATT
GAGTGGGAATCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGT
GATGGTTTAGTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGC
CTTCTTCGGAACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACT
GGGCCACATGCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAAC
GATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTT
CTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATAC
ATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCT
GGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGA
GGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAG
GCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCA
GCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTG
AATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAG
AAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGA
GACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGAAGATTTAGCACCAC
TATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGT
GCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTG
TCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGAT
TAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGG
AAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAG
GGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATT
GGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCA
GGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTC
CTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAG
ACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAG
TCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACT
AAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTG
GGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTC
TTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTT
CAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGA
AGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCC
CTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTAT
TATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCC
TCTCTTCCCCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGC
ACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTG
GGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATT
CCAGAGAACCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGT

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000360682_chr11_57561482_+_6042nt
CGAGACAAGATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCG
GCCCCCAGCTGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCC
CTGCCACCCAGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTG
TGGCTCTTCTCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGG
CACCTGCGCTCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCC
GGCAACATCTTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGC
GATGCTGACCTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGG
ATGCAGGAGCCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGAT
GGGACCACTCGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGAC
GGGTTGCCTGTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGT
CCCTATGTGGGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTAT
CCAGGTGGCAGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCT
AGTAGACAGGATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGG
CTAGAGGATGACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCC
TCTGACCCTCGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAG
CATGAGCGAGGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTG
ATCGCCATGCTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAG
ACTGACGTGCGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCT
CTCAAGAATATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGA
AAGGCTCGTGATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGAC
CATGCACTGCATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATT
GAGTGGGAATCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGT
GATGGTTTAGTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGC
CTTCTTCGGAACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACT
GGGCCACATGCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAAC
GATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTT
CTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATAC
ATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCT
GGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGA
GGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAG
GCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCA
GCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTG
AATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAC
AACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACA
ACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTAC
CCCTCCATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGAT
TTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTC
CCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATT
TGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGA
ATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTA
ATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATT
TTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGA
AACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATT
GCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGC
TGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGC
TAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTG
CCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCT
TTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAA
TTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTT
CATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGAT
GAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTA
CAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAA
TCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTG
TTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACC
CCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAG
CCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCT
TCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTC
TCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCT
GCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTA
TGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTT
CCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCAACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGA
AACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAACATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAA
GCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTTGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGT
AGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCCAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCAT
GTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATA
TTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGATCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTG
AGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAATGCTTTCTGTATGCCCAAATCTTTAGATTAAAATTATA

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000361796_chr11_57561482_+_6000nt
CGAGACAAGATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCG
GCCCCCAGCTGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCC
CTGCCACCCAGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTG
TGGCTCTTCTCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGG
CACCTGCGCTCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCC
GGCAACATCTTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGC
GATGCTGACCTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGG
ATGCAGGAGCCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGAT
GGGACCACTCGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGAC
GGGTTGCCTGTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGT
CCCTATGTGGGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTAT
CCAGGTGGCAGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCT
AGTAGACAGGATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGG
CTAGAGGATGACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCC
TCTGACCCTCGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAG
CATGAGCGAGGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTG
ATCGCCATGCTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAG
ACTGACGTGCGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCT
CTCAAGAATATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGA
AAGGCTCGTGATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGAC
CATGCACTGCATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATT
GAGTGGGAATCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGT
GATGGTTTAGTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGC
CTTCTTCGGAACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACT
GGGCCACATGCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCT
AAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACT
CCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGT
CAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTG
GCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCT
TGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGA
GAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAG
ACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCC
CGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAA
ATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTG
GATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATC
TGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCT
GCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCC
CTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCA
GTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTA
CATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCT
TTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTG
GCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAAC
CTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTC
CTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAA
GGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTC
CCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTA
CATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCC
CGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGC
CCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCT
TTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGAC
TCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTG
CCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCC
TTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCC
TTATATATTGAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCC
CCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAA
AATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGG
GTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAA
CCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTT
TTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTT
CTTCCCTGCTTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAG
CTCAGCCCCAACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCT
GAAGTTGAACATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTC
TGCAACATTTGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAAC
TACCAATCCCAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAG
GCTATATGCAGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTG
CTGCAGAGATCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAAT

>In-frame_RTN4RL2_ENST00000533205_chr11_57235563_+_CTNND1_ENST00000361391_chr11_57561482_+_6023nt
CGAGACAAGATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCG
GCCCCCAGCTGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCC
CTGCCACCCAGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTG
TGGCTCTTCTCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGG
CACCTGCGCTCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCC
GGCAACATCTTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGC
GATGCTGACCTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGG
ATGCAGGAGCCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGAT
GGGACCACTCGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGAC
GGGTTGCCTGTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGT
CCCTATGTGGGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTAT
CCAGGTGGCAGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCT
AGTAGACAGGATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGG
CTAGAGGATGACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCC
TCTGACCCTCGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAG
CATGAGCGAGGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTG
ATCGCCATGCTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAG
ACTGACGTGCGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCT
CTCAAGAATATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGA
AAGGCTCGTGATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGAC
CATGCACTGCATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATT
GAGTGGGAATCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGT
GATGGTTTAGTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGC
CTTCTTCGGAACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACT
GGGCCACATGCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCT
AAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACT
CCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGT
CAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTG
GCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCT
TGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGA
GAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAG
ACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCC
CGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAAT
GAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGAC
GAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATT
TAGCACCACTATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTG
GACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAA
GTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACT
GCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGA
AGCCGTGGGAAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTG
ATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCC
AGCAACATTGGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATC
TCCAAGGCAGGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACA
CAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATG
TCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGA
AGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGT
TGGCAAACTAAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCC
TTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTT
GTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAG
CCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCT
GGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCC
AATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTT
GATTATTATTATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTT
CCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTA
AAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGAC
CCTAAGAGCACACTGCACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTG
CTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAA
CACTAAACATTCAATTCCAGAGAACCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCT
TTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCA
TTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGA
GGTTATACCAGGATTTATTTTGAGCTCAGCCCCAACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAA
GATTCTTAAAAATTGAATGTGGCTGAAGTTGAACATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGAC
TTACTTTAATTACTGGAATTCTTCTGCAACATTTGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAAC
ACTTAGGACTAGAAGATTAGAAACTACCAATCCCAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCA
CTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTAC
CTGGATTACCAGGGACTATCTTTGCTGCAGAGATCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTC

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000524630_chr11_57561482_+_6358nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA
ATGCTTTCTGTATGCCCAAATCTTTAGATTAAAATTATATAGCTGCTCCTGATGATGGTCCTGTCTTGTTTTATTGAACTAGGACTTGGG
TATGAAAACTTTCATGGGCTAGTGAGACCAGGAAATCAACTAGCTTTTAAAGCTTGATTTGTGTCTAACAATTGTAGTGTTAGATTAGAG
GTTGAAGTACAAAGCCAAAAAGCTATTAAGAGTTTACTTTCCAAAGAGTTTTGATAGCCCTGCTTGAGATGATTTTTATCTAAATAGAAA
AGCCTGGCTGCTTGTCAGCAACACTTTATTTCCCTGTTATGTTCTTATCCTTTGGCATTGAGCTAGATACAAACCCTACTCTTCTCTCTT

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000529919_chr11_57561482_+_4767nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTG
GATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAG
AGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCT
GCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTG
AGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAG
AACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAA
AAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTT
GTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAAC
AATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGAT
CGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAAT
AGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGAAGATTTAGCACCACTATCTCCGT
TCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGC
CAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGC
CTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTT
TTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGG
AAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTA
TTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGC
CACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATC
AAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCA
CCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGT
AGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACT
GGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTT
GATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATC
TCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACT
ATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAG
CAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGG
TGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCA
GTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTC

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000399039_chr11_57561482_+_5175nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTG
GATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAG
AGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCT
GCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTG
AGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAG
AACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAA
AAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTT
GTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAAC
AATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGAT
CGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAAT
AGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGAAGATTTAGCACCACTATCTCCGT
TCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGC
CAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGC
CTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTT
TTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGG
AAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTA
TTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGC
CACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATC
AAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCA
CCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGT
AGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACT
GGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTT
GATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATC
TCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACT
ATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAG
CAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGG
TGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCA
GTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTC
TAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCC
CTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAA
ATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGG
TAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAAC
CAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTT

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000360682_chr11_57561482_+_6033nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCCAGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTG
GATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAG
AGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCT
GCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTG
AGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAG
AACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAA
AAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTT
GTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAAC
AATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCC
ACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTG
ATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATG
CAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTT
TCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCT
TCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTT
TGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATC
TTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATT
TTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCA
AAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCT
CTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCC
CCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAG
GGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAA
TGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCC
TGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTT
CTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAA
TTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGA
TTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAA
AGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGT
GGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCT
ATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCA
ACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACT
CGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCT
CTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTT
TTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTT
TATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATAC
CTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGG
TCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAA
CCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCAACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTT
TCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAACATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGA
ATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTTGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTT
AAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCCAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAG
TACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGA
CCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGATCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTA
TGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAATGCTTTCTGTATGCCCAAATCTTTAGATTAAAATTATATAGCTGCTC

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000361796_chr11_57561482_+_5991nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_RTN4RL2_ENST00000395120_chr11_57235563_+_CTNND1_ENST00000361391_chr11_57561482_+_6014nt
ATGCTGCCCGGGCTCAGGCGCCTGCTGCAAGCTCCCGCCTCGGCCTGCCTCCTGCTGATGCTCCTGGCCCTGCCCCTGGCGGCCCCCAGC
TGCCCCATGCTCTGCACCTGCTACTCATCCCCGCCCACCGTGAGCTGCCAGGCCAACAACTTCTCCTCTGTGCCGCTGTCCCTGCCACCC
AGCACTCAGCGACTCTTCCTGCAGAACAACCTCATCCGCACGCTGCGGCCAGGCACCTTTGGGTCCAACCTGCTCACCCTGTGGCTCTTC
TCCAACAACCTCTCCACCATCTACCCGGGCACTTTCCGCCACTTGCAAGCCCTGGAGGAGCTGGACCTCGGTGACAACCGGCACCTGCGC
TCGCTGGAGCCCGACACCTTCCAGGGCCTGGAGCGGCTGCAGTCGCTGCATTTGTACCGCTGCCAGCTCAGCAGCCTGCCCGGCAACATC
TTCCGAGGCCTGGTCAGCCTGCAGTACCTCTACCTCCAGGAGAACAGCCTGCTCCACCTACAGAACGGCCGGTTTGTGGGCGATGCTGAC
CTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACCTTCTATATAGCACCATCCCCAGGATGCAGGAG
CCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCCTGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACT
CGGCGCACAGAGACCACGGTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGCCT
GTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAATGGGGGACCTGGTCCCTATGTG
GGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCTGATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGC
AGTGATAACTATGGCAGTCTGTCCCGGGTGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAG
GATGTGTATGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTATGGGCTAGAGGAT
GACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCACTGCCCGTCGGACTGGGACACCCTCTGACCCT
CGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGAGGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGA
GGAAGTTTAGCAAGCTTGGATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCATG
CTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAATGACAAGGTGAAGACTGACGTG
CGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCCAAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAAT
ATCTCTTTTGGACGTGACCAGGATAACAAGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGT
GATATGGACCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTGGACCATGCACTG
CATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATGAAGACTGTAAGCCACGCCACATTGAGTGGGAA
TCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGTAAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTA
GTTGATGCCCTCATTTTCATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTCGG
AACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGTTGCCAACAATACTGGGCCACAT
GCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGA
GACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAG
GAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCAC
TATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGT
GCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTG
TCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGAT
TAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGG
AAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAG
GGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATT
GGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCA
GGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTC
CTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAG
ACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAG
TCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACT
AAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTG
GGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTC
TTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTT
CAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGA
AGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCC
CTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTAT
TATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCC
TCTCTTCCCCTTCCCTTATATATTGAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTT
ATTTACCCTTTTCCCCCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGC
ACACTGCACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTT
CTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACA
TTCAATTCCAGAGAACCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCT
GTCTTGTTAATGCTTTTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCAC
TTCAAGCTGTTATTTCTTCCCTGCTTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACC
AGGATTTATTTTGAGCTCAGCCCCAACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAA
AAATTGAATGTGGCTGAAGTTGAACATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAA
TTACTGGAATTCTTCTGCAACATTTGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGAC
TAGAAGATTAGAAACTACCAATCCCAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCAT
AATGTTGCTTCTCAGGCTATATGCAGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTAC
CAGGGACTATCTTTGCTGCAGAGATCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTA


Top

FusionGenePPI for RTN4RL2_CTNND1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RTN4RL2LGALS3, NRROSCTNND1CDH1, CTNNB1, EGFR, CTNNA1, CDH2, ACTG1, CTTN, FYN, LCK, SRC, YES1, PTPRJ, ZBTB33, CDH3, CDH5, MUC1, PSEN1, PTPN6, PTPRM, COL17A1, ERBB2IP, WDR48, SQSTM1, SNCA, RIPK3, ARRB2, CUL3, CSNK1E, APP, VCP, MYC, ATF2, SOX2, ATP4A, AP2M1, AURKA, KCTD6, NXF1, CCDC8, BMI1, SUMO2, NTRK1, IFI16, CEP135, TMEM17, TMEM216, XPO1, PPP4R1, FOXB1, MCM2, CDC5L, OTUB1, PPAP2B, BTRC, GSK3B, CTDSPL, MTMR7, CDH8, CTNNA3, G3BP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RTN4RL2_CTNND1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RTN4RL2_CTNND1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource