FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32352

FusionGeneSummary for RTN3_CSMD1

check button Fusion gene summary
Fusion gene informationFusion gene name: RTN3_CSMD1
Fusion gene ID: 32352
HgeneTgene
Gene symbol

RTN3

CSMD1

Gene ID

10313

64478

Gene namereticulon 3CUB and Sushi multiple domains 1
SynonymsASYIP|HAP|NSPL2|NSPLII|RTN3-A1PPP1R24
Cytomap

11q13.1

8p23.2

Type of geneprotein-codingprotein-coding
Descriptionreticulon-3ASY interacting proteinNSP-like protein 2NSP-like protein IIhomolog of ASY proteinneuroendocrine-specific protein-like 2neuroendocrine-specific protein-like IICUB and sushi domain-containing protein 1protein phosphatase 1, regulatory subunit 24
Modification date2018052220180520
UniProtAcc

O95197

Ensembl transtripts involved in fusion geneENST00000341307, ENST00000356000, 
ENST00000538995, ENST00000377819, 
ENST00000339997, ENST00000540798, 
ENST00000537981, ENST00000354497, 
ENST00000602723, ENST00000400186, 
ENST00000520002, ENST00000602557, 
ENST00000537824, ENST00000542608, 
ENST00000539096, ENST00000523387, 
Fusion gene scores* DoF score7 X 3 X 4=8410 X 9 X 6=540
# samples 810
** MAII scorelog2(8/84*10)=-0.070389327891398
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/540*10)=-2.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RTN3 [Title/Abstract] AND CSMD1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRTN3

GO:0071787

endoplasmic reticulum tubular network formation

25612671


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-AC-A2QH-01BRTN3chr11

63449250

+CSMD1chr8

3855632

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000341307ENST00000602723RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000341307ENST00000400186RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000341307ENST00000520002RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000341307ENST00000602557RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000341307ENST00000537824RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000341307ENST00000542608RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000341307ENST00000539096RTN3chr11

63449250

+CSMD1chr8

3855632

-
5CDS-intronENST00000341307ENST00000523387RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000356000ENST00000602723RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000356000ENST00000400186RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000356000ENST00000520002RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000356000ENST00000602557RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000356000ENST00000537824RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000356000ENST00000542608RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000356000ENST00000539096RTN3chr11

63449250

+CSMD1chr8

3855632

-
5CDS-intronENST00000356000ENST00000523387RTN3chr11

63449250

+CSMD1chr8

3855632

-
3UTR-3CDSENST00000538995ENST00000602723RTN3chr11

63449250

+CSMD1chr8

3855632

-
3UTR-3CDSENST00000538995ENST00000400186RTN3chr11

63449250

+CSMD1chr8

3855632

-
3UTR-3CDSENST00000538995ENST00000520002RTN3chr11

63449250

+CSMD1chr8

3855632

-
3UTR-3CDSENST00000538995ENST00000602557RTN3chr11

63449250

+CSMD1chr8

3855632

-
3UTR-3CDSENST00000538995ENST00000537824RTN3chr11

63449250

+CSMD1chr8

3855632

-
3UTR-3CDSENST00000538995ENST00000542608RTN3chr11

63449250

+CSMD1chr8

3855632

-
3UTR-3CDSENST00000538995ENST00000539096RTN3chr11

63449250

+CSMD1chr8

3855632

-
3UTR-intronENST00000538995ENST00000523387RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000377819ENST00000602723RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000377819ENST00000400186RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000377819ENST00000520002RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000377819ENST00000602557RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000377819ENST00000537824RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000377819ENST00000542608RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000377819ENST00000539096RTN3chr11

63449250

+CSMD1chr8

3855632

-
5CDS-intronENST00000377819ENST00000523387RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000339997ENST00000602723RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000339997ENST00000400186RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000339997ENST00000520002RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000339997ENST00000602557RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000339997ENST00000537824RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000339997ENST00000542608RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000339997ENST00000539096RTN3chr11

63449250

+CSMD1chr8

3855632

-
5CDS-intronENST00000339997ENST00000523387RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000540798ENST00000602723RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000540798ENST00000400186RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000540798ENST00000520002RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000540798ENST00000602557RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000540798ENST00000537824RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000540798ENST00000542608RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000540798ENST00000539096RTN3chr11

63449250

+CSMD1chr8

3855632

-
5CDS-intronENST00000540798ENST00000523387RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000537981ENST00000602723RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000537981ENST00000400186RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000537981ENST00000520002RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000537981ENST00000602557RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000537981ENST00000537824RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000537981ENST00000542608RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000537981ENST00000539096RTN3chr11

63449250

+CSMD1chr8

3855632

-
5CDS-intronENST00000537981ENST00000523387RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000354497ENST00000602723RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000354497ENST00000400186RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000354497ENST00000520002RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000354497ENST00000602557RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000354497ENST00000537824RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000354497ENST00000542608RTN3chr11

63449250

+CSMD1chr8

3855632

-
In-frameENST00000354497ENST00000539096RTN3chr11

63449250

+CSMD1chr8

3855632

-
5CDS-intronENST00000354497ENST00000523387RTN3chr11

63449250

+CSMD1chr8

3855632

-

Top

FusionProtFeatures for RTN3_CSMD1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RTN3

O95197

CSMD1

Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRTN3chr11:63449250chr8:3855632ENST00000339997+18844_1032471014DomainReticulon
HgeneRTN3chr11:63449250chr8:3855632ENST00000341307+16844_103247242DomainReticulon
HgeneRTN3chr11:63449250chr8:3855632ENST00000354497+14844_103247215DomainReticulon
HgeneRTN3chr11:63449250chr8:3855632ENST00000356000+18844_103247256DomainReticulon
HgeneRTN3chr11:63449250chr8:3855632ENST00000377819+19844_1032471033DomainReticulon
HgeneRTN3chr11:63449250chr8:3855632ENST00000537981+17844_103247237DomainReticulon
HgeneRTN3chr11:63449250chr8:3855632ENST00000540798+18844_103247921DomainReticulon
HgeneRTN3chr11:63449250chr8:3855632ENST00000339997+18864_887471014IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000339997+18948_968471014IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000339997+18973_993471014IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000341307+16864_88747242IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000341307+16948_96847242IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000341307+16973_99347242IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000354497+14864_88747215IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000354497+14948_96847215IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000354497+14973_99347215IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000356000+18864_88747256IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000356000+18948_96847256IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000356000+18973_99347256IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000377819+19864_887471033IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000377819+19948_968471033IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000377819+19973_993471033IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000537981+17864_88747237IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000537981+17948_96847237IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000537981+17973_99347237IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000540798+18864_88747921IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000540798+18948_96847921IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000540798+18973_99347921IntramembraneHelical
HgeneRTN3chr11:63449250chr8:3855632ENST00000339997+182_863471014Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000339997+18888_947471014Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000339997+18969_972471014Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000339997+18994_1032471014Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000341307+162_86347242Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000341307+16888_94747242Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000341307+16969_97247242Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000341307+16994_103247242Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000354497+142_86347215Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000354497+14888_94747215Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000354497+14969_97247215Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000354497+14994_103247215Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000356000+182_86347256Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000356000+18888_94747256Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000356000+18969_97247256Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000356000+18994_103247256Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000377819+192_863471033Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000377819+19888_947471033Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000377819+19969_972471033Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000377819+19994_1032471033Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000537981+172_86347237Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000537981+17888_94747237Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000537981+17969_97247237Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000537981+17994_103247237Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000540798+182_86347921Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000540798+18888_94747921Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000540798+18969_97247921Topological domainCytoplasmic
HgeneRTN3chr11:63449250chr8:3855632ENST00000540798+18994_103247921Topological domainCytoplasmic


Top

FusionGeneSequence for RTN3_CSMD1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_3409aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL
AGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNT
GYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLA
ISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSC
EMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIIS
CGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDG
YQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTC
PDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGF
FLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPVE
LKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSSG

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_3232aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCV
PITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSIL
YHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTG
NNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYSC
MDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAH
NTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCH
PGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEAS
PVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGT

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_1954aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_3409aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL
AGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNT
GYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLA
ISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSC
EMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIIS
CGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDG
YQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTC
PDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGF
FLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPVE
LKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSSG

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_3232aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCV
PITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSIL
YHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTG
NNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYSC
MDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAH
NTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCH
PGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEAS
PVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGT

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_1954aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_3409aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL
AGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNT
GYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLA
ISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSC
EMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIIS
CGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDG
YQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTC
PDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGF
FLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPVE
LKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSSG

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_3232aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCV
PITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSIL
YHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTG
NNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYSC
MDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAH
NTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCH
PGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEAS
PVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGT

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_1954aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_3409aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL
AGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNT
GYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLA
ISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSC
EMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIIS
CGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDG
YQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTC
PDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGF
FLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPVE
LKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSSG

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_3232aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCV
PITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSIL
YHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTG
NNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYSC
MDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAH
NTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCH
PGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEAS
PVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGT

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_1954aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_3409aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL
AGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNT
GYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLA
ISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSC
EMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIIS
CGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDG
YQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTC
PDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGF
FLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPVE
LKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSSG

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_3232aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCV
PITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSIL
YHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTG
NNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYSC
MDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAH
NTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCH
PGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEAS
PVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGT

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_1954aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_3409aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL
AGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNT
GYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLA
ISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSC
EMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIIS
CGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDG
YQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTC
PDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGF
FLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPVE
LKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSSG

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_3232aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCV
PITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSIL
YHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTG
NNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYSC
MDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAH
NTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCH
PGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEAS
PVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGT

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_1954aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_3233aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVC
VPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSI
LYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCT
GNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYS
CMDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTC
HPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHG

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_3410aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSP
NYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGF
KAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYG
NNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCE
WIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHG
KGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLR
TRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDT
EMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFL
HIYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYK
ILDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTH
AQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQG
STALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVT
APRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFS
GTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETA
YSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTC
EAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRS
NQLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSC
GIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVL
LSCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCN
TGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFS
CEMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMD
GYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNT
CPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPG
FFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPV
ELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSS

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_3409aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL
AGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNT
GYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLA
ISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSC
EMGHQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIIS
CGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDG
YQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTC
PDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGF
FLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASPVE
LKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSSG

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_3232aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG
TDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAY
SSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCE
AQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSN
QLYLRWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLL
SCSPGYYLEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCV
PITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSIL
YHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTG
NNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYSC
MDGYQLSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAH
NTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCH
PGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEAS
PVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGT

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_1954aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTI
ALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSV
LSQGGVALVSDMCPDPGIPENGRRAGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPN
YPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGN
NMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEW
IIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDP
GIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGK
GVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
IGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRT
RSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFT
DTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTE
MAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTVTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLH
IYEGEDSNSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGYKI
LDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHA
QARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGS
TALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTA
PRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_10227nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTT
ACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTG
GCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGC
AATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATC
ACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACG
GGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGT
TCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCAT
TGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCT
ATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGA
GGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAAT
CCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGT
GAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTG
TCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGG
GAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGT
TGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGC
TATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTG
TGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGT
TACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGA
GACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATA
CTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGC
CCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGC
TACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGA
CAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTT
TTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGA
GAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGG
AAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAG
CTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGC
AAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGA
AAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGC
TCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAA
GTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACA

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_9696nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTAC
CAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTC
CCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGC
AACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTG
AACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTG
TACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGT
TTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCC
TGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGA
AATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTC
TCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAG
GCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGC
ATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTG
TTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCT
CCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCAT
AACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGC
AGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCAT
GCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCAT
CCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAA
GGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAA
TATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCG
CCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATT
TTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGAC
ATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACC
AGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACG
AGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTA

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_5862nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGGAGGATCTGGAAACATTGGTCCTGCTTTCCCATGTCTTGACACCCCATTCCAAGCCAGATGTCAAGGAGAAGAAAGG

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_10227nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTT
ACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTG
GCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGC
AATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATC
ACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACG
GGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGT
TCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCAT
TGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCT
ATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGA
GGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAAT
CCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGT
GAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTG
TCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGG
GAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGT
TGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGC
TATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTG
TGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGT
TACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGA
GACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATA
CTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGC
CCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGC
TACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGA
CAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTT
TTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGA
GAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGG
AAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAG
CTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGC
AAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGA
AAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGC
TCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAA
GTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACA

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_9696nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTAC
CAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTC
CCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGC
AACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTG
AACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTG
TACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGT
TTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCC
TGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGA
AATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTC
TCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAG
GCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGC
ATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTG
TTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCT
CCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCAT
AACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGC
AGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCAT
GCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCAT
CCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAA
GGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAA
TATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCG
CCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATT
TTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGAC
ATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACC
AGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACG
AGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTA

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_5862nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGGAGGATCTGGAAACATTGGTCCTGCTTTCCCATGTCTTGACACCCCATTCCAAGCCAGATGTCAAGGAGAAGAAAGG

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_10227nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTT
ACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTG
GCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGC
AATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATC
ACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACG
GGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGT
TCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCAT
TGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCT
ATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGA
GGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAAT
CCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGT
GAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTG
TCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGG
GAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGT
TGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGC
TATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTG
TGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGT
TACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGA
GACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATA
CTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGC
CCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGC
TACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGA
CAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTT
TTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGA
GAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGG
AAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAG
CTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGC
AAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGA
AAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGC
TCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAA
GTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACA

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_9696nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTAC
CAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTC
CCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGC
AACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTG
AACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTG
TACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGT
TTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCC
TGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGA
AATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTC
TCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAG
GCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGC
ATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTG
TTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCT
CCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCAT
AACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGC
AGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCAT
GCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCAT
CCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAA
GGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAA
TATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCG
CCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATT
TTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGAC
ATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACC
AGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACG
AGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTA

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_5862nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGGAGGATCTGGAAACATTGGTCCTGCTTTCCCATGTCTTGACACCCCATTCCAAGCCAGATGTCAAGGAGAAGAAAGG

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_10227nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTT
ACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTG
GCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGC
AATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATC
ACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACG
GGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGT
TCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCAT
TGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCT
ATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGA
GGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAAT
CCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGT
GAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTG
TCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGG
GAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGT
TGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGC
TATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTG
TGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGT
TACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGA
GACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATA
CTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGC
CCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGC
TACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGA
CAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTT
TTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGA
GAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGG
AAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAG
CTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGC
AAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGA
AAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGC
TCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAA
GTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACA

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_9696nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTAC
CAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTC
CCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGC
AACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTG
AACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTG
TACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGT
TTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCC
TGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGA
AATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTC
TCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAG
GCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGC
ATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTG
TTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCT
CCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCAT
AACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGC
AGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCAT
GCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCAT
CCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAA
GGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAA
TATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCG
CCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATT
TTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGAC
ATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACC
AGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACG
AGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTA

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_5862nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGGAGGATCTGGAAACATTGGTCCTGCTTTCCCATGTCTTGACACCCCATTCCAAGCCAGATGTCAAGGAGAAGAAAGG

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_10227nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTT
ACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTG
GCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGC
AATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATC
ACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACG
GGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGT
TCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCAT
TGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCT
ATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGA
GGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAAT
CCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGT
GAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTG
TCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGG
GAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGT
TGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGC
TATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTG
TGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGT
TACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGA
GACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATA
CTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGC
CCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGC
TACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGA
CAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTT
TTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGA
GAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGG
AAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAG
CTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGC
AAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGA
AAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGC
TCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAA
GTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACA

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_9696nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTAC
CAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTC
CCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGC
AACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTG
AACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTG
TACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGT
TTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCC
TGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGA
AATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTC
TCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAG
GCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGC
ATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTG
TTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCT
CCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCAT
AACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGC
AGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCAT
GCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCAT
CCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAA
GGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAA
TATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCG
CCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATT
TTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGAC
ATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACC
AGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACG
AGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTA

>In-frame_RTN3_ENST00000540798_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_5862nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGGAGGATCTGGAAACATTGGTCCTGCTTTCCCATGTCTTGACACCCCATTCCAAGCCAGATGTCAAGGAGAAGAAAGG

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_10227nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTT
ACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTG
GCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGC
AATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATC
ACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACG
GGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGT
TCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCAT
TGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCT
ATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGA
GGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAAT
CCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGT
GAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTG
TCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGG
GAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGT
TGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGC
TATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTG
TGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGT
TACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGA
GACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATA
CTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGC
CCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGC
TACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGA
CAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTT
TTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGA
GAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGG
AAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAG
CTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGC
AAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGA
AAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGC
TCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAA
GTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACA

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_9696nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTAC
CAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTC
CCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGC
AACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTG
AACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTG
TACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGT
TTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCC
TGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGA
AATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTC
TCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAG
GCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGC
ATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTG
TTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCT
CCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCAT
AACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGC
AGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCAT
GCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCAT
CCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAA
GGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAA
TATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCG
CCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATT
TTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGAC
ATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACC
AGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACG
AGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTA

>In-frame_RTN3_ENST00000537981_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_5862nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGGAGGATCTGGAAACATTGGTCCTGCTTTCCCATGTCTTGACACCCCATTCCAAGCCAGATGTCAAGGAGAAGAAAGG

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_9699nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTT
TACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGT
GTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACC
TGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTG
GTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATC
CTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAG
TGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTAC
TCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACA
GGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGC
TTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGT
GAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGC
TGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCT
GTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAA
TCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCT
CATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGG
TGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCT
CATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGC
CATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGT
AAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTAT
GAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCC
TCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGAT
ATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGT
GACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGC
ACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGA
ACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAAC

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_10230nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGT
AGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACG
CTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCT
AATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAA
GAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACG
GGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTT
AAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCAT
GGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGC
AACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGG
AACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTT
GACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGC
AGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAAT
GAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGAT
GGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAA
GCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAA
TGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGA
GATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTAC
CTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGAC
CCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTA
AGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAA
GGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGG
AAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCC
GTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGAC
TTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGA
AGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGC
CTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTA
CTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGA
ACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAA
AATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTT
CAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTT
ACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTG
TGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCA
GCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACG
GAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAG
GACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACC
TCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTC
CAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCT
ACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAG
GAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTA
CACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAAC
AGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTT
GACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAG
ATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGT
GGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATC
ACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCAT
GCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTC
AGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCC
GAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGT
TCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAAT
TTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACG
GAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACC
GCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGAC
ATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATC
AAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGT
ATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATC
CTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAG
TTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGC
GGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTT
AAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTG
GGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGG
AACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAG
TATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCT
GTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCG
TATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTC
AAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAG
TGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGT
GAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAG
ACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTG
GAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGT
AATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACC
CACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATG
GTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGT
GGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTC
AAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTC
GCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTG
CTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCA
AGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATA
TTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGT
CTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAG
TGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCC
ATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAAC
ACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAAC
TGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTAC
CATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTG
GCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGC
AGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAAT
AATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCC
TGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCC
GTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGC
TGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATA
AGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCA
GGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTG
CTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGAC
GGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGC
GGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTT
ATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACC
TGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAA
GGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGC
AGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGC
TTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTG
AGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTA
GGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTG
GAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTA
AGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCAT
GGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGT
GGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCA
AAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCC

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_10227nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTT
ACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTG
GCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGC
AATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATC
ACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACG
GGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGT
TCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCAT
TGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCT
ATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGA
GGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAAT
CCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGT
GAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTG
TCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGG
GAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGT
TGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGC
TATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTG
TGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGT
TACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGA
GACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATA
CTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGC
CCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGC
TACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGA
CAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTT
TTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGA
GAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGG
AAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAG
CTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGC
AAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGA
AAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGC
TCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAA
GTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACA

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_9696nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGG
CAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAAC
TACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTAT
CCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTC
AACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTAT
AGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAG
AAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGC
CACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAA
GCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACT
TGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAA
GTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAAT
CAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCAC
CCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTC
GGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGA
ATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAG
CTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCT
TGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTG
AGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGC
TGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTAC
CAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTC
CCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGC
AACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTG
AACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTG
TACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGT
TTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCC
TGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGA
AATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTC
TCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAG
GCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGC
ATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTG
TTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCT
CCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCAT
AACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGC
AGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCAT
GCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCAT
CCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAA
GGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAA
TATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCG
CCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATT
TTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGAC
ATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACC
AGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACG
AGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTA

>In-frame_RTN3_ENST00000354497_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_5862nt
ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGC
CCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGC
AGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATT
GCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGC
ATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAAC
GCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTC
TTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGG
GTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTC
GCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAAT
TATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAG
TTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGA
TCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAA
GCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGA
GATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAAC
AAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAAC
AACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGAC
TTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGT
GGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAG
TGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGC
TTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCT
CCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGG
ATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGAT
GGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTG
CTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCG
GGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGT
GACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGG
AAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAA
GGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTT
GCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTC
TCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGA
ATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTG
GGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTG
TCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACA
CGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAAT
GAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAA
CTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACC
GACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGG
GACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCT
CCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAG
ATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGAC
ATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCA
ATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAG
TGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACA
TGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAA
TGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACAC
ATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGC
CTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGAC
CCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATT
CTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGA
GGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACG
GTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCA
CAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGT
GCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAG
CCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCC
ACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTC
ACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAG
GGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCA
CCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATT
AGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAA
ATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATG
CCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTG
AGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTT
CTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGC
ACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAA
CTTGCTTACCAAGGAGGATCTGGAAACATTGGTCCTGCTTTCCCATGTCTTGACACCCCATTCCAAGCCAGATGTCAAGGAGAAGAAAGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_10376nt
GTGCGCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTA
AAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCG
CTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCG
GCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTAC
GCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCG
GGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATAT
GGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCA
AAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATA
AAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTT
CCGACTTCAGTAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAG
TTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCA
TTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGC
TTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGT
ACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCT
CACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCA
GTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATC
AGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAG
AGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTG
AGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCC
AGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACAT
TTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCC
ACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGC
CCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTT
TACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCT
TGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGA
ACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATT
CCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGG
GGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAG
GCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAG
TGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTT
TTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGT
TTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTG
CCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCA
AGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATG
AAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCA
TCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCA
CGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCG
ACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATG
AAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAG
ACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCC
CTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTG
TTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCG
CCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCC
AGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACA
CCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAAC
CAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATC
CTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCT
ATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGA
GTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGG
AAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACT
CTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCA
ATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCC
TCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTG
ATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTC
TGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCA
GCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACC
TGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCT
GCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGA
TCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTG
GGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATT
TCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCA
GCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCC
ACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGG
GTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTG
CACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTG
GACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACC
GGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGG
ATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCA
ACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCT
TTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTAC
AGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCC
TCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACG
CATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTG
TGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTC
TCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATT
TTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGT
TTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTA
CAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACT
GCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTG
GATACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGG
CTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTC
ATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGT
GTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTG
CTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAG
ATGAGAGGCCAAGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAG
ACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAA
CGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCG
TGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCA
CGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATG
GAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGAT
CCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCG
TCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGC
CCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGA
GTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGC
AGCCGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCA
TAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCC
AGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCT
TCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCA
TTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGG
TTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCG
AATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAG
TGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTG
TGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGA
AGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCT
TCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAG
GCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTA
CTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTC
ATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCT
ACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGT
ATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGC
CCCAACAGGACTGATTCATAGCCATACCTCTGATGGACAAGCAGTGATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTT
ACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGGATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACA
CATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATCTGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGC
CAACACGTCATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGCTGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCC
CTCAGGTGCGGTGACAGAATGGTGGCACCACGATATGTGTTCTCTTGTGTTGTTTTTCCTTTTTAAACCCCCATGAACACGAATACTCTG

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_10376nt
GTGCGCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTA
AAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCG
CTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCG
GCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTAC
GCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCG
GGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATAT
GGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCA
AAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATA
AAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTT
CCGACTTCAGTAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAG
TTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCA
TTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGC
TTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGT
ACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCT
CACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCA
GTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATC
AGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAG
AGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTG
AGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCC
AGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACAT
TTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCC
ACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGC
CCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTT
TACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCT
TGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGA
ACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATT
CCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGG
GGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAG
GCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAG
TGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTT
TTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGT
TTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTG
CCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCA
AGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATG
AAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCA
TCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCA
CGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCG
ACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATG
AAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAG
ACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCC
CTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTG
TTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCG
CCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCC
AGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACA
CCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAAC
CAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATC
CTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCT
ATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGA
GTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGG
AAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACT
CTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCA
ATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCC
TCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTG
ATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTC
TGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCA
GCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACC
TGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCT
GCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGA
TCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTG
GGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATT
TCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCA
GCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCC
ACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGG
GTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTG
CACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTG
GACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACC
GGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGG
ATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCA
ACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCT
TTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTAC
AGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCC
TCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACG
CATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTG
TGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTC
TCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATT
TTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGT
TTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTA
CAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACT
GCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTG
GATACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGG
CTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTC
ATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGT
GTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTG
CTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAG
ATGAGAGGCCAAGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAG
ACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAA
CGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCG
TGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCA
CGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATG
GAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGAT
CCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCG
TCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGC
CCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGA
GTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGC
AGCCGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCA
TAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCC
AGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCT
TCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCA
TTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGG
TTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCG
AATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAG
TGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTG
TGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGA
AGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCT
TCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAG
GCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTA
CTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTC
ATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCT
ACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGT
ATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGC
CCCAACAGGACTGATTCATAGCCATACCTCTGATGGACAAGCAGTGATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTT
ACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGGATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACA
CATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATCTGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGC
CAACACGTCATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGCTGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCC
CTCAGGTGCGGTGACAGAATGGTGGCACCACGATATGTGTTCTCTTGTGTTGTTTTTCCTTTTTAAACCCCCATGAACACGAATACTCTG

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_10907nt
GTGCGCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTA
AAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCG
CTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCG
GCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTAC
GCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCG
GGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATAT
GGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCA
AAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATA
AAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTT
CCGACTTCAGTAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAG
TTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCA
TTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGC
TTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGT
ACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCT
CACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCA
GTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATC
AGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAG
AGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTG
AGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCC
AGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACAT
TTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCC
ACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGC
CCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTT
TACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCT
TGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGA
ACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATT
CCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGG
GGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAG
GCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAG
TGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTT
TTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGT
TTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTG
CCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCA
AGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATG
AAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCA
TCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCA
CGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCG
ACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATG
AAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAG
ACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCC
CTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTG
TTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCG
CCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCC
AGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACA
CCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAAC
CAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATC
CTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCT
ATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGA
GTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGG
AAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACT
CTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCA
ATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCC
TCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTG
ATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTC
TGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCA
GCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACC
TGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCT
GCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGA
TCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTG
GGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATT
TCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCA
GCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCC
ACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGG
GTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTG
CACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTG
GACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACC
GGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGG
ATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCA
ACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCT
TTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTAC
AGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCC
TCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACG
CATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTG
TGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTC
TCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATT
TTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGT
TTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTA
CAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACT
GCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTG
GATACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGG
CTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTC
ATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGT
GTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTG
CTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAG
ATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGG
CCACAGCTATATTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCG
AAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGG
TGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTG
TCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATT
TCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTC
GAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGA
GTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGC
CCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGC
ACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACT
GCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTC
TCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGG
TGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCA
TCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACT
GCACAATTATAAGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATC
AGTGTAACCCAGGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCT
GCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACA
GCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCC
CTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCA
AATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTG
CTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCA
GGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATAC
CTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCT
GCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAA
GTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATT
ATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAG
CCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAG
ATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAG
GTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACG
GCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACA
GAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAA
ACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGG
ACTGATTCATAGCCATACCTCTGATGGACAAGCAGTGATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCG
ATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGGATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTT
TCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATCTGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTC
ATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGCTGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGC
GGTGACAGAATGGTGGCACCACGATATGTGTTCTCTTGTGTTGTTTTTCCTTTTTAAACCCCCATGAACACGAATACTCTGAAAAAAATA

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_10907nt
GTGCGCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTA
AAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCG
CTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCG
GCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTAC
GCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCG
GGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATAT
GGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCA
AAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATA
AAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTT
CCGACTTCAGTAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAG
TTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCA
TTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGC
TTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGT
ACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCT
CACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCA
GTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATC
AGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAG
AGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTG
AGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCC
AGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACAT
TTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCC
ACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGC
CCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTT
TACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCT
TGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGA
ACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATT
CCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGG
GGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAG
GCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAG
TGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTT
TTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGT
TTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTG
CCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCA
AGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATG
AAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCA
TCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCA
CGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCG
ACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATG
AAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAG
ACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCC
CTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTG
TTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCG
CCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCC
AGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACA
CCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAAC
CAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATC
CTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCT
ATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGA
GTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGG
AAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACT
CTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCA
ATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCC
TCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTG
ATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTC
TGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCA
GCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACC
TGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCT
GCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGA
TCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTG
GGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATT
TCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCA
GCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCC
ACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGG
GTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTG
CACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTG
GACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACC
GGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGG
ATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCA
ACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCT
TTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTAC
AGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCC
TCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACG
CATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTG
TGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTC
TCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATT
TTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGT
TTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTA
CAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACT
GCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTG
GATACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGG
CTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTC
ATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGT
GTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTG
CTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAG
ATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGG
CCACAGCTATATTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCG
AAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGG
TGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTG
TCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATT
TCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTC
GAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGA
GTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGC
CCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGC
ACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACT
GCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTC
TCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGG
TGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCA
TCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACT
GCACAATTATAAGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATC
AGTGTAACCCAGGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCT
GCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACA
GCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCC
CTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCA
AATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTG
CTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCA
GGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATAC
CTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCT
GCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAA
GTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATT
ATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAG
CCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAG
ATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAG
GTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACG
GCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACA
GAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAA
ACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGG
ACTGATTCATAGCCATACCTCTGATGGACAAGCAGTGATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCG
ATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGGATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTT
TCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATCTGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTC
ATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGCTGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGC
GGTGACAGAATGGTGGCACCACGATATGTGTTCTCTTGTGTTGTTTTTCCTTTTTAAACCCCCATGAACACGAATACTCTGAAAAAAATA

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_10418nt
GTGCGCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTA
AAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCG
CTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCG
GCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTAC
GCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCG
GGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATAT
GGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCA
AAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATA
AAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTT
CCGACTTCAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTA
CAGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTA
CCTCCCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTG
CCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACG
TGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCAC
CTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTT
TCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGT
GGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGG
AATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGC
CTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGC
TGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTG
GTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACT
GTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCC
GCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTAC
ATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGG
AGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACT
TCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCT
GCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGT
ACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCT
ACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGT
CTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTT
CCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTA
TATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCT
TCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGC
TTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAG
GAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCC
ACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGT
TCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACC
AAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAG
GCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACA
GGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTG
GCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTT
TCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCC
TTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGT
TCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCG
TCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAG
ACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTC
CTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATG
ACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTA
GCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAG
CTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTG
GCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATG
CTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCT
ATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATG
GAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGC
TCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCT
CTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGC
TTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCA
GTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCA
TAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGG
ATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCC
AGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCA
ACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACA
TTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTG
GTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCAC
ATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGAC
AATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGC
AAGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATT
ACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACA
GAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTC
CTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGA
CGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCG
AAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCAT
TTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGA
AGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCC
CAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTA
ACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTG
ATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAA
GCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCA
GTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGAT
ACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTG
TGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATG
AGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTA
AGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTC
AAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATG
AGAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCA
CAGCTATATTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAA
CTCGATGTCTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGG
TTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCT
GTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCA
CCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAG
TGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTA
TCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCA
AGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACT
ACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCA
CAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCC
GCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGT
GTGAGGCCGTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCT
ATGCCTGCTGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCA
CAATTATAAGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGT
GTAACCCAGGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCA
AAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCT
GCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTG
TGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAAT
CTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTC
ATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGT
GCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTC
ATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCC
ATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTA
AAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATG
AATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCT
CGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATA
TTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTG
ACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCA
CCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAA
CGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACT

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_9887nt
GTGCGCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTA
AAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCG
CTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCG
GCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTAC
GCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCG
GGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATAT
GGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCA
AAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATA
AAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTT
CCGACTTCAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTA
CAGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTA
CCTCCCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTG
CCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACG
TGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCAC
CTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTT
TCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGT
GGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGG
AATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGC
CTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGC
TGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTG
GTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACT
GTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCC
GCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTAC
ATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGG
AGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACT
TCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCT
GCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGT
ACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCT
ACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGT
CTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTT
CCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTA
TATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCT
TCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGC
TTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAG
GAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCC
ACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGT
TCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACC
AAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAG
GCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACA
GGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTG
GCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTT
TCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCC
TTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGT
TCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCG
TCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAG
ACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTC
CTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATG
ACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTA
GCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAG
CTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTG
GCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATG
CTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCT
ATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATG
GAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGC
TCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCT
CTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGC
TTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCA
GTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCA
TAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGG
ATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCC
AGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCA
ACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACA
TTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTG
GTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCAC
ATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGAC
AATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGC
AAGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATT
ACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACA
GAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTC
CTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGA
CGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCG
AAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCAT
TTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGA
AGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCC
CAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTA
ACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTG
ATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAA
GCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCA
GTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGAT
ACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTG
TGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATG
AGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTA
AGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTC
AAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATG
AGAGGCCAAGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACA
CGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGC
CTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGA
ATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGT
GTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAA
TGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCC
TGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCG
TGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCC
ACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTC
TTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGC
CGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAA
GTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGT
GTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCC
AGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTG
ATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTT
TTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAAT
GTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGT
ACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGT
GTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGG
GGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCA
GCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCC
AGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTT
TTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATT
ACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACA
AACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATG

>In-frame_RTN3_ENST00000341307_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_6053nt
GTGCGCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTA
AAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCG
CTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCG
GCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTAC
GCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCG
GGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATAT
GGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCA
AAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATA
AAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTT
CCGACTTCAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTA
CAGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTA
CCTCCCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTG
CCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACG
TGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCAC
CTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTT
TCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGT
GGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGG
AATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGC
CTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGC
TGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTG
GTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACT
GTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCC
GCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTAC
ATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGG
AGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACT
TCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCT
GCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGT
ACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCT
ACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGT
CTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTT
CCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTA
TATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCT
TCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGC
TTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAG
GAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCC
ACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGT
TCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACC
AAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAG
GCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACA
GGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTG
GCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTT
TCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCC
TTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGT
TCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCG
TCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAG
ACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTC
CTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATG
ACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTA
GCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAG
CTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTG
GCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATG
CTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCT
ATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATG
GAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGC
TCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCT
CTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGC
TTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCA
GTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCA
TAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGG
ATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCC
AGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCA
ACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACA
TTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTG
GTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCAC
ATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGAC
AATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGC
AAGGATTTAAACTTGCTTACCAAGGAGGATCTGGAAACATTGGTCCTGCTTTCCCATGTCTTGACACCCCATTCCAAGCCAGATGTCAAG

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_10372nt
GCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGG
GACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCG
CGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGG
CGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGG
GACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGA
CACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCT
AACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGG
ATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAA
CTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGA
CTTCAGTAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTAC
AGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTAC
CTCCCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGC
CTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGT
GCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACC
TGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTT
CCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTG
GTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGA
ATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCC
TCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCT
GGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGG
TCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTG
TGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCG
CTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACA
TTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGA
GGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTT
CATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTG
CCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTA
CACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTA
CATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTC
TCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTC
CGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTAT
ATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTT
CAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCT
TACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGG
AACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCA
CCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTT
CACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCA
AGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGG
CCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAG
GAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGG
CTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTT
CGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCT
TCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTT
CTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGT
CACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGA
CCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCC
TGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGA
CTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAG
CGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGC
TTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGG
CTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGC
TCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTA
TTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGG
AACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCT
CCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTC
TGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCT
TCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAG
TGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCAT
AGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGA
TGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCA
GTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAA
CAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACAT
TTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGG
TGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACA
TATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACA
ATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCA
AGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTA
CAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAG
AAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCC
TGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGAC
GGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGA
AACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATT
TCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAA
GTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCC
AACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAA
CTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGA
TGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAG
CAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAG
TTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATA
CCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGT
GTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGA
GGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAA
GCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCA
AGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGA
GAGGCCAAGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACAC
GGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCC
TGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAA
TTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTG
TCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAAT
GAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCT
GCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGT
GCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCA
CTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCT
TCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCC
GGTGTGTGAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAG
TTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTG
TCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCA
GTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGA
TCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTT
TTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATG
TATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTA
CACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTG
TAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGG
GTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAG
CGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCA
GGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTT
TCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTA
CCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAA
ACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGA
TACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCA
ACAGGACTGATTCATAGCCATACCTCTGATGGACAAGCAGTGATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTG
CAGCGATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGGATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATG
CGTTTTCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATCTGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAAC
ACGTCATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGCTGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCA
GGTGCGGTGACAGAATGGTGGCACCACGATATGTGTTCTCTTGTGTTGTTTTTCCTTTTTAAACCCCCATGAACACGAATACTCTGAAAA

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_10372nt
GCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGG
GACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCG
CGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGG
CGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGG
GACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGA
CACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCT
AACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGG
ATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAA
CTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGA
CTTCAGTAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTAC
AGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTAC
CTCCCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGC
CTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGT
GCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACC
TGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTT
CCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTG
GTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGA
ATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCC
TCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCT
GGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGG
TCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTG
TGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCG
CTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACA
TTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGA
GGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTT
CATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTG
CCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTA
CACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTA
CATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTC
TCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTC
CGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTAT
ATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTT
CAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCT
TACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGG
AACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCA
CCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTT
CACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCA
AGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGG
CCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAG
GAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGG
CTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTT
CGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCT
TCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTT
CTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGT
CACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGA
CCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCC
TGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGA
CTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAG
CGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGC
TTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGG
CTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGC
TCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTA
TTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGG
AACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCT
CCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTC
TGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCT
TCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAG
TGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCAT
AGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGA
TGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCA
GTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAA
CAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACAT
TTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGG
TGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACA
TATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACA
ATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCA
AGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTA
CAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAG
AAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCC
TGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGAC
GGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGA
AACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATT
TCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAA
GTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCC
AACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAA
CTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGA
TGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAG
CAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAG
TTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATA
CCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGT
GTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGA
GGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAA
GCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCA
AGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGA
GAGGCCAAGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACAC
GGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCC
TGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAA
TTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTG
TCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAAT
GAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCT
GCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGT
GCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCA
CTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCT
TCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCC
GGTGTGTGAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAG
TTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTG
TCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCA
GTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGA
TCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTT
TTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATG
TATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTA
CACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTG
TAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGG
GTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAG
CGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCA
GGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTT
TCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTA
CCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAA
ACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGA
TACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCA
ACAGGACTGATTCATAGCCATACCTCTGATGGACAAGCAGTGATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTG
CAGCGATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGGATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATG
CGTTTTCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATCTGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAAC
ACGTCATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGCTGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCA
GGTGCGGTGACAGAATGGTGGCACCACGATATGTGTTCTCTTGTGTTGTTTTTCCTTTTTAAACCCCCATGAACACGAATACTCTGAAAA

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_10903nt
GCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGG
GACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCG
CGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGG
CGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGG
GACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGA
CACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCT
AACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGG
ATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAA
CTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGA
CTTCAGTAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTAC
AGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTAC
CTCCCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGC
CTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGT
GCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACC
TGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTT
CCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTG
GTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGA
ATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCC
TCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCT
GGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGG
TCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTG
TGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCG
CTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACA
TTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGA
GGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTT
CATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTG
CCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTA
CACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTA
CATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTC
TCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTC
CGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTAT
ATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTT
CAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCT
TACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGG
AACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCA
CCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTT
CACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCA
AGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGG
CCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAG
GAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGG
CTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTT
CGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCT
TCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTT
CTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGT
CACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGA
CCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCC
TGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGA
CTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAG
CGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGC
TTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGG
CTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGC
TCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTA
TTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGG
AACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCT
CCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTC
TGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCT
TCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAG
TGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCAT
AGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGA
TGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCA
GTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAA
CAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACAT
TTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGG
TGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACA
TATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACA
ATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCA
AGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTA
CAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAG
AAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCC
TGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGAC
GGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGA
AACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATT
TCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAA
GTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCC
AACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAA
CTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGA
TGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAG
CAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAG
TTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATA
CCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGT
GTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGA
GGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAA
GCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCA
AGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGA
GAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCAC
AGCTATATTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAAC
TCGATGTCTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGT
TTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTG
TGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCAC
CTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGT
GGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTAT
CCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAA
GTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTA
CTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCAC
AGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCG
CTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTG
TGAGGCCGTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTA
TGCCTGCTGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCAC
AATTATAAGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTG
TAACCCAGGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAA
AGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTG
CATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGT
GTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATC
TCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCA
TAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTG
CAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCA
TGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCA
TCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAA
AGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGA
ATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTC
GCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATAT
TTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGA
CATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCAC
CAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAAC
GAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTT
AAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTG
ATTCATAGCCATACCTCTGATGGACAAGCAGTGATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCT
TCAACCTTGTCTACTGGCATAAGTGCAGCGGGGATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCAT
TCCAAAAGTGGGTTCTAAATGCCTGGCTGCATCTGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATAC
TCAATGCCTCAGACTTTCATATTTCTGTGTTGCTGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTG
ACAGAATGGTGGCACCACGATATGTGTTCTCTTGTGTTGTTTTTCCTTTTTAAACCCCCATGAACACGAATACTCTGAAAAAAATAAAAA

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_10903nt
GCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGG
GACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCG
CGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGG
CGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGG
GACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGA
CACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCT
AACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGG
ATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAA
CTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGA
CTTCAGTAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTAC
AGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTAC
CTCCCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGC
CTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGT
GCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACC
TGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTT
CCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTG
GTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGA
ATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCC
TCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCT
GGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGG
TCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTG
TGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCG
CTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACA
TTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGA
GGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTT
CATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTG
CCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTA
CACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTA
CATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTC
TCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTC
CGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTAT
ATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTT
CAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCT
TACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGG
AACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCA
CCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTT
CACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCA
AGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGG
CCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAG
GAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGG
CTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTT
CGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCT
TCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTT
CTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGT
CACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGA
CCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCC
TGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGA
CTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAG
CGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGC
TTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGG
CTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGC
TCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTA
TTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGG
AACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCT
CCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTC
TGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCT
TCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAG
TGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCAT
AGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGA
TGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCA
GTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAA
CAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACAT
TTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGG
TGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACA
TATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACA
ATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCA
AGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTA
CAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAG
AAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCC
TGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGAC
GGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGA
AACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATT
TCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAA
GTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCC
AACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAA
CTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGA
TGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAG
CAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAG
TTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATA
CCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGT
GTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGA
GGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAA
GCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCA
AGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGA
GAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCAC
AGCTATATTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAAC
TCGATGTCTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGT
TTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTG
TGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCAC
CTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGT
GGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTAT
CCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAA
GTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTA
CTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCAC
AGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCG
CTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTG
TGAGGCCGTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTA
TGCCTGCTGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCAC
AATTATAAGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTG
TAACCCAGGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAA
AGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTG
CATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGT
GTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATC
TCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCA
TAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTG
CAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCA
TGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCA
TCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAA
AGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGA
ATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTC
GCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATAT
TTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGA
CATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCAC
CAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAAC
GAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTT
AAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTG
ATTCATAGCCATACCTCTGATGGACAAGCAGTGATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCT
TCAACCTTGTCTACTGGCATAAGTGCAGCGGGGATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCAT
TCCAAAAGTGGGTTCTAAATGCCTGGCTGCATCTGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATAC
TCAATGCCTCAGACTTTCATATTTCTGTGTTGCTGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTG
ACAGAATGGTGGCACCACGATATGTGTTCTCTTGTGTTGTTTTTCCTTTTTAAACCCCCATGAACACGAATACTCTGAAAAAAATAAAAA

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_10414nt
GCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGG
GACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCG
CGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGG
CGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGG
GACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGA
CACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCT
AACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGG
ATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAA
CTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGA
CTTCAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGA
GACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTC
CCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTT
TGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCT
CACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGG
GTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCT
CCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTC
TGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATA
TGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCA
GTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGC
CAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCA
GAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGA
TGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTG
TGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTG
TGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGT
CAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCAT
GTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCT
GGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACAC
ACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACAT
CCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCA
TGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGA
GCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATC
AGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAG
CCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTAC
CTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAAC
ATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCT
TAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCAC
TAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGG
TTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCA
CTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAG
AGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTA
TCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGA
CACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCC
GGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTC
CACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCAC
ATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCC
TCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGG
GAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTT
CCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGG
AAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTG
TTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTA
TAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCC
CTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTC
CATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAAC
CCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCG
ATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGT
CCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCA
GGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGG
CAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGT
TACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGT
GACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTC
TGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAG
CATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTC
CTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGT
GATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATAT
TCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATT
TAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGG
ATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAG
CGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAA
CTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGA
TGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGA
AGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAAC
GGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCA
GCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTA
CCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAAC
ATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTC
CCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGC
ACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAG
GAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTT
GACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCG
AATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTC
CTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGG
CTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCC
GGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGT
ATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAG
GCCAAGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGC
TATATTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCG
ATGTCTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTA
CCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGT
CCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTG
CAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGT
GAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCT
GTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTG
TTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTC
CTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGG
AAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTT
CTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGA
GGCCGTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGC
CTGCTGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAAT
TATAAGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAA
CCCAGGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGC
CGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCAT
GGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTT
CTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCC
ATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAA
CACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAG
AAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGC
CTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCC
AGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGG
AGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATA
TTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCC
AGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTT
TGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACAT
TCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAG
CAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAG
ACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAA

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_9883nt
GCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGG
GACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCG
CGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGG
CGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGG
GACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGA
CACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCT
AACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGG
ATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAA
CTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGA
CTTCAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGA
GACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTC
CCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTT
TGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCT
CACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGG
GTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCT
CCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTC
TGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATA
TGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCA
GTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGC
CAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCA
GAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGA
TGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTG
TGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTG
TGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGT
CAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCAT
GTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCT
GGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACAC
ACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACAT
CCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCA
TGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGA
GCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATC
AGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAG
CCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTAC
CTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAAC
ATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCT
TAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCAC
TAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGG
TTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCA
CTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAG
AGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTA
TCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGA
CACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCC
GGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTC
CACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCAC
ATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCC
TCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGG
GAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTT
CCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGG
AAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTG
TTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTA
TAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCC
CTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTC
CATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAAC
CCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCG
ATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGT
CCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCA
GGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGG
CAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGT
TACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGT
GACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTC
TGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAG
CATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTC
CTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGT
GATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATAT
TCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATT
TAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGG
ATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAG
CGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAA
CTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGA
TGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGA
AGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAAC
GGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCA
GCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTA
CCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAAC
ATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTC
CCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGC
ACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAG
GAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTT
GACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCG
AATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTC
CTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGG
CTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCC
GGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGT
ATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAG
GCCAAGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGT
GGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGT
CTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTT
CACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCG
AGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAG
TATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCC
CAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCA
CTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTG
CACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCT
CCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGT
GTGTGAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTA
CAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCT
CCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTG
CAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCC
TGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTT
CAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTAT
ACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACAC
CTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAA
AAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTA
TTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGA
AGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGC
AGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCA
AGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCA
CGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACA
CAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATAC

>In-frame_RTN3_ENST00000356000_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_6049nt
GCATGCGCGCTCGCGCTCCCGCCCTCTAGCTGCGCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGG
GACTTGAGCGAGCCAGTTGCCGGATTATTCTATTTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCG
CGTAGCCATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGG
CGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGG
GACCAGCAGCTCCATCTCCAGCCCGCACTTCCCTTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGA
CACCATTGCGCTGGTCTTCACTGACTTTCAGCTAGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCT
AACTGGCATGAACCTCCCCTCTCCAGTTATCAGTAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGG
ATTTAACGCTCAGTTCCAAGTGAAAAAGGCGATTGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAA
CTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGTCTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGA
CTTCAGGGTTGGTGCAAATGTACAGTTTTCATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGA
GACGCTCGCTGCTTGGAGTGACCACAGGCCCATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTC
CCCTAATTATCCGGTTCAGTATGAAGATAATGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTT
TGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCT
CACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGG
GTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCT
CCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTC
TGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATA
TGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCA
GTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGC
CAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCA
GAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGA
TGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTG
TGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTG
TGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGT
CAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCAT
GTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCT
GGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACAC
ACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACAT
CCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCA
TGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGA
GCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATC
AGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAG
CCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTAC
CTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAAC
ATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCT
TAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCAC
TAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGG
TTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCA
CTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAG
AGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTA
TCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGA
CACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCC
GGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTC
CACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCAC
ATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCC
TCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGG
GAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTT
CCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGG
AAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTG
TTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTA
TAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCC
CTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTC
CATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAAC
CCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCG
ATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGT
CCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCA
GGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGG
CAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGT
TACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGT
GACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTC
TGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAG
CATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTC
CTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGT
GATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATAT
TCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATT
TAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGG
ATTTAAACTTGCTTACCAAGGAGGATCTGGAAACATTGGTCCTGCTTTCCCATGTCTTGACACCCCATTCCAAGCCAGATGTCAAGGAGA

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_10339nt
GCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTAT
TTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCA
GTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGAC
GAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCC
TTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCT
AGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAG
TAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGAT
TGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGT
CTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGTAGGGTTGGTGCAAATGTACAGTTTTC
ATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCC
CATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAA
TGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGA
CACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGT
GAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAA
GGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCC
GGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATG
TTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGAT
TATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGG
CATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATT
TCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTAT
AAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGA
GTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGC
GTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCA
CTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACT
GATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCG
CTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCG
CCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGA
GAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCC
TGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACAC
CTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTT
GCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAA
TATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGG
AGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAG
TGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTA
TGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGG
AGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAA
CAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCT
GGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTG
CAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCAT
AGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTG
CACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGT
CTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACT
CACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCC
AGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCA
AGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAA
TCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAA
CCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAA
CAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGA
TGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGAC
AAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTG
TGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGG
GGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTT
TGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACT
CTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCG
CGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGG
TTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGT
GCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCT
GTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGT
GATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGG
CACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCA
CCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAA
CGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAA
CTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTA
CCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAA
TCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCT
GAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATT
ACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTA
TCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGC
CCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTG
GCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGA
CGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCT
CAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGT
TCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGG
GACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGT
CCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGA
ACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCA
AAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCAC
TGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCT
AAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAG
ACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGG
TTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAAC
AGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCT
CTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTT
AGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGCTGGCCACTGCGGTTC
CCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCT
TGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGG
AAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGG
CGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGT
GGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTA
CTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCC
AGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCAT
AGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGA
TCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCT
GAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCGCC
GCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCA
CTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCC
CGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTC
CAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTAC
GCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGG
TTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCC
GGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGG
ATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAAC
AGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGC
CACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGG
CATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGA
CAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAA
ATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGC
CATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGG
CTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGT
GAGGTTTGACACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTGATTCATAGCCATACCTCTGATGGA
CAAGCAGTGATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGT
GCAGCGGGGATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCT
GGCTGCATCTGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATACTCAATGCCTCAGACTTTCATATTT
CTGTGTTGCTGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTGACAGAATGGTGGCACCACGATATG

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_10339nt
GCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTAT
TTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCA
GTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGAC
GAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCC
TTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCT
AGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAG
TAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGAT
TGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGT
CTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGTAGGGTTGGTGCAAATGTACAGTTTTC
ATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCC
CATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAA
TGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGA
CACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGT
GAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAA
GGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCC
GGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATG
TTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGAT
TATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGG
CATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATT
TCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTAT
AAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGA
GTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGC
GTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCA
CTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACT
GATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCG
CTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCG
CCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGA
GAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCC
TGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACAC
CTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTT
GCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAA
TATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGG
AGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAG
TGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTA
TGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGG
AGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAA
CAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCT
GGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTG
CAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCAT
AGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTG
CACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGT
CTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACT
CACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCC
AGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCA
AGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAA
TCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAA
CCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAA
CAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGA
TGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGAC
AAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTG
TGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGG
GGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTT
TGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACT
CTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCG
CGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGG
TTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGT
GCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCT
GTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGT
GATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGG
CACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCA
CCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAA
CGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAA
CTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTA
CCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAA
TCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCT
GAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATT
ACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTA
TCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGC
CCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTG
GCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGA
CGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCT
CAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGT
TCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGG
GACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGT
CCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGA
ACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCA
AAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCAC
TGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCT
AAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAG
ACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGG
TTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAAC
AGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCT
CTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTT
AGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGCTGGCCACTGCGGTTC
CCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCT
TGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGG
AAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGG
CGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGT
GGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTA
CTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCC
AGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCAT
AGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGA
TCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCT
GAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCGCC
GCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCA
CTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCC
CGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTC
CAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTAC
GCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGG
TTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCC
GGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGG
ATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAAC
AGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGC
CACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGG
CATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGA
CAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAA
ATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGC
CATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGG
CTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGT
GAGGTTTGACACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTGATTCATAGCCATACCTCTGATGGA
CAAGCAGTGATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGT
GCAGCGGGGATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCT
GGCTGCATCTGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATACTCAATGCCTCAGACTTTCATATTT
CTGTGTTGCTGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTGACAGAATGGTGGCACCACGATATG

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_10870nt
GCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTAT
TTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCA
GTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGAC
GAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCC
TTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCT
AGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAG
TAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGAT
TGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGT
CTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGTAGGGTTGGTGCAAATGTACAGTTTTC
ATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCC
CATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAA
TGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGA
CACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGT
GAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAA
GGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCC
GGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATG
TTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGAT
TATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGG
CATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATT
TCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTAT
AAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGA
GTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGC
GTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCA
CTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACT
GATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCG
CTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCG
CCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGA
GAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCC
TGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACAC
CTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTT
GCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAA
TATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGG
AGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAG
TGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTA
TGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGG
AGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAA
CAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCT
GGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTG
CAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCAT
AGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTG
CACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGT
CTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACT
CACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCC
AGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCA
AGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAA
TCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAA
CCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAA
CAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGA
TGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGAC
AAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTG
TGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGG
GGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTT
TGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACT
CTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCG
CGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGG
TTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGT
GCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCT
GTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGT
GATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGG
CACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCA
CCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAA
CGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAA
CTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTA
CCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAA
TCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCT
GAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATT
ACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTA
TCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGC
CCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTG
GCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGA
CGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCT
CAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGT
TCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGG
GACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGT
CCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGA
ACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCA
AAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCAC
TGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCT
AAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAG
ACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGG
TTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAAC
AGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCT
CTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTT
AGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAG
CCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTTACGTGCAACACCGGCTACACGCT
TGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCAGA
CCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGG
AACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCC
TGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTC
TCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAA
TGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCT
GGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGT
CCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAA
CGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGG
GACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGG
CTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACACC
CACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGGCT
CATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGTTGTGGGGATCCAGGCACACTAGC
AAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGCTATGTCATGGAAGCAGTCACATC
CGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCA
GAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCAT
CCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGG
GCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGT
CTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTT
TGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGAC
TCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGC
GGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCA
CAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAA
AACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAAC
TGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAA
GAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGG
ACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCT
AGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGT
TCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGG
GCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGA
CACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTGATTCATAGCCATACCTCTGATGGACAAGCAGTG
ATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGG
ATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATC
TGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGC
TGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTGACAGAATGGTGGCACCACGATATGTGTTCTCTT

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_10870nt
GCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTAT
TTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCA
GTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGAC
GAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCC
TTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCT
AGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAG
TAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGAT
TGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGT
CTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGTAGGGTTGGTGCAAATGTACAGTTTTC
ATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCC
CATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAA
TGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGA
CACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGT
GAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAA
GGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCC
GGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATG
TTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGAT
TATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGG
CATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATT
TCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTAT
AAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGA
GTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGC
GTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCA
CTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACT
GATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCG
CTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCG
CCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGA
GAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCC
TGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACAC
CTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTT
GCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAA
TATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGG
AGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAG
TGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTA
TGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGG
AGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAA
CAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCT
GGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTG
CAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCAT
AGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTG
CACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGT
CTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACT
CACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCC
AGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCA
AGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAA
TCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAA
CCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAA
CAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGA
TGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGAC
AAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTG
TGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGG
GGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTT
TGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACT
CTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCG
CGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGG
TTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGT
GCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCT
GTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGT
GATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGG
CACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCA
CCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAA
CGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAA
CTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTA
CCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAA
TCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCT
GAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATT
ACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTA
TCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGC
CCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTG
GCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGA
CGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCT
CAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGT
TCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGG
GACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGT
CCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGA
ACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCA
AAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCAC
TGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCT
AAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAG
ACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGG
TTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAAC
AGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCT
CTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTT
AGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAG
CCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTTACGTGCAACACCGGCTACACGCT
TGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCAGA
CCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGG
AACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCC
TGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTC
TCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAA
TGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCT
GGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGT
CCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAA
CGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGG
GACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGG
CTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACACC
CACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGGCT
CATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGTTGTGGGGATCCAGGCACACTAGC
AAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGCTATGTCATGGAAGCAGTCACATC
CGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCA
GAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCAT
CCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGG
GCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGT
CTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTT
TGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGAC
TCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGC
GGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCA
CAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAA
AACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAAC
TGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAA
GAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGG
ACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCT
AGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGT
TCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGG
GCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGA
CACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTGATTCATAGCCATACCTCTGATGGACAAGCAGTG
ATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGG
ATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATC
TGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGC
TGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTGACAGAATGGTGGCACCACGATATGTGTTCTCTT

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_10381nt
GCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTAT
TTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCA
GTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGAC
GAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCC
TTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCT
AGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAG
TAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGAT
TGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGT
CTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGGGTTGGTGCAAATGTACAGTTTTCATG
TGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCAT
CTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAATGC
ACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACAC
CCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAG
CATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGG
AGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGC
GGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTT
CTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTAT
CTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCAT
TTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCA
GTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAA
CGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTC
CATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTC
CAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTC
TATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGAT
CGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTC
CAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCA
CGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAG
GAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGG
GTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTT
TCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCC
TCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATAT
CACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGA
CTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGC
ACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGA
TAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGA
TACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAG
CACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGT
AAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAA
CCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGC
GGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCAC
CTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTG
GGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCAC
CCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGG
TATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGG
ACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCT
GACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCC
GGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAG
CCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGC
CTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAG
AGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGT
GATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGT
AGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGG
ACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTC
GGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGG
CTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTC
TGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCC
CAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTC
CCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGAT
CAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCAC
CACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCT
GGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGA
CGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTA
TCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCC
CAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCA
TGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAG
CACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACA
GAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCC
TGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCC
TTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCT
CATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGG
TCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAA
GTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCC
ACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGAC
CGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCG
GACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACC
AAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAG
TCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGA
CCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAA
CAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACG
AAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTC
ATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGC
CGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTC
AGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGA
AGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAGCCT
TTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTTACGTGCAACACCGGCTACACGCTTGT
GGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCAGACCC
GATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAAC
TTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGC
CCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCG
AGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGC
CATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGG
ATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCC
TGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGA
CACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGAC
CCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTC
CCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACACCCAC
CAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGGCTCAT
GACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGTTGTGGGGATCCAGGCACACTAGCAAA
TGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGCTATGTCATGGAAGCAGTCACATCCGC
CACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAA
TGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCT
CTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCG
ACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTG
CCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGG
AATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCG
CACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGA
TGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAG
AACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAAC
TCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGT
TGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAA
GGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACT
AGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGA
AAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCC
TTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCA
TGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACAC

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_9850nt
GCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTAT
TTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCA
GTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGAC
GAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCC
TTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCT
AGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAG
TAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGAT
TGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGT
CTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGGGTTGGTGCAAATGTACAGTTTTCATG
TGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCAT
CTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAATGC
ACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACAC
CCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAG
CATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGG
AGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGC
GGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTT
CTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTAT
CTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCAT
TTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCA
GTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAA
CGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTC
CATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTC
CAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTC
TATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGAT
CGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTC
CAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCA
CGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAG
GAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGG
GTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTT
TCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCC
TCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATAT
CACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGA
CTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGC
ACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGA
TAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGA
TACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAG
CACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGT
AAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAA
CCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGC
GGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCAC
CTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTG
GGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCAC
CCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGG
TATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGG
ACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCT
GACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCC
GGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAG
CCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGC
CTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAG
AGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGT
GATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGT
AGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGG
ACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTC
GGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGG
CTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTC
TGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCC
CAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTC
CCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGAT
CAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCAC
CACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCT
GGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGA
CGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTA
TCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCC
CAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCA
TGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAG
CACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACA
GAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCC
TGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCC
TTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCT
CATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGG
TCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAA
GTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCC
ACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGAC
CGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCG
GACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACC
AAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAG
TCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGA
CCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAA
CAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACG
AAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTC
ATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGC
CGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTC
AGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGA
AGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGCTGGCCACTGCGGTTCCCC
AGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGT
GGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAA
CCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGT
GTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGA
AAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTT
GCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGG
GGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGG
CAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCC
GGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAG
GGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCGCCGCC
GGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTC
CGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGC
AGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAG
AAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCC
ACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTC
CACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGC
ACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATC
TGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGT
TACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCAC
TCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCAT
TTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAA
CTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATT
TAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCAT
TCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTA
TGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAG

>In-frame_RTN3_ENST00000377819_chr11_63449250_+_CSMD1_ENST00000539096_chr8_3855632_-_6016nt
GCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTAT
TTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCA
GTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGAC
GAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCC
TTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCT
AGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAG
TAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGAT
TGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGT
CTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGGGTTGGTGCAAATGTACAGTTTTCATG
TGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCAT
CTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAATGC
ACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACAC
CCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAG
CATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGG
AGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGC
GGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTT
CTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTAT
CTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCAT
TTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCA
GTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAA
CGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTC
CATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTC
CAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTC
TATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGAT
CGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTC
CAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCA
CGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAG
GAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGG
GTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTT
TCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCC
TCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATAT
CACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGA
CTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGC
ACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGA
TAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGA
TACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAG
CACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGT
AAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAA
CCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGC
GGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCAC
CTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTG
GGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCAC
CCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGG
TATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGG
ACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCT
GACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCC
GGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAG
CCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGC
CTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAG
AGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGT
GATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGT
AGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGG
ACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTC
GGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGG
CTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTC
TGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCC
CAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTC
CCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGAT
CAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCAC
CACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCT
GGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGA
CGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTA
TCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCC
CAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCA
TGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAG
CACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGGAGGATCTGGAAA

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000602723_chr8_3855632_-_10339nt
GCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTAT
TTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCA
GTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGAC
GAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCC
TTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCT
AGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAG
TAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGAT
TGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGT
CTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGTAGGGTTGGTGCAAATGTACAGTTTTC
ATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCC
CATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAA
TGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGA
CACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGT
GAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAA
GGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCC
GGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATG
TTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGAT
TATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGG
CATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATT
TCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTAT
AAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGA
GTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGC
GTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCA
CTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACT
GATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCG
CTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCG
CCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGA
GAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCC
TGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACAC
CTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTT
GCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAA
TATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGG
AGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAG
TGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTA
TGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGG
AGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAA
CAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCT
GGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTG
CAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCAT
AGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTG
CACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGT
CTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACT
CACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCC
AGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCA
AGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAA
TCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAA
CCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAA
CAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGA
TGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGAC
AAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTG
TGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGG
GGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTT
TGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACT
CTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCG
CGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGG
TTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGT
GCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCT
GTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGT
GATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGG
CACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCA
CCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAA
CGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAA
CTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTA
CCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAA
TCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCT
GAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATT
ACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTA
TCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGC
CCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTG
GCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGA
CGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCT
CAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGT
TCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGG
GACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGT
CCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGA
ACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCA
AAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCAC
TGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCT
AAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAG
ACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGG
TTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAAC
AGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCT
CTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTT
AGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGCTGGCCACTGCGGTTC
CCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCT
TGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGG
AAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGG
CGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGT
GGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTA
CTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCC
AGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCAT
AGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGA
TCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCT
GAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCGCC
GCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCA
CTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCC
CGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTC
CAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTAC
GCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGG
TTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCC
GGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGG
ATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAAC
AGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGC
CACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGG
CATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGA
CAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAA
ATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGC
CATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGG
CTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGT
GAGGTTTGACACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTGATTCATAGCCATACCTCTGATGGA
CAAGCAGTGATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGT
GCAGCGGGGATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCT
GGCTGCATCTGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATACTCAATGCCTCAGACTTTCATATTT
CTGTGTTGCTGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTGACAGAATGGTGGCACCACGATATG

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000400186_chr8_3855632_-_10339nt
GCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTAT
TTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCA
GTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGAC
GAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCC
TTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCT
AGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAG
TAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGAT
TGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGT
CTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGTAGGGTTGGTGCAAATGTACAGTTTTC
ATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCC
CATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAA
TGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGA
CACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGT
GAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAA
GGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCC
GGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATG
TTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGAT
TATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGG
CATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATT
TCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTAT
AAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGA
GTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGC
GTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCA
CTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACT
GATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCG
CTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCG
CCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGA
GAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCC
TGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACAC
CTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTT
GCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAA
TATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGG
AGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAG
TGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTA
TGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGG
AGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAA
CAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCT
GGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTG
CAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCAT
AGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTG
CACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGT
CTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACT
CACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCC
AGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCA
AGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAA
TCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAA
CCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAA
CAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGA
TGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGAC
AAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTG
TGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGG
GGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTT
TGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACT
CTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCG
CGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGG
TTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGT
GCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCT
GTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGT
GATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGG
CACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCA
CCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAA
CGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAA
CTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTA
CCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAA
TCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCT
GAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATT
ACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTA
TCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGC
CCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTG
GCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGA
CGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCT
CAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGT
TCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGG
GACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGT
CCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGA
ACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCA
AAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCAC
TGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCT
AAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAG
ACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGG
TTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAAC
AGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCT
CTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTT
AGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGCTGGCCACTGCGGTTC
CCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCT
TGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGG
AAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGG
CGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGT
GGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTA
CTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCC
AGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCAT
AGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGA
TCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCT
GAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCGCC
GCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCA
CTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCC
CGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTC
CAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTAC
GCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGG
TTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCC
GGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGG
ATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAAC
AGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGC
CACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGG
CATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGA
CAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAA
ATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGC
CATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGG
CTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGT
GAGGTTTGACACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTGATTCATAGCCATACCTCTGATGGA
CAAGCAGTGATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGT
GCAGCGGGGATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCT
GGCTGCATCTGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATACTCAATGCCTCAGACTTTCATATTT
CTGTGTTGCTGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTGACAGAATGGTGGCACCACGATATG

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000520002_chr8_3855632_-_10870nt
GCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTAT
TTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCA
GTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGAC
GAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCC
TTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCT
AGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAG
TAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGAT
TGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGT
CTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGTAGGGTTGGTGCAAATGTACAGTTTTC
ATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCC
CATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAA
TGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGA
CACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGT
GAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAA
GGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCC
GGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATG
TTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGAT
TATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGG
CATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATT
TCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTAT
AAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGA
GTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGC
GTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCA
CTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACT
GATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCG
CTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCG
CCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGA
GAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCC
TGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACAC
CTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTT
GCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAA
TATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGG
AGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAG
TGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTA
TGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGG
AGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAA
CAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCT
GGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTG
CAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCAT
AGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTG
CACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGT
CTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACT
CACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCC
AGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCA
AGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAA
TCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAA
CCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAA
CAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGA
TGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGAC
AAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTG
TGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGG
GGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTT
TGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACT
CTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCG
CGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGG
TTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGT
GCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCT
GTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGT
GATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGG
CACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCA
CCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAA
CGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAA
CTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTA
CCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAA
TCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCT
GAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATT
ACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTA
TCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGC
CCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTG
GCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGA
CGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCT
CAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGT
TCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGG
GACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGT
CCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGA
ACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCA
AAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCAC
TGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCT
AAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAG
ACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGG
TTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAAC
AGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCT
CTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTT
AGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAG
CCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTTACGTGCAACACCGGCTACACGCT
TGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCAGA
CCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGG
AACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCC
TGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTC
TCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAA
TGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCT
GGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGT
CCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAA
CGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGG
GACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGG
CTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACACC
CACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGGCT
CATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGTTGTGGGGATCCAGGCACACTAGC
AAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGCTATGTCATGGAAGCAGTCACATC
CGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCA
GAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCAT
CCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGG
GCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGT
CTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTT
TGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGAC
TCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGC
GGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCA
CAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAA
AACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAAC
TGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAA
GAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGG
ACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCT
AGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGT
TCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGG
GCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGA
CACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTGATTCATAGCCATACCTCTGATGGACAAGCAGTG
ATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGG
ATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATC
TGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGC
TGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTGACAGAATGGTGGCACCACGATATGTGTTCTCTT

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000602557_chr8_3855632_-_10870nt
GCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTAT
TTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCA
GTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGAC
GAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCC
TTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCT
AGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAG
TAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGAT
TGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGT
CTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGTAGGGTTGGTGCAAATGTACAGTTTTC
ATGTGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCC
CATCTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAA
TGCACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGA
CACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGT
GAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAA
GGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCC
GGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATG
TTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGAT
TATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGG
CATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATT
TCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTAT
AAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGA
GTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGC
GTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCA
CTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACT
GATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCG
CTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCG
CCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGA
GAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCC
TGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACAC
CTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTT
GCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAA
TATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGG
AGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAG
TGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTA
TGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGG
AGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAA
CAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCT
GGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTG
CAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCAT
AGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTG
CACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGT
CTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACT
CACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCC
AGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCA
AGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAA
TCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAA
CCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAA
CAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGA
TGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGAC
AAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTG
TGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGG
GGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTT
TGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACT
CTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCG
CGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGG
TTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGT
GCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCT
GTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGT
GATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGG
CACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCA
CCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAA
CGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAA
CTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTA
CCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAA
TCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCT
GAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATT
ACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTA
TCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGC
CCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTG
GCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGA
CGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCT
CAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGT
TCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGG
GACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGT
CCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGA
ACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCA
AAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCAC
TGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCT
AAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAG
ACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGG
TTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAAC
AGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCT
CTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTT
AGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAG
CCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTTACGTGCAACACCGGCTACACGCT
TGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCAGA
CCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGG
AACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCC
TGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTC
TCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAA
TGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCT
GGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGT
CCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAA
CGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGG
GACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGG
CTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACACC
CACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGGCT
CATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGTTGTGGGGATCCAGGCACACTAGC
AAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGCTATGTCATGGAAGCAGTCACATC
CGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCA
GAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCAT
CCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGG
GCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGT
CTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTT
TGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGAC
TCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGC
GGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCA
CAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAA
AACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAAC
TGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAA
GAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGG
ACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCT
AGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGT
TCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGG
GCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGA
CACAACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTGATTCATAGCCATACCTCTGATGGACAAGCAGTG
ATTCCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGG
ATCTCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATC
TGTATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGC
TGAGATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTGACAGAATGGTGGCACCACGATATGTGTTCTCTT

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000537824_chr8_3855632_-_10381nt
GCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTAT
TTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCA
GTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGAC
GAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCC
TTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCT
AGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAG
TAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGAT
TGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGT
CTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGGGTTGGTGCAAATGTACAGTTTTCATG
TGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCAT
CTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAATGC
ACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACAC
CCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAG
CATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGG
AGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGC
GGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTT
CTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTAT
CTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCAT
TTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCA
GTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAA
CGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTC
CATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTC
CAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTC
TATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGAT
CGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTC
CAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCA
CGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAG
GAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGG
GTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTT
TCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCC
TCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATAT
CACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGA
CTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGC
ACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGA
TAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGA
TACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAG
CACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGT
AAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAA
CCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGC
GGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCAC
CTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTG
GGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCAC
CCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGG
TATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGG
ACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCT
GACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCC
GGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAG
CCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGC
CTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAG
AGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGT
GATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGT
AGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGG
ACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTC
GGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGG
CTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTC
TGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCC
CAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTC
CCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGAT
CAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCAC
CACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCT
GGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGA
CGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTA
TCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCC
CAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCA
TGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAG
CACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACA
GAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCC
TGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCC
TTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCT
CATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGG
TCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAA
GTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCC
ACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGAC
CGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCG
GACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACC
AAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAG
TCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGA
CCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAA
CAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACG
AAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTC
ATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGC
CGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTC
AGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGA
AGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAGCCT
TTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTTACGTGCAACACCGGCTACACGCTTGT
GGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCAGACCC
GATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAAC
TTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGC
CCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCG
AGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGC
CATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGG
ATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCC
TGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGA
CACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGAC
CCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTC
CCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACACCCAC
CAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGGCTCAT
GACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGTTGTGGGGATCCAGGCACACTAGCAAA
TGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGCTATGTCATGGAAGCAGTCACATCCGC
CACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAA
TGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCT
CTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCG
ACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTG
CCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGG
AATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCG
CACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGA
TGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAG
AACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAAC
TCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGT
TGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAA
GGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACT
AGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGA
AAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCC
TTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCA
TGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACAC

>In-frame_RTN3_ENST00000339997_chr11_63449250_+_CSMD1_ENST00000542608_chr8_3855632_-_9850nt
GCTCGGCTGAGTCAGTCAGTCTGTCGGAGTCTGTCCTCGGAGCAGGCGGAGTAAAGGGACTTGAGCGAGCCAGTTGCCGGATTATTCTAT
TTCCCCTCCCTCTCTCCCGCCCCGTATCTCTTTTCACCCTTCTCCCACCCTCGCTCGCGTAGCCATGGCGGAGCCGTCGGCGGCCACTCA
GTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGAC
GAAGAGCTGCAGCTCCTCCTGTGCGGCTGAGGGAGCCTGCGGAGGAACCTTACGCGGGACCAGCAGCTCCATCTCCAGCCCGCACTTCCC
TTCAGAGTACGAGAACAACGCGGACTGCACCTGGACCATTCTGGCTGAGCCCGGGGACACCATTGCGCTGGTCTTCACTGACTTTCAGCT
AGAAGAAGGATATGATTTCTTAGAGATCAGTGGCACGGAAGCTCCATCCATATGGCTAACTGGCATGAACCTCCCCTCTCCAGTTATCAG
TAGCAAGAATTGGCTACGACTCCATTTCACCTCTGACAGCAACCACCGACGCAAAGGATTTAACGCTCAGTTCCAAGTGAAAAAGGCGAT
TGAGTTGAAGTCAAGAGGAGTCAAGATGCTGCCCAGCAAGGATGGAAGCCATAAAAACTCTGTCTTGAGCCAAGGAGGTGTTGCATTGGT
CTCTGACATGTGTCCAGATCCTGGGATTCCAGAAAATGGTAGAAGAGCAGGTTCCGACTTCAGGGTTGGTGCAAATGTACAGTTTTCATG
TGAGGACAATTACGTGCTCCAGGGATCTAAAAGCATCACCTGTCAGAGAGTTACAGAGACGCTCGCTGCTTGGAGTGACCACAGGCCCAT
CTGCCGAGCGAGAACATGTGGATCCAATCTGCGTGGGCCCAGCGGCGTCATTACCTCCCCTAATTATCCGGTTCAGTATGAAGATAATGC
ACACTGTGTGTGGGTCATCACCACCACCGACCCGGACAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACAC
CCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAG
CATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGG
AGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGC
GGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTT
CTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTAT
CTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCAT
TTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCA
GTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAA
CGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTC
CATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTC
CAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTC
TATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGAT
CGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTC
CAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCA
CGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAG
GAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGG
GTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTT
TCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCC
TCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATAT
CACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGA
CTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGC
ACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGA
TAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGA
TACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAG
CACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGT
AAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAA
CCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGC
GGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCAC
CTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTG
GGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCAC
CCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGG
TATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGG
ACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCT
GACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCC
GGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAG
CCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGC
CTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAG
AGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGT
GATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGT
AGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGG
ACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTC
GGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGG
CTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTC
TGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCC
CAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTC
CCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGAT
CAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCAC
CACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCT
GGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGA
CGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTA
TCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCC
CAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCA
TGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAG
CACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACA
GAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCC
TGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCC
TTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCT
CATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGG
TCCCGATCAG