FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32330

FusionGeneSummary for RTF1_GANC

check button Fusion gene summary
Fusion gene informationFusion gene name: RTF1_GANC
Fusion gene ID: 32330
HgeneTgene
Gene symbol

RTF1

GANC

Gene ID

23168

2595

Gene nameRTF1 homolog, Paf1/RNA polymerase II complex componentglucosidase alpha, neutral C
SynonymsGTL7|KIAA0252-
Cytomap

15q15.1

15q15.1

Type of geneprotein-codingprotein-coding
DescriptionRNA polymerase-associated protein RTF1 homologRtf1, Paf1/RNA polymerase II complex component, homologortholog of mouse gene trap locus 7neutral alpha-glucosidase C
Modification date2018052320180519
UniProtAcc

Q92541

Q8TET4

Ensembl transtripts involved in fusion geneENST00000389629, ENST00000462276, 
ENST00000566442, ENST00000318010, 
ENST00000440615, 
Fusion gene scores* DoF score7 X 7 X 6=2945 X 5 X 3=75
# samples 95
** MAII scorelog2(9/294*10)=-1.70781924850669
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RTF1 [Title/Abstract] AND GANC [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRTF1

GO:0019827

stem cell population maintenance

19345177

HgeneRTF1

GO:0032968

positive regulation of transcription elongation from RNA polymerase II promoter

20178742

HgeneRTF1

GO:0045944

positive regulation of transcription by RNA polymerase II

20178742


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSKCMTCGA-EB-A42Z-01ARTF1chr15

41768017

+GANCchr15

42579889

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000389629ENST00000566442RTF1chr15

41768017

+GANCchr15

42579889

+
In-frameENST00000389629ENST00000318010RTF1chr15

41768017

+GANCchr15

42579889

+
5CDS-intronENST00000389629ENST00000440615RTF1chr15

41768017

+GANCchr15

42579889

+
intron-3CDSENST00000462276ENST00000566442RTF1chr15

41768017

+GANCchr15

42579889

+
intron-3CDSENST00000462276ENST00000318010RTF1chr15

41768017

+GANCchr15

42579889

+
intron-intronENST00000462276ENST00000440615RTF1chr15

41768017

+GANCchr15

42579889

+

Top

FusionProtFeatures for RTF1_GANC


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RTF1

Q92541

GANC

Q8TET4

Component of the PAF1 complex (PAF1C) which has multiplefunctions during transcription by RNA polymerase II and isimplicated in regulation of development and maintenance ofembryonic stem cell pluripotency. PAF1C associates with RNApolymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms andis involved in transcriptional elongation, acting bothindepentently and synergistically with TCEA1 and in cooperationwith the DSIF complex and HTATSF1. PAF1C is required fortranscription of Hox and Wnt target genes. PAF1C is involved inhematopoiesis and stimulates transcriptional activity ofKMT2A/MLL1; it promotes leukemogenesis through association withKMT2A/MLL1-rearranged oncoproteins, such as KMT2A/MLL1-MLLT3/AF9and KMT2A/MLL1-MLLT1/ENL. PAF1C is involved in histonemodifications such as ubiquitination of histone H2B andmethylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits theRNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzymeUBE2A or UBE2B to chromatin which mediate monoubiquitination of'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2Bubiquitination is proposed to be coupled to transcription. PAF1Cis involved in mRNA 3' end formation probably through associationwith cleavage and poly(A) factors. In case of infection byinfluenza A strain H3N2, PAF1C associates with viral NS1 protein,thereby regulating gene transcription. Binds single-stranded DNA.Required for maximal induction of heat-shock genes. Required forthe trimethylation of histone H3 'Lys-4' (H3K4me3) on genesinvolved in stem cell pluripotency; this function is synergisticwith CXXC1 indicative for an involvement of a SET1 complex (Bysimilarity). {ECO:0000250, ECO:0000269|PubMed:19345177,ECO:0000269|PubMed:20178742}. Has alpha-glucosidase activity.{ECO:0000269|PubMed:12370436}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRTF1chr15:41768017chr15:42579889ENST00000389629+111810_18494711Compositional biasNote=Poly-Ala
HgeneRTF1chr15:41768017chr15:42579889ENST00000389629+1118135_173494711Compositional biasNote=Ser-rich
HgeneRTF1chr15:41768017chr15:42579889ENST00000389629+1118174_345494711Compositional biasNote=Glu-rich
HgeneRTF1chr15:41768017chr15:42579889ENST00000389629+1118214_307494711Compositional biasNote=Lys-rich
HgeneRTF1chr15:41768017chr15:42579889ENST00000389629+1118353_484494711DomainPlus3

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRTF1chr15:41768017chr15:42579889ENST00000389629+1118526_560494711Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for RTF1_GANC


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RTF1_ENST00000389629_chr15_41768017_+_GANC_ENST00000566442_chr15_42579889_+_785aa
MRGRLCVGRAAAAAAAVAVPLAGGQEGSPGGGRRGSRGTTMVKKRKGRVVIDSDTEDSGSDENLDQELLSLAKRKRSDSEEKEPPVSQPA
ASSDSETSDSDDEWTFGSNKNKKKGKARKIEKKGTMKKQANKTASSGSSDKDSSAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEEFHD
GYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKKKKQEEEQEKKKLTQIQESQVTSHNKERRSK
RDEKLDKKSQAMEELKAEREKRKNRTAELLAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELN
RVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTES
EFMKWKEAMFSAGMQLPTLDEINKKELSIKEALNYKFNDQDIEEVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLIS
CSGDTGSLILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEETSVDTSQENQEDLGLWEEKFGKFV
DIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNTGDGDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVE

>In-frame_RTF1_ENST00000389629_chr15_41768017_+_GANC_ENST00000318010_chr15_42579889_+_1342aa
MRGRLCVGRAAAAAAAVAVPLAGGQEGSPGGGRRGSRGTTMVKKRKGRVVIDSDTEDSGSDENLDQELLSLAKRKRSDSEEKEPPVSQPA
ASSDSETSDSDDEWTFGSNKNKKKGKARKIEKKGTMKKQANKTASSGSSDKDSSAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEEFHD
GYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKKKKQEEEQEKKKLTQIQESQVTSHNKERRSK
RDEKLDKKSQAMEELKAEREKRKNRTAELLAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELN
RVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTES
EFMKWKEAMFSAGMQLPTLDEINKKELSIKEALNYKFNDQDIEEVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLIS
CSGDTGSLILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEETSVDTSQENQEDLGLWEEKFGKFV
DIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNTGDGDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVE
INTEPAVEYTLTQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSHLTGTQAMPPLFSLGYHQCRWNYEDEQDVKAVDA
GFDEHDIPYDAMWLDIEHTEGKRYFTWDKNRFPNPKRMQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWP
GLSSYLDFTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHRELHNIYGFYHQMATAEGLIKRSKGK
ERPFVLTRSFFAGSQKYGAVWTGDNTAEWSNLKISIPMLLTLSITGISFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRR
EPWLFGEEHTRLIREAIRERYGLLPYWYSLFYHAHVASQPVMRPLWVEFPDELKTFDMEDEYMLGSALLVHPVTEPKATTVDVFLPGSNE
VWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVIPIKTTVGKSTGWMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLHQKQFLHRK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RTF1_ENST00000389629_chr15_41768017_+_GANC_ENST00000566442_chr15_42579889_+_2355nt
ATGCGCGGTCGCCTTTGTGTGGGTCGAGCAGCGGCGGCGGCGGCGGCAGTGGCGGTCCCACTGGCAGGCGGGCAAGAGGGGAGTCCGGGC
GGCGGCCGGCGTGGGAGCCGGGGGACCACCATGGTAAAGAAGCGGAAAGGCCGCGTCGTGATCGACTCGGACACAGAGGACAGCGGCAGC
GACGAGAACCTGGATCAGGAGCTCTTGTCCCTGGCAAAGCGAAAGCGCAGTGACTCTGAGGAGAAGGAGCCGCCTGTGAGTCAGCCTGCA
GCCTCGTCAGACTCGGAGACGTCTGACAGTGACGATGAGTGGACATTTGGGAGCAATAAAAATAAGAAGAAAGGAAAAGCCAGAAAAATA
GAGAAGAAAGGAACCATGAAGAAACAGGCCAACAAAACTGCCTCCTCAGGCAGTTCAGACAAAGACAGTTCAGCTGAGAGCTCAGCCCCT
GAGGAAGGTGAAGTGTCAGACTCTGACAGCAACAGCTCCTCTTCCAGTTCAGATTCAGACTCTTCCTCAGAAGATGAAGAGTTCCATGAT
GGCTATGGAGAAGACCTCATGGGAGATGAGGAAGACAGGGCCCGTCTGGAACAGATGACAGAGAAAGAGAGAGAGCAAGAACTGTTCAAT
CGCATAGAGAAGAGGGAGGTGTTGAAAAGAAGATTTGAAATCAAGAAAAAACTAAAAACAGCCAAAAAGAAAGAAAAGAAAGAAAAGAAG
AAAAAGCAAGAAGAGGAGCAAGAAAAGAAAAAACTGACACAGATTCAAGAATCTCAGGTAACATCCCACAACAAGGAACGGCGTTCCAAG
CGGGATGAGAAACTAGACAAGAAATCTCAAGCCATGGAGGAGCTAAAAGCAGAGCGAGAAAAACGAAAGAACAGAACAGCTGAGCTCCTT
GCCAAAAAACAGCCATTAAAAACCAGTGAGGTCTACTCTGATGATGAAGAGGAGGAAGAGGATGACAAATCCAGTGAAAAGTCAGACCGC
TCATCACGAACATCATCGTCTGATGAAGAAGAGGAGAAAGAAGAGATCCCTCCCAAATCCCAACCAGTTTCCTTACCTGAAGAATTGAAT
CGGGTTCGATTATCACGGCATAAGCTAGAACGCTGGTGTCACATGCCCTTCTTTGCTAAAACTGTCACAGGATGTTTTGTGCGGATTGGC
ATCGGAAACCACAACAGCAAACCAGTTTACCGGGTCGCTGAGATTACGGGTGTTGTGGAAACTGCCAAAGTTTACCAACTAGGTGGCACC
AGAACAAACAAAGGGCTGCAACTACGGCATGGCAATGACCAACGCGTGTTCCGTTTAGAGTTTGTCTCAAACCAAGAATTCACCGAAAGT
GAGTTTATGAAGTGGAAAGAAGCGATGTTCTCTGCTGGCATGCAGTTGCCCACTCTAGATGAAATCAATAAAAAGGAATTATCTATTAAA
GAAGCTCTTAATTATAAATTCAATGATCAGGACATTGAAGAGGTTCCTCTCCTGGCTGAAATTTATGGTATAGAAGGAAACATTTTCAGG
CTTAAAATTAATGAAGAGACTCCTCTAAAACCCAGATTTGAAGTTCCGGATGTCCTCACAAGCAAGCCAAGCACTGTAAGGCTGATTTCA
TGCTCTGGGGACACAGGCAGTCTGATATTGGCAGATGGAAAAGGAGACCTGAAGTGCCATATCACAGCAAACCCATTCAAGGTAGACTTG
GTGTCTGAAGAAGAGGTTGTGATTAGCATAAATTCCCTGGGCCAATTATACTTTGAGCATCTACAGATTCTTCACAAACAAAGAGCTGCT
AAAGAAAATGAGGAGGAGACATCAGTGGACACCTCTCAGGAAAATCAAGAAGATCTGGGCCTGTGGGAAGAGAAATTTGGAAAATTTGTG
GATATCAAAGCTAATGGCCCTTCTTCTATTGGTTTGGATTTCTCCTTGCATGGATTTGAGCATCTTTATGGGATCCCACAACATGCAGAA
TCACACCAACTTAAAAATACTGGTGATGGAGATGCTTACCGTCTTTATAACCTGGATGTCTATGGATACCAAATATATGATAAAATGGGC
ATTTATGGTTCAGTACCTTATCTCCTGGCCCACAAACTGGGCAGAACTATAGGTATTTTCTGGCTGAATGCCTCGGAAACACTGGTGGAG
ATCAATACAGAGCCTGCAGTAGAGTACACACTGACCCAGATGGGCCCAGTTGCTGCTAAACAAAAGGTCAGATCTCGCACTCATGTGCAC
TGGATGTCAGAGAGTGGCATCATTGATGTTTTTCTGCTGACAGGACCTACACCTTCTGATGTCTTCAAACAGTACTCACACCTTACAGAC

>In-frame_RTF1_ENST00000389629_chr15_41768017_+_GANC_ENST00000318010_chr15_42579889_+_4026nt
ATGCGCGGTCGCCTTTGTGTGGGTCGAGCAGCGGCGGCGGCGGCGGCAGTGGCGGTCCCACTGGCAGGCGGGCAAGAGGGGAGTCCGGGC
GGCGGCCGGCGTGGGAGCCGGGGGACCACCATGGTAAAGAAGCGGAAAGGCCGCGTCGTGATCGACTCGGACACAGAGGACAGCGGCAGC
GACGAGAACCTGGATCAGGAGCTCTTGTCCCTGGCAAAGCGAAAGCGCAGTGACTCTGAGGAGAAGGAGCCGCCTGTGAGTCAGCCTGCA
GCCTCGTCAGACTCGGAGACGTCTGACAGTGACGATGAGTGGACATTTGGGAGCAATAAAAATAAGAAGAAAGGAAAAGCCAGAAAAATA
GAGAAGAAAGGAACCATGAAGAAACAGGCCAACAAAACTGCCTCCTCAGGCAGTTCAGACAAAGACAGTTCAGCTGAGAGCTCAGCCCCT
GAGGAAGGTGAAGTGTCAGACTCTGACAGCAACAGCTCCTCTTCCAGTTCAGATTCAGACTCTTCCTCAGAAGATGAAGAGTTCCATGAT
GGCTATGGAGAAGACCTCATGGGAGATGAGGAAGACAGGGCCCGTCTGGAACAGATGACAGAGAAAGAGAGAGAGCAAGAACTGTTCAAT
CGCATAGAGAAGAGGGAGGTGTTGAAAAGAAGATTTGAAATCAAGAAAAAACTAAAAACAGCCAAAAAGAAAGAAAAGAAAGAAAAGAAG
AAAAAGCAAGAAGAGGAGCAAGAAAAGAAAAAACTGACACAGATTCAAGAATCTCAGGTAACATCCCACAACAAGGAACGGCGTTCCAAG
CGGGATGAGAAACTAGACAAGAAATCTCAAGCCATGGAGGAGCTAAAAGCAGAGCGAGAAAAACGAAAGAACAGAACAGCTGAGCTCCTT
GCCAAAAAACAGCCATTAAAAACCAGTGAGGTCTACTCTGATGATGAAGAGGAGGAAGAGGATGACAAATCCAGTGAAAAGTCAGACCGC
TCATCACGAACATCATCGTCTGATGAAGAAGAGGAGAAAGAAGAGATCCCTCCCAAATCCCAACCAGTTTCCTTACCTGAAGAATTGAAT
CGGGTTCGATTATCACGGCATAAGCTAGAACGCTGGTGTCACATGCCCTTCTTTGCTAAAACTGTCACAGGATGTTTTGTGCGGATTGGC
ATCGGAAACCACAACAGCAAACCAGTTTACCGGGTCGCTGAGATTACGGGTGTTGTGGAAACTGCCAAAGTTTACCAACTAGGTGGCACC
AGAACAAACAAAGGGCTGCAACTACGGCATGGCAATGACCAACGCGTGTTCCGTTTAGAGTTTGTCTCAAACCAAGAATTCACCGAAAGT
GAGTTTATGAAGTGGAAAGAAGCGATGTTCTCTGCTGGCATGCAGTTGCCCACTCTAGATGAAATCAATAAAAAGGAATTATCTATTAAA
GAAGCTCTTAATTATAAATTCAATGATCAGGACATTGAAGAGGTTCCTCTCCTGGCTGAAATTTATGGTATAGAAGGAAACATTTTCAGG
CTTAAAATTAATGAAGAGACTCCTCTAAAACCCAGATTTGAAGTTCCGGATGTCCTCACAAGCAAGCCAAGCACTGTAAGGCTGATTTCA
TGCTCTGGGGACACAGGCAGTCTGATATTGGCAGATGGAAAAGGAGACCTGAAGTGCCATATCACAGCAAACCCATTCAAGGTAGACTTG
GTGTCTGAAGAAGAGGTTGTGATTAGCATAAATTCCCTGGGCCAATTATACTTTGAGCATCTACAGATTCTTCACAAACAAAGAGCTGCT
AAAGAAAATGAGGAGGAGACATCAGTGGACACCTCTCAGGAAAATCAAGAAGATCTGGGCCTGTGGGAAGAGAAATTTGGAAAATTTGTG
GATATCAAAGCTAATGGCCCTTCTTCTATTGGTTTGGATTTCTCCTTGCATGGATTTGAGCATCTTTATGGGATCCCACAACATGCAGAA
TCACACCAACTTAAAAATACTGGTGATGGAGATGCTTACCGTCTTTATAACCTGGATGTCTATGGATACCAAATATATGATAAAATGGGC
ATTTATGGTTCAGTACCTTATCTCCTGGCCCACAAACTGGGCAGAACTATAGGTATTTTCTGGCTGAATGCCTCGGAAACACTGGTGGAG
ATCAATACAGAGCCTGCAGTAGAGTACACACTGACCCAGATGGGCCCAGTTGCTGCTAAACAAAAGGTCAGATCTCGCACTCATGTGCAC
TGGATGTCAGAGAGTGGCATCATTGATGTTTTTCTGCTGACAGGACCTACACCTTCTGATGTCTTCAAACAGTACTCACACCTTACAGGC
ACACAAGCCATGCCCCCTCTTTTCTCTTTGGGATACCACCAGTGCCGCTGGAACTATGAAGATGAGCAGGATGTAAAAGCAGTGGATGCA
GGGTTTGATGAGCATGACATTCCTTATGATGCCATGTGGCTGGACATAGAGCACACTGAGGGCAAGAGGTACTTCACCTGGGACAAAAAC
AGATTCCCAAACCCCAAGAGGATGCAAGAGCTGCTCAGGAGCAAAAAGCGTAAGCTTGTGGTCATCAGTGATCCCCACATCAAGATTGAT
CCTGACTACTCAGTATATGTGAAGGCCAAAGATCAGGGCTTCTTTGTGAAGAATCAGGAAGGGGAAGACTTTGAAGGGGTGTGTTGGCCA
GGTCTCTCCTCTTACCTGGATTTCACCAATCCCAAGGTCAGAGAGTGGTATTCAAGTCTTTTTGCTTTCCCTGTTTATCAGGGATCTACG
GACATCCTCTTCCTTTGGAATGACATGAATGAGCCTTCTGTCTTTAGAGGGCCAGAGCAAACCATGCAGAAGAATGCCATTCATCATGGC
AATTGGGAGCACAGAGAGCTCCACAACATCTACGGTTTTTATCATCAAATGGCTACTGCAGAAGGACTGATAAAACGATCTAAAGGGAAG
GAGAGACCCTTTGTTCTTACACGTTCTTTCTTTGCTGGATCACAAAAGTATGGTGCCGTGTGGACAGGCGACAACACAGCAGAATGGAGC
AACTTGAAAATTTCTATCCCAATGTTACTCACTCTCAGCATTACTGGGATCTCTTTTTGCGGAGCTGACATAGGCGGGTTCATTGGGAAT
CCAGAGACAGAGCTGCTAGTGCGTTGGTACCAGGCTGGAGCCTACCAGCCCTTCTTCCGTGGCCATGCCACCATGAACACCAAGCGACGA
GAGCCCTGGCTCTTTGGGGAGGAACACACCCGACTCATCCGAGAAGCCATCAGAGAGCGCTATGGCCTCCTGCCATATTGGTATTCTCTG
TTCTACCATGCACACGTGGCTTCCCAACCTGTCATGAGGCCTCTGTGGGTAGAGTTCCCTGATGAACTAAAGACTTTTGATATGGAAGAT
GAATACATGCTGGGGAGTGCATTATTGGTTCATCCAGTCACAGAACCAAAAGCCACCACAGTTGATGTGTTTCTTCCAGGATCAAATGAG
GTCTGGTATGACTATAAGACATTTGCTCATTGGGAAGGAGGGTGTACTGTAAAGATCCCAGTAGCCTTGGACACTATTCCAGTGTTTCAG
CGAGGTGGAAGTGTGATACCAATAAAGACAACTGTAGGAAAATCCACAGGCTGGATGACTGAATCCTCCTATGGACTCCGGGTTGCTCTA
AGCACTAAGGGTTCTTCAGTGGGTGAGTTATATCTTGATGATGGCCATTCATTCCAATACCTCCACCAGAAGCAATTTTTGCACAGGAAG
TTTTCATTCTGTTCCAGTGTTCTGATCAATAGTTTTGCTGACCAGAGGGGTCATTATCCCAGCAAGTGTGTGGTGGAGAAGATCTTGGTC
TTAGGCTTCAGGAAGGAGCCATCTTCTGTGACTACCCACTCATCTGATGGTAAAGATCAGCCTGTGGCTTTTACGTATTGTGCCAAAACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_RTF1_ENST00000389629_chr15_41768017_+_GANC_ENST00000566442_chr15_42579889_+_3104nt
AGCGGAGCGCGCATGCGCGGTCGCCTTTGTGTGGGTCGAGCAGCGGCGGCGGCGGCGGCAGTGGCGGTCCCACTGGCAGGCGGGCAAGAG
GGGAGTCCGGGCGGCGGCCGGCGTGGGAGCCGGGGGACCACCATGGTAAAGAAGCGGAAAGGCCGCGTCGTGATCGACTCGGACACAGAG
GACAGCGGCAGCGACGAGAACCTGGATCAGGAGCTCTTGTCCCTGGCAAAGCGAAAGCGCAGTGACTCTGAGGAGAAGGAGCCGCCTGTG
AGTCAGCCTGCAGCCTCGTCAGACTCGGAGACGTCTGACAGTGACGATGAGTGGACATTTGGGAGCAATAAAAATAAGAAGAAAGGAAAA
GCCAGAAAAATAGAGAAGAAAGGAACCATGAAGAAACAGGCCAACAAAACTGCCTCCTCAGGCAGTTCAGACAAAGACAGTTCAGCTGAG
AGCTCAGCCCCTGAGGAAGGTGAAGTGTCAGACTCTGACAGCAACAGCTCCTCTTCCAGTTCAGATTCAGACTCTTCCTCAGAAGATGAA
GAGTTCCATGATGGCTATGGAGAAGACCTCATGGGAGATGAGGAAGACAGGGCCCGTCTGGAACAGATGACAGAGAAAGAGAGAGAGCAA
GAACTGTTCAATCGCATAGAGAAGAGGGAGGTGTTGAAAAGAAGATTTGAAATCAAGAAAAAACTAAAAACAGCCAAAAAGAAAGAAAAG
AAAGAAAAGAAGAAAAAGCAAGAAGAGGAGCAAGAAAAGAAAAAACTGACACAGATTCAAGAATCTCAGGTAACATCCCACAACAAGGAA
CGGCGTTCCAAGCGGGATGAGAAACTAGACAAGAAATCTCAAGCCATGGAGGAGCTAAAAGCAGAGCGAGAAAAACGAAAGAACAGAACA
GCTGAGCTCCTTGCCAAAAAACAGCCATTAAAAACCAGTGAGGTCTACTCTGATGATGAAGAGGAGGAAGAGGATGACAAATCCAGTGAA
AAGTCAGACCGCTCATCACGAACATCATCGTCTGATGAAGAAGAGGAGAAAGAAGAGATCCCTCCCAAATCCCAACCAGTTTCCTTACCT
GAAGAATTGAATCGGGTTCGATTATCACGGCATAAGCTAGAACGCTGGTGTCACATGCCCTTCTTTGCTAAAACTGTCACAGGATGTTTT
GTGCGGATTGGCATCGGAAACCACAACAGCAAACCAGTTTACCGGGTCGCTGAGATTACGGGTGTTGTGGAAACTGCCAAAGTTTACCAA
CTAGGTGGCACCAGAACAAACAAAGGGCTGCAACTACGGCATGGCAATGACCAACGCGTGTTCCGTTTAGAGTTTGTCTCAAACCAAGAA
TTCACCGAAAGTGAGTTTATGAAGTGGAAAGAAGCGATGTTCTCTGCTGGCATGCAGTTGCCCACTCTAGATGAAATCAATAAAAAGGAA
TTATCTATTAAAGAAGCTCTTAATTATAAATTCAATGATCAGGACATTGAAGAGGTTCCTCTCCTGGCTGAAATTTATGGTATAGAAGGA
AACATTTTCAGGCTTAAAATTAATGAAGAGACTCCTCTAAAACCCAGATTTGAAGTTCCGGATGTCCTCACAAGCAAGCCAAGCACTGTA
AGGCTGATTTCATGCTCTGGGGACACAGGCAGTCTGATATTGGCAGATGGAAAAGGAGACCTGAAGTGCCATATCACAGCAAACCCATTC
AAGGTAGACTTGGTGTCTGAAGAAGAGGTTGTGATTAGCATAAATTCCCTGGGCCAATTATACTTTGAGCATCTACAGATTCTTCACAAA
CAAAGAGCTGCTAAAGAAAATGAGGAGGAGACATCAGTGGACACCTCTCAGGAAAATCAAGAAGATCTGGGCCTGTGGGAAGAGAAATTT
GGAAAATTTGTGGATATCAAAGCTAATGGCCCTTCTTCTATTGGTTTGGATTTCTCCTTGCATGGATTTGAGCATCTTTATGGGATCCCA
CAACATGCAGAATCACACCAACTTAAAAATACTGGTGATGGAGATGCTTACCGTCTTTATAACCTGGATGTCTATGGATACCAAATATAT
GATAAAATGGGCATTTATGGTTCAGTACCTTATCTCCTGGCCCACAAACTGGGCAGAACTATAGGTATTTTCTGGCTGAATGCCTCGGAA
ACACTGGTGGAGATCAATACAGAGCCTGCAGTAGAGTACACACTGACCCAGATGGGCCCAGTTGCTGCTAAACAAAAGGTCAGATCTCGC
ACTCATGTGCACTGGATGTCAGAGAGTGGCATCATTGATGTTTTTCTGCTGACAGGACCTACACCTTCTGATGTCTTCAAACAGTACTCA
CACCTTACAGACATTGGAGAAAAATAGCTCTCAGTCTGAGGAAGATACTGAGAAAAGGAAAGAAGTTGAAAGCATCTTGAAGAAAAATTC
AGATTGGATATGGGATTGGACAAGTTGGCCAGAAAATATTCCCCACAAGGAGTTCCTCTTTAAAGCACCTGAAGCACGTAGCTACCCAGC
ATGGAATTTAAAGCCTGATGAGGAAAGGGGGCATTTTCTCAGCAGAATTTCCAAAGGGTTTTGCTGCTGTCTCATCTGGTGGCCATGGGA
TTGGGGATCTATATTGGAAGGCATCTGACAACTTCTACCAGCACCTTTTGATGAATAATTTGAATCCAGCTTTGTGCGTATAGTGGGGAT
TTCTATCTGAGCTTGTGACACAGCTAACTCAGGAGCTGTTATGGTCCTTGGGTGGCTGTTTCACTTGTTTTTATTTGTTCTGTAAATACT
GCTTTCCTAATTTAGTAAAATGAAAGAATAGACACTAAAATCACACTGACCTATACTTATACCTATAGAATCAGTTAATAAGGGTATCAG
ACTGATTAATATCTACTGTAACAATTTGGCAGTGAGTTTTCTTTGGATATTAGTATAAATATGTAAGTATCGTTTTAATATATTAGTCAT
GATATAGCATTTTAAAAATTATCTGTAACCTGAATTCTGTTAAAACACTTTATATTCCAAAAGAATGAATGACAGTGATATTAAAATCAC

>In-frame_RTF1_ENST00000389629_chr15_41768017_+_GANC_ENST00000318010_chr15_42579889_+_5565nt
AGCGGAGCGCGCATGCGCGGTCGCCTTTGTGTGGGTCGAGCAGCGGCGGCGGCGGCGGCAGTGGCGGTCCCACTGGCAGGCGGGCAAGAG
GGGAGTCCGGGCGGCGGCCGGCGTGGGAGCCGGGGGACCACCATGGTAAAGAAGCGGAAAGGCCGCGTCGTGATCGACTCGGACACAGAG
GACAGCGGCAGCGACGAGAACCTGGATCAGGAGCTCTTGTCCCTGGCAAAGCGAAAGCGCAGTGACTCTGAGGAGAAGGAGCCGCCTGTG
AGTCAGCCTGCAGCCTCGTCAGACTCGGAGACGTCTGACAGTGACGATGAGTGGACATTTGGGAGCAATAAAAATAAGAAGAAAGGAAAA
GCCAGAAAAATAGAGAAGAAAGGAACCATGAAGAAACAGGCCAACAAAACTGCCTCCTCAGGCAGTTCAGACAAAGACAGTTCAGCTGAG
AGCTCAGCCCCTGAGGAAGGTGAAGTGTCAGACTCTGACAGCAACAGCTCCTCTTCCAGTTCAGATTCAGACTCTTCCTCAGAAGATGAA
GAGTTCCATGATGGCTATGGAGAAGACCTCATGGGAGATGAGGAAGACAGGGCCCGTCTGGAACAGATGACAGAGAAAGAGAGAGAGCAA
GAACTGTTCAATCGCATAGAGAAGAGGGAGGTGTTGAAAAGAAGATTTGAAATCAAGAAAAAACTAAAAACAGCCAAAAAGAAAGAAAAG
AAAGAAAAGAAGAAAAAGCAAGAAGAGGAGCAAGAAAAGAAAAAACTGACACAGATTCAAGAATCTCAGGTAACATCCCACAACAAGGAA
CGGCGTTCCAAGCGGGATGAGAAACTAGACAAGAAATCTCAAGCCATGGAGGAGCTAAAAGCAGAGCGAGAAAAACGAAAGAACAGAACA
GCTGAGCTCCTTGCCAAAAAACAGCCATTAAAAACCAGTGAGGTCTACTCTGATGATGAAGAGGAGGAAGAGGATGACAAATCCAGTGAA
AAGTCAGACCGCTCATCACGAACATCATCGTCTGATGAAGAAGAGGAGAAAGAAGAGATCCCTCCCAAATCCCAACCAGTTTCCTTACCT
GAAGAATTGAATCGGGTTCGATTATCACGGCATAAGCTAGAACGCTGGTGTCACATGCCCTTCTTTGCTAAAACTGTCACAGGATGTTTT
GTGCGGATTGGCATCGGAAACCACAACAGCAAACCAGTTTACCGGGTCGCTGAGATTACGGGTGTTGTGGAAACTGCCAAAGTTTACCAA
CTAGGTGGCACCAGAACAAACAAAGGGCTGCAACTACGGCATGGCAATGACCAACGCGTGTTCCGTTTAGAGTTTGTCTCAAACCAAGAA
TTCACCGAAAGTGAGTTTATGAAGTGGAAAGAAGCGATGTTCTCTGCTGGCATGCAGTTGCCCACTCTAGATGAAATCAATAAAAAGGAA
TTATCTATTAAAGAAGCTCTTAATTATAAATTCAATGATCAGGACATTGAAGAGGTTCCTCTCCTGGCTGAAATTTATGGTATAGAAGGA
AACATTTTCAGGCTTAAAATTAATGAAGAGACTCCTCTAAAACCCAGATTTGAAGTTCCGGATGTCCTCACAAGCAAGCCAAGCACTGTA
AGGCTGATTTCATGCTCTGGGGACACAGGCAGTCTGATATTGGCAGATGGAAAAGGAGACCTGAAGTGCCATATCACAGCAAACCCATTC
AAGGTAGACTTGGTGTCTGAAGAAGAGGTTGTGATTAGCATAAATTCCCTGGGCCAATTATACTTTGAGCATCTACAGATTCTTCACAAA
CAAAGAGCTGCTAAAGAAAATGAGGAGGAGACATCAGTGGACACCTCTCAGGAAAATCAAGAAGATCTGGGCCTGTGGGAAGAGAAATTT
GGAAAATTTGTGGATATCAAAGCTAATGGCCCTTCTTCTATTGGTTTGGATTTCTCCTTGCATGGATTTGAGCATCTTTATGGGATCCCA
CAACATGCAGAATCACACCAACTTAAAAATACTGGTGATGGAGATGCTTACCGTCTTTATAACCTGGATGTCTATGGATACCAAATATAT
GATAAAATGGGCATTTATGGTTCAGTACCTTATCTCCTGGCCCACAAACTGGGCAGAACTATAGGTATTTTCTGGCTGAATGCCTCGGAA
ACACTGGTGGAGATCAATACAGAGCCTGCAGTAGAGTACACACTGACCCAGATGGGCCCAGTTGCTGCTAAACAAAAGGTCAGATCTCGC
ACTCATGTGCACTGGATGTCAGAGAGTGGCATCATTGATGTTTTTCTGCTGACAGGACCTACACCTTCTGATGTCTTCAAACAGTACTCA
CACCTTACAGGCACACAAGCCATGCCCCCTCTTTTCTCTTTGGGATACCACCAGTGCCGCTGGAACTATGAAGATGAGCAGGATGTAAAA
GCAGTGGATGCAGGGTTTGATGAGCATGACATTCCTTATGATGCCATGTGGCTGGACATAGAGCACACTGAGGGCAAGAGGTACTTCACC
TGGGACAAAAACAGATTCCCAAACCCCAAGAGGATGCAAGAGCTGCTCAGGAGCAAAAAGCGTAAGCTTGTGGTCATCAGTGATCCCCAC
ATCAAGATTGATCCTGACTACTCAGTATATGTGAAGGCCAAAGATCAGGGCTTCTTTGTGAAGAATCAGGAAGGGGAAGACTTTGAAGGG
GTGTGTTGGCCAGGTCTCTCCTCTTACCTGGATTTCACCAATCCCAAGGTCAGAGAGTGGTATTCAAGTCTTTTTGCTTTCCCTGTTTAT
CAGGGATCTACGGACATCCTCTTCCTTTGGAATGACATGAATGAGCCTTCTGTCTTTAGAGGGCCAGAGCAAACCATGCAGAAGAATGCC
ATTCATCATGGCAATTGGGAGCACAGAGAGCTCCACAACATCTACGGTTTTTATCATCAAATGGCTACTGCAGAAGGACTGATAAAACGA
TCTAAAGGGAAGGAGAGACCCTTTGTTCTTACACGTTCTTTCTTTGCTGGATCACAAAAGTATGGTGCCGTGTGGACAGGCGACAACACA
GCAGAATGGAGCAACTTGAAAATTTCTATCCCAATGTTACTCACTCTCAGCATTACTGGGATCTCTTTTTGCGGAGCTGACATAGGCGGG
TTCATTGGGAATCCAGAGACAGAGCTGCTAGTGCGTTGGTACCAGGCTGGAGCCTACCAGCCCTTCTTCCGTGGCCATGCCACCATGAAC
ACCAAGCGACGAGAGCCCTGGCTCTTTGGGGAGGAACACACCCGACTCATCCGAGAAGCCATCAGAGAGCGCTATGGCCTCCTGCCATAT
TGGTATTCTCTGTTCTACCATGCACACGTGGCTTCCCAACCTGTCATGAGGCCTCTGTGGGTAGAGTTCCCTGATGAACTAAAGACTTTT
GATATGGAAGATGAATACATGCTGGGGAGTGCATTATTGGTTCATCCAGTCACAGAACCAAAAGCCACCACAGTTGATGTGTTTCTTCCA
GGATCAAATGAGGTCTGGTATGACTATAAGACATTTGCTCATTGGGAAGGAGGGTGTACTGTAAAGATCCCAGTAGCCTTGGACACTATT
CCAGTGTTTCAGCGAGGTGGAAGTGTGATACCAATAAAGACAACTGTAGGAAAATCCACAGGCTGGATGACTGAATCCTCCTATGGACTC
CGGGTTGCTCTAAGCACTAAGGGTTCTTCAGTGGGTGAGTTATATCTTGATGATGGCCATTCATTCCAATACCTCCACCAGAAGCAATTT
TTGCACAGGAAGTTTTCATTCTGTTCCAGTGTTCTGATCAATAGTTTTGCTGACCAGAGGGGTCATTATCCCAGCAAGTGTGTGGTGGAG
AAGATCTTGGTCTTAGGCTTCAGGAAGGAGCCATCTTCTGTGACTACCCACTCATCTGATGGTAAAGATCAGCCTGTGGCTTTTACGTAT
TGTGCCAAAACATCCATCCTGAGCCTGGAGAAGCTCTCACTCAACATTGCCACTGACTGGGAGGTCCGCATCATATGACAAAGAACTGCC
CCTGGTGATGTGAGCAGGGACCTGCCTGCCCCTTTCAACCTTTCCCCTCACCTTTTTTGAGATTTTTGCTGCAATCTGTTTGCCTTCCCT
GAATCAAAATAATCTTTCATTCGTCACCATTATACTAATGAACAATAGATTTCATGTTTCAAAATTTCAGATTTTACATGTTAAGATGTA
CTAACAATATTCCTTGTATCAAACATCTCCTTTTCTCCCTGATACATAGCCCTGAGACATTTATAGCGTTCAGGAGTCTTCTATTGCTTC
CATTCCTTCAGCAGGGCTGCGTGGGTCTGTTTTAACGTGGGCCAAGCCTACCTGGGCAGCCCATTTGCCAGGGCTTGCCTCAGGCCATGC
AGCATTGGCGCTCTGGCTGCAGCAGCTGAGTTGCTCAAGGCCAGTGTCCAAGTGGACAGCAGCCTCTGGTACTCCCCCCAGTTATCTTCC
ACCCACATGGACTGGGCAGAGCAGCCCTCTTCTGTGTGCACTGCATACGCTGCAGCCGTGGGAGTTATTCTCCCCTAGAGATCGACTTGG
CAGCACGAAGGATTCTTTTCTCTTTCATGCTTCTCAGGCTCAATAGTTTCTAATTAATCTTAAAATCCATGTCTTTTACATTGTTTTTTT
AATTAAGTGCTGTTTACTAACCAAATAATATTTATAACATGAGTAAGCTATAATTAATAACAATGAAATAAATACCCATGTACCCACCAC
TGGACTTCAGAAGTAGAACTCATGACTGGGACTAGGATGAGGCAAGGGAGACCCTGGCCTTGGGCACAAAATGTAAGGGATGCCAAAAAA
ATACAGTAATCAAAGTAAGTAATATTTCAATCCAATATTTTTAAAAATCAGAATTAATGCAAAAAAAACCATGATGAACAAAATATTAAA
ATTTAAAATAAAGACAGGATTAGTATTACTGAGTTTTCCTTTTGTCCCAGGCTCTAATATGGCTTGGCATGGGGCAGAACATTACAACAT
ACCAGTCGTGTCATGGTGCCCAAGGCTCCACAGACCTCAGTGGCTCCCTGCTGCCTGCCACAGCATCTGTTTTAGCAGCCTCGACTCCTC
AGCACTCCTCAGCACACACCTCTTCTTATCAGGCTTCCTCCACTTAGCAACTTGCTAACGGCCACCTCTGTGCCTTCTGATCCCTGGGCG
CCAATATCCTCCTGCCCTTACCATCCTTCCAGGCCCAACTTAAATCCCACTTTCCCATGAAGCCTAACTGCGTGAACACCCCTACCCCCA
TACCCATTAGCAGTGATTTTGCCCTTCCCCGTAATGCTGTCCCACTTATAACTGTGCTCTACTTAGCATTCTCAGGGATCATACCTTAAT
GTTTTCAGTATGTCTGCGTTCTCCTACTAGATTGTATGTCCCTCAAGAGCATGTTCTGTTTCTCTTCTGTCTGACAGAGCACTATTATAC


Top

FusionGenePPI for RTF1_GANC


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RTF1ARRB1, PAF1, CTR9, LEO1, TCEA1, CDC73, WDR61, NEDD4, HADHA, HADHB, PTPN11, APP, SUPT16H, CSNK2A1, SSRP1, TRPM8, CD81, DNMT3B, DNMT3A, SRPK2, ETF1, GSPT1, SNX6, YAP1, STAT1, DENND2D, CHD1, RPL37, BRD4, NUMA1, RPL35A, UBTF, ZC3H18, SRRM2, SUPT5H, NTRK1, PIP4K2A, ARRB2GANCSMC1A, FGFR1OP2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RTF1_GANC


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneGANCQ8TET4DB00491MiglitolNeutral alpha-glucosidase Csmall moleculeapproved

Top

RelatedDiseases for RTF1_GANC


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource