FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32317

FusionGeneSummary for RSU1_FANCI

check button Fusion gene summary
Fusion gene informationFusion gene name: RSU1_FANCI
Fusion gene ID: 32317
HgeneTgene
Gene symbol

RSU1

FANCI

Gene ID

6251

55215

Gene nameRas suppressor protein 1FA complementation group I
SynonymsRSP-1KIAA1794
Cytomap

10p13

15q26.1

Type of geneprotein-codingprotein-coding
Descriptionras suppressor protein 1ras suppressor protein 1 variant 1ras suppressor protein 1 variant 2ras suppressor protein 1 variant 3ras suppressor protein 1 variant 5rsu-1Fanconi anemia group I proteinFanconi anemia complementation group I
Modification date2018052220180523
UniProtAcc

Q15404

Q9NVI1

Ensembl transtripts involved in fusion geneENST00000377921, ENST00000345264, 
ENST00000602389, ENST00000464074, 
ENST00000300027, ENST00000310775, 
ENST00000451393, ENST00000567996, 
ENST00000566615, 
Fusion gene scores* DoF score6 X 4 X 6=1442 X 2 X 2=8
# samples 62
** MAII scorelog2(6/144*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: RSU1 [Title/Abstract] AND FANCI [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneFANCI

GO:0031398

positive regulation of protein ubiquitination

18029348


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A1L4-01ARSU1chr10

16858972

-FANCIchr15

89816608

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000377921ENST00000300027RSU1chr10

16858972

-FANCIchr15

89816608

+
In-frameENST00000377921ENST00000310775RSU1chr10

16858972

-FANCIchr15

89816608

+
5CDS-intronENST00000377921ENST00000451393RSU1chr10

16858972

-FANCIchr15

89816608

+
5CDS-intronENST00000377921ENST00000567996RSU1chr10

16858972

-FANCIchr15

89816608

+
5CDS-intronENST00000377921ENST00000566615RSU1chr10

16858972

-FANCIchr15

89816608

+
Frame-shitENST00000345264ENST00000300027RSU1chr10

16858972

-FANCIchr15

89816608

+
Frame-shitENST00000345264ENST00000310775RSU1chr10

16858972

-FANCIchr15

89816608

+
5CDS-intronENST00000345264ENST00000451393RSU1chr10

16858972

-FANCIchr15

89816608

+
5CDS-intronENST00000345264ENST00000567996RSU1chr10

16858972

-FANCIchr15

89816608

+
5CDS-intronENST00000345264ENST00000566615RSU1chr10

16858972

-FANCIchr15

89816608

+
intron-3CDSENST00000602389ENST00000300027RSU1chr10

16858972

-FANCIchr15

89816608

+
intron-3CDSENST00000602389ENST00000310775RSU1chr10

16858972

-FANCIchr15

89816608

+
intron-intronENST00000602389ENST00000451393RSU1chr10

16858972

-FANCIchr15

89816608

+
intron-intronENST00000602389ENST00000567996RSU1chr10

16858972

-FANCIchr15

89816608

+
intron-intronENST00000602389ENST00000566615RSU1chr10

16858972

-FANCIchr15

89816608

+
intron-3CDSENST00000464074ENST00000300027RSU1chr10

16858972

-FANCIchr15

89816608

+
intron-3CDSENST00000464074ENST00000310775RSU1chr10

16858972

-FANCIchr15

89816608

+
intron-intronENST00000464074ENST00000451393RSU1chr10

16858972

-FANCIchr15

89816608

+
intron-intronENST00000464074ENST00000567996RSU1chr10

16858972

-FANCIchr15

89816608

+
intron-intronENST00000464074ENST00000566615RSU1chr10

16858972

-FANCIchr15

89816608

+

Top

FusionProtFeatures for RSU1_FANCI


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RSU1

Q15404

FANCI

Q9NVI1

Potentially plays a role in the Ras signal transductionpathway. Capable of suppressing v-Ras transformation in vitro. Plays an essential role in the repair of DNA double-strand breaks by homologous recombination and in the repair ofinterstrand DNA cross-links (ICLs) by promoting FANCD2monoubiquitination by FANCL and participating in recruitment toDNA repair sites. Required for maintenance of chromosomalstability. Specifically binds branched DNA: binds both single-stranded DNA (ssDNA) and double-stranded DNA (dsDNA). Participatesin S phase and G2 phase checkpoint activation upon DNA damage.{ECO:0000269|PubMed:17412408, ECO:0000269|PubMed:17452773,ECO:0000269|PubMed:17460694, ECO:0000269|PubMed:19111657}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRSU1chr10:16858972chr15:89816608ENST00000345264-29110_13336278RepeatNote=LRR 4
HgeneRSU1chr10:16858972chr15:89816608ENST00000345264-29135_15636278RepeatNote=LRR 5
HgeneRSU1chr10:16858972chr15:89816608ENST00000345264-29158_17936278RepeatNote=LRR 6
HgeneRSU1chr10:16858972chr15:89816608ENST00000345264-29181_20236278RepeatNote=LRR 7
HgeneRSU1chr10:16858972chr15:89816608ENST00000345264-2941_6336278RepeatNote=LRR 1
HgeneRSU1chr10:16858972chr15:89816608ENST00000345264-2964_8536278RepeatNote=LRR 2
HgeneRSU1chr10:16858972chr15:89816608ENST00000345264-2987_10936278RepeatNote=LRR 3
HgeneRSU1chr10:16858972chr15:89816608ENST00000377921-18110_13336278RepeatNote=LRR 4
HgeneRSU1chr10:16858972chr15:89816608ENST00000377921-18135_15636278RepeatNote=LRR 5
HgeneRSU1chr10:16858972chr15:89816608ENST00000377921-18158_17936278RepeatNote=LRR 6
HgeneRSU1chr10:16858972chr15:89816608ENST00000377921-18181_20236278RepeatNote=LRR 7
HgeneRSU1chr10:16858972chr15:89816608ENST00000377921-1841_6336278RepeatNote=LRR 1
HgeneRSU1chr10:16858972chr15:89816608ENST00000377921-1864_8536278RepeatNote=LRR 2
HgeneRSU1chr10:16858972chr15:89816608ENST00000377921-1887_10936278RepeatNote=LRR 3
HgeneRSU1chr10:16858972chr15:89816608ENST00000602389-18110_133-64225RepeatNote=LRR 4
HgeneRSU1chr10:16858972chr15:89816608ENST00000602389-18135_156-64225RepeatNote=LRR 5
HgeneRSU1chr10:16858972chr15:89816608ENST00000602389-18158_179-64225RepeatNote=LRR 6
HgeneRSU1chr10:16858972chr15:89816608ENST00000602389-18181_202-64225RepeatNote=LRR 7
HgeneRSU1chr10:16858972chr15:89816608ENST00000602389-1841_63-64225RepeatNote=LRR 1
HgeneRSU1chr10:16858972chr15:89816608ENST00000602389-1864_85-64225RepeatNote=LRR 2
HgeneRSU1chr10:16858972chr15:89816608ENST00000602389-1887_109-64225RepeatNote=LRR 3


Top

FusionGeneSequence for RSU1_FANCI


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RSU1_ENST00000377921_chr10_16858972_-_FANCI_ENST00000300027_chr15_89816608_+_1011aa
MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLCRTARRFQ__LKSLQHCSSSVCNKNTKISGPGA_SFKDFGCKEL_GSSTPPRLK
ISSESSSS_ILCFNHDLGSSEE_RS_LGPCYSGPRRTWFHFDGFIWAKEGS_WKNT_NQPKSF_NAKPACM_ARS_TPVGNF_DP_DDQT
RNFGAGPQQGCYQSIFSHQSFLRPAFKTRHVCTLSSSKLFF_SHRSF_LFVLSAPSDCTKAA_GSAAPSQSQHVNERLLDTCPSESTVCQ
PA_CPKICSCWVFAAPEEL_SFRQPVILSVQSVSQCQSGSCGCSQPLQFCRQ_NFLP_DHG_FEEMLKPAS_CSTHAL_GVL_CSSKELS
AG_FSHANSALTVKTVL_AKT_SAASSEIRSLTSDPRR_DLSTRTTGLSAVLTSALFGLV_EYSHTLTAGRGGRGGGRGILRRPR_TIGV
HY__ND_E_AGRL_TG_ISRFFSEHQTWHKK_TLCFSCDGSL_GFNRIQFLHK_FQ_E_V_GHSELITVLQKTL_HS__KSG_SQN_NGQ
QDK__SFVHEICVQSSHCSFQSLAMEIHFNSYFSGRVGKERERKEHLTAVLGGFTENIQCCATVLSAQDSAVSQSSGCHR_GRRRERRCR
CQCHSENSIPDPAISEVLVEFT_QSRGRF__QRSPPASHGSYQFVQVTGALLSSVCADVILDIKDLQGKQPGGCLVLQELDELALQPACF
V_ESCHSAA_LVPGTPRASGRTRPGCRGGENKPLCNSEFENGCPHCLFTCSESGREGSRRSGLANHQA_GTSEPRNLIRRGLFSGNPTKS
AC_ESTHHATGNSAYIFPRAGADSSAIRQLCGHLVKGLVQNVHHTYSPCQILSPGVSELRRNSKKTGKAGEAVWFSSDPPVLFFHFLRTE
_E_EPELYGREKGETCCRCHSHGQSSSGNQANP_PHLCHRTV_KISHPPF_EVQGEPDAAHEAQHLTRLQDQRKHPRHGSSRGW_R_K_R

>In-frame_RSU1_ENST00000377921_chr10_16858972_-_FANCI_ENST00000310775_chr15_89816608_+_1071aa
MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLCRTARRFQ__LKSLQHCSSSVCNKNTKISGPGA_SFKDFGCKEL_GSSTPPRLK
ISSESSSS_ILCFNHDLGSSEE_RS_LGPCYSGPRRTWFHFDGFIWAKEGS_WKNT_NQPKSF_NAKPACM_ARS_TPVGNF_DP_DDQT
RNFGAGPQQGCYQSIFSHQSFLRPAFKTRHVCTLSSSKLFF_SHRSF_LFVLSAPSDCTKAA_GSAAPSQSQHVNERLLDTCPSESTVCQ
PA_CPKICSCWVFAAPEEL_SFRQPVILSVQSVSQCQSGSCGCSQPLQFCRQ_NFLP_DHG_FEEMLKPAS_CSTHAL_GVL_CSSKELS
AG_FSHANSALTVKTVL_AKT_SAASSEIRSLTSDPRR_DLSTRTTGLSAVLTSALFGLV_EYSHTLTAGRGGRGGGRGILRRPR_TIGV
HY__ND_E_AGRL_TG_ISRFFSEHQTWHKK_TLCFSCDGSL_GFNRIQFLHK_FQ_E_V_GHSELITVLQKTL_HS__KSG_SQN_NGQ
QDK__SFVHEICVQSSHCSFQG_TPKPPRKPFCSQVQQ_VTALCSECSSAEGTAAKGNRACEWP_WPKPRKDLSEPL_HNSSLAMEIHFN
SYFSGRVGKERERKEHLTAVLGGFTENIQCCATVLSAQDSAVSQSSGCHR_GRRRERRCRCQCHSENSIPDPAISEVLVEFT_QSRGRF_
_QRSPPASHGSYQFVQVTGALLSSVCADVILDIKDLQGKQPGGCLVLQELDELALQPACFV_ESCHSAA_LVPGTPRASGRTRPGCRGGE
NKPLCNSEFENGCPHCLFTCSESGREGSRRSGLANHQA_GTSEPRNLIRRGLFSGNPTKSAC_ESTHHATGNSAYIFPRAGADSSAIRQL
CGHLVKGLVQNVHHTYSPCQILSPGVSELRRNSKKTGKAGEAVWFSSDPPVLFFHFLRTE_E_EPELYGREKGETCCRCHSHGQSSSGNQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RSU1_ENST00000377921_chr10_16858972_-_FANCI_ENST00000300027_chr15_89816608_+_3034nt
ATGTCCAAGTCTCTGAAGAAGTTGGTGGAGGAGAGCCGGGAGAAGAACCAGCCCGAGGTGGACATGAGTGACCGGGGCATCTCCAACATG
CTGGATGTCAACGGCCTCTGTAGGACAGCAAGGAGATTCCAATAATAACTTAAGTCCCTTCAGCATTGCTCTTCTTCTGTCTGTAACAAG
AATACAAAGATTTCAGGACCAGGTGCTTGATCTTTTAAAGACTTCGGTTGTAAAGAGCTTTAAGGATCTTCAACTCCTCCAAGGCTCAAA
ATTTCTTCAGAATCTAGTTCCTCATAGATCTTATGTTTCAACCATGATCTTGGAAGTAGTGAAGAATAGCGTTCATAGCTGGGACCATGT
TACTCAGGGCCTCGTAGAACTTGGTTTCATTTTGATGGATTCATATGGGCCAAAGAAGGTTCTTGATGGAAAAACTATTGAAACCAGCCC
AAGTCTTTCTAGAATGCCAAACCAGCATGCATGTAAGCTCGGAGCTAATATCCTGTTGGAAACTTTTAAGATCCATGAGATGATCAGACA
AGAAATTTTGGAGCAGGTCCTCAACAGGGTTGTTACCAGAGCATCTTCTCCCATCAGTCATTTCTTAGACCTGCTTTCAAATATCGTCAT
GTATGCACCCTTAGTTCTTCAAAGTTGTTCTTCTAAAGTCACAGAAGCTTTTGACTATTTGTCCTTTCTGCCCCTTCAGACTGTACAAAG
GCTGCTTAAGGCAGTGCAGCCCCTTCTCAAAGTCAGCATGTCAATGAGAGACTGCTTGATACTTGTCCTTCGGAAAGCTATGTTTGCCAA
CCAGCTTGATGCCCGAAAATCTGCAGTTGCTGGGTTTTTGCTGCTCCTGAAGAACTTTAAAGTTTTAGGCAGCCTGTCATCCTCTCAGTG
CAGTCAGTCTCTCAGTGTCAGTCAGGTTCATGTGGATGTTCACAGCCATTACAATTCTGTCGCCAATGAAACTTTTTGCCTTGAGATCAT
GGATAGTTTGAGGAGATGCTTAAGCCAGCAAGCTGATGTTCGACTCATGCTTTATGAGGGGTTTTATGATGTTCTTCGAAGGAACTCTCA
GCTGGCTAATTCAGTCATGCAAACTCTGCTCTCACAGTTAAAACAGTTCTATGAGCCAAAACCTGATCTGCTGCCTCCTCTGAAATTAGA
AGCTTGTATTCTGACCCAAGGAGATAAGATCTCTCTACAAGAACCACTGGATTATCTGCTGTGTTGTATTCAGCATTGTTTGGCCTGGTA
TAAGAATACAGTCATACCCTTACAGCAGGGAGAGGAGGAAGAGGAGGAGGAAGAGGCATTCTACGAAGACCTAGATGATATATTGGAGTC
CATTACTAATAGAATGATTAAGAGTGAGCTGGAAGACTTTGAACTGGATAAATCAGCAGATTTTTCTCAGAGCACCAGTATTGGCATAAA
AAATAATATCTGTGCTTTTCTTGTGATGGGAGTTTGTGAGGTTTTAATAGAATACAATTTCTCCATAAGTAGTTTCAGTAAGAATAGGTT
TGAGGACATTCTGAGCTTATTTATGTGTTACAAAAAACTCTCTGACATTCTTAATGAAAAAGCGGGTAAAGCCAAAACTAAAATGGCCAA
CAAGACAAGTGATAGTCTTTTGTCCATGAAATTTGTGTCCAGTCTTCTCACTGCTCTTTTCAGAGTCTTGCTATGGAGATACACTTCAAT
TCCTACTTCAGTGGAAGAGTCGGGAAAGAAAGAGAAAGGAAAGAGCATCTCACTGCTGTGCTTGGAGGGTTTACAGAAAATATTCAGTGC
TGTGCAACAGTTCTATCAGCCCAAGATTCAGCAGTTTCTCAGAGCTCTGGATGTCACAGATAAGGAAGGAGAAGAGAGAGAAGATGCAGA
TGTCAGTGTCACTCAGAGAACAGCATTCCAGATCCGGCAATTTCAGAGGTCCTTGTTGAATTTACTTAGCAGTCAAGAGGAAGATTTTAA
TAGCAAAGAAGCCCTCCTGCTAGTCACGGTTCTTACCAGTTTGTCCAAGTTACTGGAGCCCTCCTCTCCTCAGTTTGTGCAGATGTTATC
CTGGACATCAAAGATTTGCAAGGAAAACAGCCGGGAGGATGCCTTGTTTTGCAAGAGCTTGATGAACTTGCTCTTCAGCCTGCATGTTTC
GTATAAGAGTCCTGTCATTCTGCTGCGTGACTTGTCCCAGGATATCCACGGGCATCTGGGAGATATAGACCAGGATGTAGAGGTGGAGAA
AACAAACCACTTTGCAATAGTGAATTTGAGAACGGCTGCCCCCACTGTCTGTTTACTTGTTCTGAGTCAGGCCGAGAAGGTTCTAGAAGA
AGTGGACTGGCTAATCACCAAGCTTAAGGGACAAGTGAGCCAAGAAACCTTATCAGAAGAGGCCTCTTCTCAGGCAACCCTACCAAATCA
GCCTGTTGAGAAAGCTATCATCATGCAACTGGGAACTCTGCTTACATTTTTCCACGAGCTGGTGCAGACAGCTCTGCCATCAGGCAGCTG
TGTGGACACCTTGTTAAAGGACTTGTGCAAAATGTACACCACACTTACAGCCCTTGTCAGATATTATCTCCAGGTGTGTCAGAGCTCCGG
AGGAATTCCAAAAAATATGGAAAAGCTGGTGAAGCTGTCTGGTTCTCATCTGACCCCCCTGTGTTATTCTTTCATTTCTTACGTACAGAA
TAAGAGTAAGAGCCTGAACTATACGGGAGAGAAAAAGGAGAAACCTGCTGCCGTTGCCACAGCCATGGCCAGAGTTCTTCGGGAAACCAA
GCCAATCCCTAACCTCATCTTTGCCATAGAACAGTATGAAAAATTTCTCATCCACCTTTCTAAGAAGTCCAAGGTGAACCTGATGCAGCA
CATGAAGCTCAGCACCTCACGAGACTTCAAGATCAAAGGAAACATCCTAGACATGGTTCTTCGAGAGGATGGTGAAGATGAAAATGAAGA

>In-frame_RSU1_ENST00000377921_chr10_16858972_-_FANCI_ENST00000310775_chr15_89816608_+_3214nt
ATGTCCAAGTCTCTGAAGAAGTTGGTGGAGGAGAGCCGGGAGAAGAACCAGCCCGAGGTGGACATGAGTGACCGGGGCATCTCCAACATG
CTGGATGTCAACGGCCTCTGTAGGACAGCAAGGAGATTCCAATAATAACTTAAGTCCCTTCAGCATTGCTCTTCTTCTGTCTGTAACAAG
AATACAAAGATTTCAGGACCAGGTGCTTGATCTTTTAAAGACTTCGGTTGTAAAGAGCTTTAAGGATCTTCAACTCCTCCAAGGCTCAAA
ATTTCTTCAGAATCTAGTTCCTCATAGATCTTATGTTTCAACCATGATCTTGGAAGTAGTGAAGAATAGCGTTCATAGCTGGGACCATGT
TACTCAGGGCCTCGTAGAACTTGGTTTCATTTTGATGGATTCATATGGGCCAAAGAAGGTTCTTGATGGAAAAACTATTGAAACCAGCCC
AAGTCTTTCTAGAATGCCAAACCAGCATGCATGTAAGCTCGGAGCTAATATCCTGTTGGAAACTTTTAAGATCCATGAGATGATCAGACA
AGAAATTTTGGAGCAGGTCCTCAACAGGGTTGTTACCAGAGCATCTTCTCCCATCAGTCATTTCTTAGACCTGCTTTCAAATATCGTCAT
GTATGCACCCTTAGTTCTTCAAAGTTGTTCTTCTAAAGTCACAGAAGCTTTTGACTATTTGTCCTTTCTGCCCCTTCAGACTGTACAAAG
GCTGCTTAAGGCAGTGCAGCCCCTTCTCAAAGTCAGCATGTCAATGAGAGACTGCTTGATACTTGTCCTTCGGAAAGCTATGTTTGCCAA
CCAGCTTGATGCCCGAAAATCTGCAGTTGCTGGGTTTTTGCTGCTCCTGAAGAACTTTAAAGTTTTAGGCAGCCTGTCATCCTCTCAGTG
CAGTCAGTCTCTCAGTGTCAGTCAGGTTCATGTGGATGTTCACAGCCATTACAATTCTGTCGCCAATGAAACTTTTTGCCTTGAGATCAT
GGATAGTTTGAGGAGATGCTTAAGCCAGCAAGCTGATGTTCGACTCATGCTTTATGAGGGGTTTTATGATGTTCTTCGAAGGAACTCTCA
GCTGGCTAATTCAGTCATGCAAACTCTGCTCTCACAGTTAAAACAGTTCTATGAGCCAAAACCTGATCTGCTGCCTCCTCTGAAATTAGA
AGCTTGTATTCTGACCCAAGGAGATAAGATCTCTCTACAAGAACCACTGGATTATCTGCTGTGTTGTATTCAGCATTGTTTGGCCTGGTA
TAAGAATACAGTCATACCCTTACAGCAGGGAGAGGAGGAAGAGGAGGAGGAAGAGGCATTCTACGAAGACCTAGATGATATATTGGAGTC
CATTACTAATAGAATGATTAAGAGTGAGCTGGAAGACTTTGAACTGGATAAATCAGCAGATTTTTCTCAGAGCACCAGTATTGGCATAAA
AAATAATATCTGTGCTTTTCTTGTGATGGGAGTTTGTGAGGTTTTAATAGAATACAATTTCTCCATAAGTAGTTTCAGTAAGAATAGGTT
TGAGGACATTCTGAGCTTATTTATGTGTTACAAAAAACTCTCTGACATTCTTAATGAAAAAGCGGGTAAAGCCAAAACTAAAATGGCCAA
CAAGACAAGTGATAGTCTTTTGTCCATGAAATTTGTGTCCAGTCTTCTCACTGCTCTTTTCAGGGATAGTATCCAAAGCCACCAAGAAAG
CCTTTCTGTTCTCAGGTCCAGCAATGAGTTTATGCGCTATGCAGTGAATGTAGCTCTGCAGAAGGTACAGCAGCTAAAGGAAACAGGGCA
TGTGAGTGGCCCTGATGGCCAAAACCCAGAAAAGATCTTTCAGAACCTCTGTGACATAACTCGAGTCTTGCTATGGAGATACACTTCAAT
TCCTACTTCAGTGGAAGAGTCGGGAAAGAAAGAGAAAGGAAAGAGCATCTCACTGCTGTGCTTGGAGGGTTTACAGAAAATATTCAGTGC
TGTGCAACAGTTCTATCAGCCCAAGATTCAGCAGTTTCTCAGAGCTCTGGATGTCACAGATAAGGAAGGAGAAGAGAGAGAAGATGCAGA
TGTCAGTGTCACTCAGAGAACAGCATTCCAGATCCGGCAATTTCAGAGGTCCTTGTTGAATTTACTTAGCAGTCAAGAGGAAGATTTTAA
TAGCAAAGAAGCCCTCCTGCTAGTCACGGTTCTTACCAGTTTGTCCAAGTTACTGGAGCCCTCCTCTCCTCAGTTTGTGCAGATGTTATC
CTGGACATCAAAGATTTGCAAGGAAAACAGCCGGGAGGATGCCTTGTTTTGCAAGAGCTTGATGAACTTGCTCTTCAGCCTGCATGTTTC
GTATAAGAGTCCTGTCATTCTGCTGCGTGACTTGTCCCAGGATATCCACGGGCATCTGGGAGATATAGACCAGGATGTAGAGGTGGAGAA
AACAAACCACTTTGCAATAGTGAATTTGAGAACGGCTGCCCCCACTGTCTGTTTACTTGTTCTGAGTCAGGCCGAGAAGGTTCTAGAAGA
AGTGGACTGGCTAATCACCAAGCTTAAGGGACAAGTGAGCCAAGAAACCTTATCAGAAGAGGCCTCTTCTCAGGCAACCCTACCAAATCA
GCCTGTTGAGAAAGCTATCATCATGCAACTGGGAACTCTGCTTACATTTTTCCACGAGCTGGTGCAGACAGCTCTGCCATCAGGCAGCTG
TGTGGACACCTTGTTAAAGGACTTGTGCAAAATGTACACCACACTTACAGCCCTTGTCAGATATTATCTCCAGGTGTGTCAGAGCTCCGG
AGGAATTCCAAAAAATATGGAAAAGCTGGTGAAGCTGTCTGGTTCTCATCTGACCCCCCTGTGTTATTCTTTCATTTCTTACGTACAGAA
TAAGAGTAAGAGCCTGAACTATACGGGAGAGAAAAAGGAGAAACCTGCTGCCGTTGCCACAGCCATGGCCAGAGTTCTTCGGGAAACCAA
GCCAATCCCTAACCTCATCTTTGCCATAGAACAGTATGAAAAATTTCTCATCCACCTTTCTAAGAAGTCCAAGGTGAACCTGATGCAGCA
CATGAAGCTCAGCACCTCACGAGACTTCAAGATCAAAGGAAACATCCTAGACATGGTTCTTCGAGAGGATGGTGAAGATGAAAATGAAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_RSU1_ENST00000377921_chr10_16858972_-_FANCI_ENST00000300027_chr15_89816608_+_4138nt
GGGCAGCTGGAGTGCGTTCTGCCGAAGCTTGTGGTTGCACGCCCATCGTCTTAGGGGCTACCTTCCGTGGTGAGTGTGTGCGGTGTTGCA
CTTGGGGTTGCTTCTCGCTGCGTGGCCGCAGCGGGGCTGAACCCTTCCCACTCCATCCCCTCCCCGCACCCGGACCAGCCCCTGGGACGC
CCTCGGACGCCCACCCGCTCCAACCCTGGGGAAGCCTCAGAGTGGCAGCGAAGGCCTCTTGCCTTTCCGCCTCTGCGCTTGCTGTCATCG
CCCACGTGCTTTGTTGTTGTTCGGTGCAGACCATGTCCAAGTCTCTGAAGAAGTTGGTGGAGGAGAGCCGGGAGAAGAACCAGCCCGAGG
TGGACATGAGTGACCGGGGCATCTCCAACATGCTGGATGTCAACGGCCTCTGTAGGACAGCAAGGAGATTCCAATAATAACTTAAGTCCC
TTCAGCATTGCTCTTCTTCTGTCTGTAACAAGAATACAAAGATTTCAGGACCAGGTGCTTGATCTTTTAAAGACTTCGGTTGTAAAGAGC
TTTAAGGATCTTCAACTCCTCCAAGGCTCAAAATTTCTTCAGAATCTAGTTCCTCATAGATCTTATGTTTCAACCATGATCTTGGAAGTA
GTGAAGAATAGCGTTCATAGCTGGGACCATGTTACTCAGGGCCTCGTAGAACTTGGTTTCATTTTGATGGATTCATATGGGCCAAAGAAG
GTTCTTGATGGAAAAACTATTGAAACCAGCCCAAGTCTTTCTAGAATGCCAAACCAGCATGCATGTAAGCTCGGAGCTAATATCCTGTTG
GAAACTTTTAAGATCCATGAGATGATCAGACAAGAAATTTTGGAGCAGGTCCTCAACAGGGTTGTTACCAGAGCATCTTCTCCCATCAGT
CATTTCTTAGACCTGCTTTCAAATATCGTCATGTATGCACCCTTAGTTCTTCAAAGTTGTTCTTCTAAAGTCACAGAAGCTTTTGACTAT
TTGTCCTTTCTGCCCCTTCAGACTGTACAAAGGCTGCTTAAGGCAGTGCAGCCCCTTCTCAAAGTCAGCATGTCAATGAGAGACTGCTTG
ATACTTGTCCTTCGGAAAGCTATGTTTGCCAACCAGCTTGATGCCCGAAAATCTGCAGTTGCTGGGTTTTTGCTGCTCCTGAAGAACTTT
AAAGTTTTAGGCAGCCTGTCATCCTCTCAGTGCAGTCAGTCTCTCAGTGTCAGTCAGGTTCATGTGGATGTTCACAGCCATTACAATTCT
GTCGCCAATGAAACTTTTTGCCTTGAGATCATGGATAGTTTGAGGAGATGCTTAAGCCAGCAAGCTGATGTTCGACTCATGCTTTATGAG
GGGTTTTATGATGTTCTTCGAAGGAACTCTCAGCTGGCTAATTCAGTCATGCAAACTCTGCTCTCACAGTTAAAACAGTTCTATGAGCCA
AAACCTGATCTGCTGCCTCCTCTGAAATTAGAAGCTTGTATTCTGACCCAAGGAGATAAGATCTCTCTACAAGAACCACTGGATTATCTG
CTGTGTTGTATTCAGCATTGTTTGGCCTGGTATAAGAATACAGTCATACCCTTACAGCAGGGAGAGGAGGAAGAGGAGGAGGAAGAGGCA
TTCTACGAAGACCTAGATGATATATTGGAGTCCATTACTAATAGAATGATTAAGAGTGAGCTGGAAGACTTTGAACTGGATAAATCAGCA
GATTTTTCTCAGAGCACCAGTATTGGCATAAAAAATAATATCTGTGCTTTTCTTGTGATGGGAGTTTGTGAGGTTTTAATAGAATACAAT
TTCTCCATAAGTAGTTTCAGTAAGAATAGGTTTGAGGACATTCTGAGCTTATTTATGTGTTACAAAAAACTCTCTGACATTCTTAATGAA
AAAGCGGGTAAAGCCAAAACTAAAATGGCCAACAAGACAAGTGATAGTCTTTTGTCCATGAAATTTGTGTCCAGTCTTCTCACTGCTCTT
TTCAGAGTCTTGCTATGGAGATACACTTCAATTCCTACTTCAGTGGAAGAGTCGGGAAAGAAAGAGAAAGGAAAGAGCATCTCACTGCTG
TGCTTGGAGGGTTTACAGAAAATATTCAGTGCTGTGCAACAGTTCTATCAGCCCAAGATTCAGCAGTTTCTCAGAGCTCTGGATGTCACA
GATAAGGAAGGAGAAGAGAGAGAAGATGCAGATGTCAGTGTCACTCAGAGAACAGCATTCCAGATCCGGCAATTTCAGAGGTCCTTGTTG
AATTTACTTAGCAGTCAAGAGGAAGATTTTAATAGCAAAGAAGCCCTCCTGCTAGTCACGGTTCTTACCAGTTTGTCCAAGTTACTGGAG
CCCTCCTCTCCTCAGTTTGTGCAGATGTTATCCTGGACATCAAAGATTTGCAAGGAAAACAGCCGGGAGGATGCCTTGTTTTGCAAGAGC
TTGATGAACTTGCTCTTCAGCCTGCATGTTTCGTATAAGAGTCCTGTCATTCTGCTGCGTGACTTGTCCCAGGATATCCACGGGCATCTG
GGAGATATAGACCAGGATGTAGAGGTGGAGAAAACAAACCACTTTGCAATAGTGAATTTGAGAACGGCTGCCCCCACTGTCTGTTTACTT
GTTCTGAGTCAGGCCGAGAAGGTTCTAGAAGAAGTGGACTGGCTAATCACCAAGCTTAAGGGACAAGTGAGCCAAGAAACCTTATCAGAA
GAGGCCTCTTCTCAGGCAACCCTACCAAATCAGCCTGTTGAGAAAGCTATCATCATGCAACTGGGAACTCTGCTTACATTTTTCCACGAG
CTGGTGCAGACAGCTCTGCCATCAGGCAGCTGTGTGGACACCTTGTTAAAGGACTTGTGCAAAATGTACACCACACTTACAGCCCTTGTC
AGATATTATCTCCAGGTGTGTCAGAGCTCCGGAGGAATTCCAAAAAATATGGAAAAGCTGGTGAAGCTGTCTGGTTCTCATCTGACCCCC
CTGTGTTATTCTTTCATTTCTTACGTACAGAATAAGAGTAAGAGCCTGAACTATACGGGAGAGAAAAAGGAGAAACCTGCTGCCGTTGCC
ACAGCCATGGCCAGAGTTCTTCGGGAAACCAAGCCAATCCCTAACCTCATCTTTGCCATAGAACAGTATGAAAAATTTCTCATCCACCTT
TCTAAGAAGTCCAAGGTGAACCTGATGCAGCACATGAAGCTCAGCACCTCACGAGACTTCAAGATCAAAGGAAACATCCTAGACATGGTT
CTTCGAGAGGATGGTGAAGATGAAAATGAAGAGGGCACTGCATCAGAGCATGGGGGACAGAACAAAGAACCAGCCAAGAAGAAAAGGAAA
AAATAAATGAAATGCCTGAGTTAATGTGAACTTTGGGGCTTCTGCTTCATTTTTACCCAACAAGCAACAATGCCCCTTGTCCTGTAGTCC
ACACCGATGTTGGCATCTTGGTTCTGAACCCACTGAATTCAACTGCACCTTCAGTTAGAAGGAATCTTCTTGGCAGGTCCTGCTACTGAA
AAATGGCTGGCCTTAGGCAAGCCCTTTTGCAAAAAGCACAGCTGAAAGCCTGAGTTTGGGAGCCTGCACCACCCCGATGAAGCTCCACGG
GAGCAAATACAGAGCCTCCAGGCAGTGCTATGGTCCAGGCTGGCTTCGTTTTTCCAAGGAGCCTTTGGTGAGTTCAATTATCTGGTAAAT
ATCCAGCGCTTCACCTGAAAGATAGTGCAAATTGGTTAGGATGCCACCTCAAGAACTGTAACTGAGAGCTCAGAAGTGAGCAAAGGAGCT
TAATGCTAAGGTCAAAAGGAGAGTGAAAGGTTGAGAACAATTGCCACGAACGGTAATGTTACATGTTAGGAGGGTCTGTTTTCTTTTTAT
ATAAGTGTGTCTTAGATATATTTTAAATAGAAAATAAGCTTTCTGATTTACTTGTTTGGTATTTAAAGCACAGTTTGTTTTTCTGTCACC
TATAGAGTGCAAGAATGCACTCTATAGAATAAATTATCTTTAAACATTTCTTCTGTGGTTGAAGTAGGGGACAGGTACAGGTAGAATATT

>In-frame_RSU1_ENST00000377921_chr10_16858972_-_FANCI_ENST00000310775_chr15_89816608_+_4186nt
GGGCAGCTGGAGTGCGTTCTGCCGAAGCTTGTGGTTGCACGCCCATCGTCTTAGGGGCTACCTTCCGTGGTGAGTGTGTGCGGTGTTGCA
CTTGGGGTTGCTTCTCGCTGCGTGGCCGCAGCGGGGCTGAACCCTTCCCACTCCATCCCCTCCCCGCACCCGGACCAGCCCCTGGGACGC
CCTCGGACGCCCACCCGCTCCAACCCTGGGGAAGCCTCAGAGTGGCAGCGAAGGCCTCTTGCCTTTCCGCCTCTGCGCTTGCTGTCATCG
CCCACGTGCTTTGTTGTTGTTCGGTGCAGACCATGTCCAAGTCTCTGAAGAAGTTGGTGGAGGAGAGCCGGGAGAAGAACCAGCCCGAGG
TGGACATGAGTGACCGGGGCATCTCCAACATGCTGGATGTCAACGGCCTCTGTAGGACAGCAAGGAGATTCCAATAATAACTTAAGTCCC
TTCAGCATTGCTCTTCTTCTGTCTGTAACAAGAATACAAAGATTTCAGGACCAGGTGCTTGATCTTTTAAAGACTTCGGTTGTAAAGAGC
TTTAAGGATCTTCAACTCCTCCAAGGCTCAAAATTTCTTCAGAATCTAGTTCCTCATAGATCTTATGTTTCAACCATGATCTTGGAAGTA
GTGAAGAATAGCGTTCATAGCTGGGACCATGTTACTCAGGGCCTCGTAGAACTTGGTTTCATTTTGATGGATTCATATGGGCCAAAGAAG
GTTCTTGATGGAAAAACTATTGAAACCAGCCCAAGTCTTTCTAGAATGCCAAACCAGCATGCATGTAAGCTCGGAGCTAATATCCTGTTG
GAAACTTTTAAGATCCATGAGATGATCAGACAAGAAATTTTGGAGCAGGTCCTCAACAGGGTTGTTACCAGAGCATCTTCTCCCATCAGT
CATTTCTTAGACCTGCTTTCAAATATCGTCATGTATGCACCCTTAGTTCTTCAAAGTTGTTCTTCTAAAGTCACAGAAGCTTTTGACTAT
TTGTCCTTTCTGCCCCTTCAGACTGTACAAAGGCTGCTTAAGGCAGTGCAGCCCCTTCTCAAAGTCAGCATGTCAATGAGAGACTGCTTG
ATACTTGTCCTTCGGAAAGCTATGTTTGCCAACCAGCTTGATGCCCGAAAATCTGCAGTTGCTGGGTTTTTGCTGCTCCTGAAGAACTTT
AAAGTTTTAGGCAGCCTGTCATCCTCTCAGTGCAGTCAGTCTCTCAGTGTCAGTCAGGTTCATGTGGATGTTCACAGCCATTACAATTCT
GTCGCCAATGAAACTTTTTGCCTTGAGATCATGGATAGTTTGAGGAGATGCTTAAGCCAGCAAGCTGATGTTCGACTCATGCTTTATGAG
GGGTTTTATGATGTTCTTCGAAGGAACTCTCAGCTGGCTAATTCAGTCATGCAAACTCTGCTCTCACAGTTAAAACAGTTCTATGAGCCA
AAACCTGATCTGCTGCCTCCTCTGAAATTAGAAGCTTGTATTCTGACCCAAGGAGATAAGATCTCTCTACAAGAACCACTGGATTATCTG
CTGTGTTGTATTCAGCATTGTTTGGCCTGGTATAAGAATACAGTCATACCCTTACAGCAGGGAGAGGAGGAAGAGGAGGAGGAAGAGGCA
TTCTACGAAGACCTAGATGATATATTGGAGTCCATTACTAATAGAATGATTAAGAGTGAGCTGGAAGACTTTGAACTGGATAAATCAGCA
GATTTTTCTCAGAGCACCAGTATTGGCATAAAAAATAATATCTGTGCTTTTCTTGTGATGGGAGTTTGTGAGGTTTTAATAGAATACAAT
TTCTCCATAAGTAGTTTCAGTAAGAATAGGTTTGAGGACATTCTGAGCTTATTTATGTGTTACAAAAAACTCTCTGACATTCTTAATGAA
AAAGCGGGTAAAGCCAAAACTAAAATGGCCAACAAGACAAGTGATAGTCTTTTGTCCATGAAATTTGTGTCCAGTCTTCTCACTGCTCTT
TTCAGGGATAGTATCCAAAGCCACCAAGAAAGCCTTTCTGTTCTCAGGTCCAGCAATGAGTTTATGCGCTATGCAGTGAATGTAGCTCTG
CAGAAGGTACAGCAGCTAAAGGAAACAGGGCATGTGAGTGGCCCTGATGGCCAAAACCCAGAAAAGATCTTTCAGAACCTCTGTGACATA
ACTCGAGTCTTGCTATGGAGATACACTTCAATTCCTACTTCAGTGGAAGAGTCGGGAAAGAAAGAGAAAGGAAAGAGCATCTCACTGCTG
TGCTTGGAGGGTTTACAGAAAATATTCAGTGCTGTGCAACAGTTCTATCAGCCCAAGATTCAGCAGTTTCTCAGAGCTCTGGATGTCACA
GATAAGGAAGGAGAAGAGAGAGAAGATGCAGATGTCAGTGTCACTCAGAGAACAGCATTCCAGATCCGGCAATTTCAGAGGTCCTTGTTG
AATTTACTTAGCAGTCAAGAGGAAGATTTTAATAGCAAAGAAGCCCTCCTGCTAGTCACGGTTCTTACCAGTTTGTCCAAGTTACTGGAG
CCCTCCTCTCCTCAGTTTGTGCAGATGTTATCCTGGACATCAAAGATTTGCAAGGAAAACAGCCGGGAGGATGCCTTGTTTTGCAAGAGC
TTGATGAACTTGCTCTTCAGCCTGCATGTTTCGTATAAGAGTCCTGTCATTCTGCTGCGTGACTTGTCCCAGGATATCCACGGGCATCTG
GGAGATATAGACCAGGATGTAGAGGTGGAGAAAACAAACCACTTTGCAATAGTGAATTTGAGAACGGCTGCCCCCACTGTCTGTTTACTT
GTTCTGAGTCAGGCCGAGAAGGTTCTAGAAGAAGTGGACTGGCTAATCACCAAGCTTAAGGGACAAGTGAGCCAAGAAACCTTATCAGAA
GAGGCCTCTTCTCAGGCAACCCTACCAAATCAGCCTGTTGAGAAAGCTATCATCATGCAACTGGGAACTCTGCTTACATTTTTCCACGAG
CTGGTGCAGACAGCTCTGCCATCAGGCAGCTGTGTGGACACCTTGTTAAAGGACTTGTGCAAAATGTACACCACACTTACAGCCCTTGTC
AGATATTATCTCCAGGTGTGTCAGAGCTCCGGAGGAATTCCAAAAAATATGGAAAAGCTGGTGAAGCTGTCTGGTTCTCATCTGACCCCC
CTGTGTTATTCTTTCATTTCTTACGTACAGAATAAGAGTAAGAGCCTGAACTATACGGGAGAGAAAAAGGAGAAACCTGCTGCCGTTGCC
ACAGCCATGGCCAGAGTTCTTCGGGAAACCAAGCCAATCCCTAACCTCATCTTTGCCATAGAACAGTATGAAAAATTTCTCATCCACCTT
TCTAAGAAGTCCAAGGTGAACCTGATGCAGCACATGAAGCTCAGCACCTCACGAGACTTCAAGATCAAAGGAAACATCCTAGACATGGTT
CTTCGAGAGGATGGTGAAGATGAAAATGAAGAGGGCACTGCATCAGAGCATGGGGGACAGAACAAAGAACCAGCCAAGAAGAAAAGGAAA
AAATAAATGAAATGCCTGAGTTAATGTGAACTTTGGGGCTTCTGCTTCATTTTTACCCAACAAGCAACAATGCCCCTTGTCCTGTAGTCC
ACACCGATGTTGGCATCTTGGTTCTGAACCCACTGAATTCAACTGCACCTTCAGTTAGAAGGAATCTTCTTGGCAGGTCCTGCTACTGAA
AAATGGCTGGCCTTAGGCAAGCCCTTTTGCAAAAAGCACAGCTGAAAGCCTGAGTTTGGGAGCCTGCACCACCCCGATGAAGCTCCACGG
GAGCAAATACAGAGCCTCCAGGCAGTGCTATGGTCCAGGCTGGCTTCGTTTTTCCAAGGAGCCTTTGGTGAGTTCAATTATCTGGTAAAT
ATCCAGCGCTTCACCTGAAAGATAGTGCAAATTGGTTAGGATGCCACCTCAAGAACTGTAACTGAGAGCTCAGAAGTGAGCAAAGGAGCT
TAATGCTAAGGTCAAAAGGAGAGTGAAAGGTTGAGAACAATTGCCACGAACGGTAATGTTACATGTTAGGAGGGTCTGTTTTCTTTTTAT
ATAAGTGTGTCTTAGATATATTTTAAATAGAAAATAAGCTTTCTGATTTACTTGTTTGGTATTTAAAGCACAGTTTGTTTTTCTGTCACC


Top

FusionGenePPI for RSU1_FANCI


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RSU1ACP6, ILK, HGS, GSK3B, ELAVL1, LRRK1, APP, VCP, FN1, LRCH3, FAM114A1, PARVA, PPAT, SEC24D, SUGT1, LIMS1, PARVB, PARVG, CBS, HNRNPA3, NDUFA8, NTMT1, PFKP, DAZAP1, DHX15, FLNB, HADH, USP3, TIAL1, TKTFANCIPTP4A3, ILK, C20orf24, PELO, GSTK1, NEK6, MAGED1, BRF2, MYC, USP36, ATM, CAMKK2, CLN3, PRKAB2, RAD18, FAN1, POLN, FANCD2, WDR48, PIDD1, SIRT7, FANCL, CUL3, APP, VCP, MMS19, HBS1L, PTPLAD1, EMD, MOV10, NXF1, ABCE1, IMPDH2, NTRK1, CEP120, DDOST, STXBP2, PAPSS1, CIR1, DGCR8, IMPACT, PRR3, DPY30, PLEKHA8, C1orf86, TIMM23, REV1, SNW1, CDC5L, POU5F1, PPM1A, RUNX3, UBL5, FANCI, MCM2, MCM3, MCM5, HELQ, FANCM, MTNR1B, PHLPP1, AKT1, PHLPP2, ATR, BRCA2, TRIM25, UHRF2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RSU1_FANCI


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RSU1_FANCI


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRSU1C0029456Osteoporosis1CTD_human
HgeneRSU1C0263454Chloracne1CTD_human
TgeneFANCIC1836861FANCONI ANEMIA, COMPLEMENTATION GROUP I2CTD_human;UNIPROT