FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32220

FusionGeneSummary for RRAS2_FHIT

check button Fusion gene summary
Fusion gene informationFusion gene name: RRAS2_FHIT
Fusion gene ID: 32220
HgeneTgene
Gene symbol

RRAS2

FHIT

Gene ID

22800

2272

Gene nameRAS related 2fragile histidine triad
SynonymsTC21AP3Aase|FRA3B
Cytomap

11p15.2

3p14.2

Type of geneprotein-codingprotein-coding
Descriptionras-related protein R-Ras2ras-like protein TC21related RAS viral (r-ras) oncogene homolog 2teratocarcinoma oncogenebis(5'-adenosyl)-triphosphataseAP3A hydrolasediadenosine 5',5'''-P1,P3-triphosphate hydrolasedinucleosidetriphosphatase
Modification date2018051920180519
UniProtAcc

P62070

P49789

Ensembl transtripts involved in fusion geneENST00000545643, ENST00000537760, 
ENST00000414023, ENST00000529237, 
ENST00000256196, ENST00000534746, 
ENST00000526063, ENST00000532814, 
ENST00000476844, ENST00000492590, 
ENST00000466788, ENST00000468189, 
ENST00000341848, 
Fusion gene scores* DoF score2 X 1 X 2=417 X 7 X 10=1190
# samples 220
** MAII scorelog2(2/4*10)=2.32192809488736log2(20/1190*10)=-2.57288966842058
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RRAS2 [Title/Abstract] AND FHIT [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneFHIT

GO:0006163

purine nucleotide metabolic process

9323207


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-KK-A7B3-01ARRAS2chr11

14380309

-FHITchr3

59908140

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000545643ENST00000476844RRAS2chr11

14380309

-FHITchr3

59908140

-
In-frameENST00000545643ENST00000492590RRAS2chr11

14380309

-FHITchr3

59908140

-
5CDS-5UTRENST00000545643ENST00000466788RRAS2chr11

14380309

-FHITchr3

59908140

-
5CDS-5UTRENST00000545643ENST00000468189RRAS2chr11

14380309

-FHITchr3

59908140

-
5CDS-5UTRENST00000545643ENST00000341848RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-3CDSENST00000537760ENST00000476844RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-3CDSENST00000537760ENST00000492590RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000537760ENST00000466788RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000537760ENST00000468189RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000537760ENST00000341848RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-3CDSENST00000414023ENST00000476844RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-3CDSENST00000414023ENST00000492590RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000414023ENST00000466788RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000414023ENST00000468189RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000414023ENST00000341848RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-3CDSENST00000529237ENST00000476844RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-3CDSENST00000529237ENST00000492590RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000529237ENST00000466788RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000529237ENST00000468189RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000529237ENST00000341848RRAS2chr11

14380309

-FHITchr3

59908140

-
In-frameENST00000256196ENST00000476844RRAS2chr11

14380309

-FHITchr3

59908140

-
In-frameENST00000256196ENST00000492590RRAS2chr11

14380309

-FHITchr3

59908140

-
5CDS-5UTRENST00000256196ENST00000466788RRAS2chr11

14380309

-FHITchr3

59908140

-
5CDS-5UTRENST00000256196ENST00000468189RRAS2chr11

14380309

-FHITchr3

59908140

-
5CDS-5UTRENST00000256196ENST00000341848RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-3CDSENST00000534746ENST00000476844RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-3CDSENST00000534746ENST00000492590RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000534746ENST00000466788RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000534746ENST00000468189RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000534746ENST00000341848RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-3CDSENST00000526063ENST00000476844RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-3CDSENST00000526063ENST00000492590RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000526063ENST00000466788RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000526063ENST00000468189RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000526063ENST00000341848RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-3CDSENST00000532814ENST00000476844RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-3CDSENST00000532814ENST00000492590RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000532814ENST00000466788RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000532814ENST00000468189RRAS2chr11

14380309

-FHITchr3

59908140

-
intron-5UTRENST00000532814ENST00000341848RRAS2chr11

14380309

-FHITchr3

59908140

-

Top

FusionProtFeatures for RRAS2_FHIT


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RRAS2

P62070

FHIT

P49789

It is a plasma membrane-associated GTP-binding proteinwith GTPase activity. Might transduce growth inhibitory signalsacross the cell membrane, exerting its effect through an effectorshared with the Ras proteins but in an antagonistic fashion. Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A)to yield AMP and ADP. Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extremely low activitywith ATP. Modulates transcriptional activation by CTNNB1 andthereby contributes to regulate the expression of genes essentialfor cell proliferation and survival, such as CCND1 and BIRC5.Plays a role in the induction of apoptosis via SRC and AKT1signaling pathways. Inhibits MDM2-mediated proteasomal degradationof p53/TP53 and thereby plays a role in p53/TP53-mediatedapoptosis. Induction of apoptosis depends on the ability of FHITto bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or relatedcompounds, but does not require its catalytic activity, it may inpart come from the mitochondrial form, which sensitizes the low-affinity Ca(2+) transporters, enhancing mitochondrial calciumuptake. Functions as tumor suppressor.{ECO:0000269|PubMed:12574506, ECO:0000269|PubMed:15313915,ECO:0000269|PubMed:16407838, ECO:0000269|PubMed:18077326,ECO:0000269|PubMed:19622739, ECO:0000269|PubMed:8794732,ECO:0000269|PubMed:9323207}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRRAS2chr11:14380309chr3:59908140ENST00000256196-1621_2936205Nucleotide bindingNote=GTP
TgeneFHITchr11:14380309chr3:59908140ENST00000341848-2594_9893148MotifHistidine triad motif
TgeneFHITchr11:14380309chr3:59908140ENST00000468189-6994_9893148MotifHistidine triad motif
TgeneFHITchr11:14380309chr3:59908140ENST00000476844-61094_9893214MotifHistidine triad motif
TgeneFHITchr11:14380309chr3:59908140ENST00000492590-61094_9893205MotifHistidine triad motif

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRRAS2chr11:14380309chr3:59908140ENST00000256196-1643_5136205MotifNote=Effector region
HgeneRRAS2chr11:14380309chr3:59908140ENST00000414023-1543_51-43128MotifNote=Effector region
HgeneRRAS2chr11:14380309chr3:59908140ENST00000526063-1643_51-118128MotifNote=Effector region
HgeneRRAS2chr11:14380309chr3:59908140ENST00000529237-1643_51-80128MotifNote=Effector region
HgeneRRAS2chr11:14380309chr3:59908140ENST00000532814-1643_51-124128MotifNote=Effector region
HgeneRRAS2chr11:14380309chr3:59908140ENST00000534746-1643_51-71128MotifNote=Effector region
HgeneRRAS2chr11:14380309chr3:59908140ENST00000537760-1643_51-38170MotifNote=Effector region
HgeneRRAS2chr11:14380309chr3:59908140ENST00000256196-16127_13036205Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000256196-16157_15936205Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000256196-1668_7236205Nucleotide bindingGTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000414023-15127_130-43128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000414023-15157_159-43128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000414023-1521_29-43128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000414023-1568_72-43128Nucleotide bindingGTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000526063-16127_130-118128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000526063-16157_159-118128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000526063-1621_29-118128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000526063-1668_72-118128Nucleotide bindingGTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000529237-16127_130-80128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000529237-16157_159-80128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000529237-1621_29-80128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000529237-1668_72-80128Nucleotide bindingGTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000532814-16127_130-124128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000532814-16157_159-124128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000532814-1621_29-124128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000532814-1668_72-124128Nucleotide bindingGTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000534746-16127_130-71128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000534746-16157_159-71128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000534746-1621_29-71128Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000534746-1668_72-71128Nucleotide bindingGTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000537760-16127_130-38170Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000537760-16157_159-38170Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000537760-1621_29-38170Nucleotide bindingNote=GTP
HgeneRRAS2chr11:14380309chr3:59908140ENST00000537760-1668_72-38170Nucleotide bindingGTP
TgeneFHITchr11:14380309chr3:59908140ENST00000341848-252_10993148DomainHIT
TgeneFHITchr11:14380309chr3:59908140ENST00000468189-692_10993148DomainHIT
TgeneFHITchr11:14380309chr3:59908140ENST00000476844-6102_10993214DomainHIT
TgeneFHITchr11:14380309chr3:59908140ENST00000492590-6102_10993205DomainHIT
TgeneFHITchr11:14380309chr3:59908140ENST00000341848-2589_9293148Nucleotide bindingSubstrate
TgeneFHITchr11:14380309chr3:59908140ENST00000468189-6989_9293148Nucleotide bindingSubstrate
TgeneFHITchr11:14380309chr3:59908140ENST00000476844-61089_9293214Nucleotide bindingSubstrate
TgeneFHITchr11:14380309chr3:59908140ENST00000492590-61089_9293205Nucleotide bindingSubstrate


Top

FusionGeneSequence for RRAS2_FHIT


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RRAS2_ENST00000545643_chr11_14380309_-_FHIT_ENST00000476844_chr3_59908140_-_91aa
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQHVHVHVLPRKAGDFHRNDSITEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

>In-frame_RRAS2_ENST00000545643_chr11_14380309_-_FHIT_ENST00000492590_chr3_59908140_-_91aa
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQHVHVHVLPRKAGDFHRNDSITEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

>In-frame_RRAS2_ENST00000256196_chr11_14380309_-_FHIT_ENST00000476844_chr3_59908140_-_91aa
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQHVHVHVLPRKAGDFHRNDSITEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

>In-frame_RRAS2_ENST00000256196_chr11_14380309_-_FHIT_ENST00000492590_chr3_59908140_-_91aa
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQHVHVHVLPRKAGDFHRNDSITEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RRAS2_ENST00000545643_chr11_14380309_-_FHIT_ENST00000476844_chr3_59908140_-_273nt
ATGGCCGCGGCCGGCTGGCGGGACGGCTCCGGCCAGGAGAAGTACCGGCTCGTGGTGGTCGGCGGGGGCGGCGTGGGCAAGTCGGCGCTC
ACCATCCAGTTCATCCAGCACGTTCACGTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTC
CAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGAGATCAGAGGAGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACTTTCAG

>In-frame_RRAS2_ENST00000545643_chr11_14380309_-_FHIT_ENST00000492590_chr3_59908140_-_273nt
ATGGCCGCGGCCGGCTGGCGGGACGGCTCCGGCCAGGAGAAGTACCGGCTCGTGGTGGTCGGCGGGGGCGGCGTGGGCAAGTCGGCGCTC
ACCATCCAGTTCATCCAGCACGTTCACGTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTC
CAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGAGATCAGAGGAGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACTTTCAG

>In-frame_RRAS2_ENST00000256196_chr11_14380309_-_FHIT_ENST00000476844_chr3_59908140_-_273nt
ATGGCCGCGGCCGGCTGGCGGGACGGCTCCGGCCAGGAGAAGTACCGGCTCGTGGTGGTCGGCGGGGGCGGCGTGGGCAAGTCGGCGCTC
ACCATCCAGTTCATCCAGCACGTTCACGTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTC
CAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGAGATCAGAGGAGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACTTTCAG

>In-frame_RRAS2_ENST00000256196_chr11_14380309_-_FHIT_ENST00000492590_chr3_59908140_-_273nt
ATGGCCGCGGCCGGCTGGCGGGACGGCTCCGGCCAGGAGAAGTACCGGCTCGTGGTGGTCGGCGGGGGCGGCGTGGGCAAGTCGGCGCTC
ACCATCCAGTTCATCCAGCACGTTCACGTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTC
CAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGAGATCAGAGGAGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACTTTCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RRAS2_ENST00000545643_chr11_14380309_-_FHIT_ENST00000476844_chr3_59908140_-_851nt
CAGACGGCCATTTGTGGCGGCGCTGGAGGCTGCGTTCGGCAGGCGCTGCGGAGACGCGTAGAGGAGCGCGCCCCCCGGCCGCTGCCGCCC
CTGGCCCGTGCCGTCACCCCGCTTCTCCGCGCCTCGGGCGGTACCCAGCCAGTCCCCAGCGCCGCGCTACCGCGCTGACCGGCCCTCCAG
ACGCCTCCCGGTACCCGGGACCCCAGCCCGGCCGCTCGCCCGCAGCCCGCCGGCCGCACACGTCCCCGGAGCCGGGCCTAGGGCGGGCGG
CAGCGGCGGCTCGGCGCAGTCAGGCTGGGCTCTGTAGCGTCCCCATGGCCGCGGCCGGCTGGCGGGACGGCTCCGGCCAGGAGAAGTACC
GGCTCGTGGTGGTCGGCGGGGGCGGCGTGGGCAAGTCGGCGCTCACCATCCAGTTCATCCAGCACGTTCACGTCCATGTTCTTCCCAGGA
AGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGAGATCAGAGG
AGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACTTTCAGTGACACAGATCCTGAATTCCAGCAAAAGAGCTATTGCCAACCAGTT
TGAAGACCGCCCCCCGCCTCTCCCCAAGAGGAACTGAATCAGCATGAAAATGCAGTTTCTTCATCTCACCATCCTGTATTCTTCAACCAG
TGATCCCCCACCTCGGTCACTCCAACTCCCTTAAAATACCTAGACCTAAACGGCTCAGACAGGCAGATTTGAGGTTTCCCCCTGTCTCCT

>In-frame_RRAS2_ENST00000545643_chr11_14380309_-_FHIT_ENST00000492590_chr3_59908140_-_862nt
CAGACGGCCATTTGTGGCGGCGCTGGAGGCTGCGTTCGGCAGGCGCTGCGGAGACGCGTAGAGGAGCGCGCCCCCCGGCCGCTGCCGCCC
CTGGCCCGTGCCGTCACCCCGCTTCTCCGCGCCTCGGGCGGTACCCAGCCAGTCCCCAGCGCCGCGCTACCGCGCTGACCGGCCCTCCAG
ACGCCTCCCGGTACCCGGGACCCCAGCCCGGCCGCTCGCCCGCAGCCCGCCGGCCGCACACGTCCCCGGAGCCGGGCCTAGGGCGGGCGG
CAGCGGCGGCTCGGCGCAGTCAGGCTGGGCTCTGTAGCGTCCCCATGGCCGCGGCCGGCTGGCGGGACGGCTCCGGCCAGGAGAAGTACC
GGCTCGTGGTGGTCGGCGGGGGCGGCGTGGGCAAGTCGGCGCTCACCATCCAGTTCATCCAGCACGTTCACGTCCATGTTCTTCCCAGGA
AGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGAGATCAGAGG
AGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACTTTCAGTGACACAGATGTTTTTCAGATCCTGAATTCCAGCAAAAGAGCTATT
GCCAACCAGTTTGAAGACCGCCCCCCGCCTCTCCCCAAGAGGAACTGAATCAGCATGAAAATGCAGTTTCTTCATCTCACCATCCTGTAT
TCTTCAACCAGTGATCCCCCACCTCGGTCACTCCAACTCCCTTAAAATACCTAGACCTAAACGGCTCAGACAGGCAGATTTGAGGTTTCC

>In-frame_RRAS2_ENST00000256196_chr11_14380309_-_FHIT_ENST00000476844_chr3_59908140_-_851nt
CAGACGGCCATTTGTGGCGGCGCTGGAGGCTGCGTTCGGCAGGCGCTGCGGAGACGCGTAGAGGAGCGCGCCCCCCGGCCGCTGCCGCCC
CTGGCCCGTGCCGTCACCCCGCTTCTCCGCGCCTCGGGCGGTACCCAGCCAGTCCCCAGCGCCGCGCTACCGCGCTGACCGGCCCTCCAG
ACGCCTCCCGGTACCCGGGACCCCAGCCCGGCCGCTCGCCCGCAGCCCGCCGGCCGCACACGTCCCCGGAGCCGGGCCTAGGGCGGGCGG
CAGCGGCGGCTCGGCGCAGTCAGGCTGGGCTCTGTAGCGTCCCCATGGCCGCGGCCGGCTGGCGGGACGGCTCCGGCCAGGAGAAGTACC
GGCTCGTGGTGGTCGGCGGGGGCGGCGTGGGCAAGTCGGCGCTCACCATCCAGTTCATCCAGCACGTTCACGTCCATGTTCTTCCCAGGA
AGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGAGATCAGAGG
AGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACTTTCAGTGACACAGATCCTGAATTCCAGCAAAAGAGCTATTGCCAACCAGTT
TGAAGACCGCCCCCCGCCTCTCCCCAAGAGGAACTGAATCAGCATGAAAATGCAGTTTCTTCATCTCACCATCCTGTATTCTTCAACCAG
TGATCCCCCACCTCGGTCACTCCAACTCCCTTAAAATACCTAGACCTAAACGGCTCAGACAGGCAGATTTGAGGTTTCCCCCTGTCTCCT

>In-frame_RRAS2_ENST00000256196_chr11_14380309_-_FHIT_ENST00000492590_chr3_59908140_-_862nt
CAGACGGCCATTTGTGGCGGCGCTGGAGGCTGCGTTCGGCAGGCGCTGCGGAGACGCGTAGAGGAGCGCGCCCCCCGGCCGCTGCCGCCC
CTGGCCCGTGCCGTCACCCCGCTTCTCCGCGCCTCGGGCGGTACCCAGCCAGTCCCCAGCGCCGCGCTACCGCGCTGACCGGCCCTCCAG
ACGCCTCCCGGTACCCGGGACCCCAGCCCGGCCGCTCGCCCGCAGCCCGCCGGCCGCACACGTCCCCGGAGCCGGGCCTAGGGCGGGCGG
CAGCGGCGGCTCGGCGCAGTCAGGCTGGGCTCTGTAGCGTCCCCATGGCCGCGGCCGGCTGGCGGGACGGCTCCGGCCAGGAGAAGTACC
GGCTCGTGGTGGTCGGCGGGGGCGGCGTGGGCAAGTCGGCGCTCACCATCCAGTTCATCCAGCACGTTCACGTCCATGTTCTTCCCAGGA
AGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGAGATCAGAGG
AGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACTTTCAGTGACACAGATGTTTTTCAGATCCTGAATTCCAGCAAAAGAGCTATT
GCCAACCAGTTTGAAGACCGCCCCCCGCCTCTCCCCAAGAGGAACTGAATCAGCATGAAAATGCAGTTTCTTCATCTCACCATCCTGTAT
TCTTCAACCAGTGATCCCCCACCTCGGTCACTCCAACTCCCTTAAAATACCTAGACCTAAACGGCTCAGACAGGCAGATTTGAGGTTTCC


Top

FusionGenePPI for RRAS2_FHIT


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RRAS2LGALS4, XRCC6, RAF1, PIK3R1, RALGDS, RIN1, MLLT4, CDK2, PAN2, TRAF2, CREB3, ARAF, CCDC8, RABGGTB, FNTB, DBN1, SNCA, TSNAX, SYNPO, LIMA1, FOXS1FHITFHIT, UBE2I, CTNNB1, LEF1, TRIM23, RAB40B, MDM2, REL, TP53, ARHGAP19, MTMR6, RABL2A, CHEK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RRAS2_FHIT


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneFHITP49789DB04173FructoseBis(5'-adenosyl)-triphosphatasesmall moleculeapproved|experimental

Top

RelatedDiseases for RRAS2_FHIT


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRRAS2C0023904Liver Neoplasms, Experimental1CTD_human
HgeneRRAS2C0349639Juvenile Myelomonocytic Leukemia1CTD_human
TgeneFHITC0024121Lung Neoplasms2CTD_human
TgeneFHITC0025500Mesothelioma2CTD_human
TgeneFHITC0007131Non-Small Cell Lung Carcinoma1CTD_human
TgeneFHITC0023903Liver neoplasms1CTD_human
TgeneFHITC0033578Prostatic Neoplasms1CTD_human
TgeneFHITC0036341Schizophrenia1PSYGENET
TgeneFHITC0038356Stomach Neoplasms1CTD_human
TgeneFHITC0042076Urologic Neoplasms1CTD_human
TgeneFHITC0236733Amphetamine-Related Disorders1CTD_human
TgeneFHITC0236969Substance-Related Disorders1CTD_human