FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3195

FusionGeneSummary for ATG5_EPHA7

check button Fusion gene summary
Fusion gene informationFusion gene name: ATG5_EPHA7
Fusion gene ID: 3195
HgeneTgene
Gene symbol

ATG5

EPHA7

Gene ID

9474

2045

Gene nameautophagy related 5EPH receptor A7
SynonymsAPG5|APG5-LIKE|APG5L|ASP|SCAR25|hAPG5EHK-3|EHK3|EK11|HEK11
Cytomap

6q21

6q16.1

Type of geneprotein-codingprotein-coding
Descriptionautophagy protein 5APG5 autophagy 5-likeATG5 autophagy related 5 homologapoptosis-specific proteinephrin type-A receptor 7EPH homology kinase 3EPH-like kinase 11Eph homology kinase-3receptor protein-tyrosine kinase HEK11tyrosine-protein kinase receptor EHK-3
Modification date2018052720180523
UniProtAcc

Q9H1Y0

Q15375

Ensembl transtripts involved in fusion geneENST00000343245, ENST00000369070, 
ENST00000369076, ENST00000360666, 
ENST00000475645, 
ENST00000369303, 
ENST00000369297, 
Fusion gene scores* DoF score16 X 8 X 9=11521 X 1 X 1=1
# samples 161
** MAII scorelog2(16/1152*10)=-2.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: ATG5 [Title/Abstract] AND EPHA7 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneEPHA7

GO:0048013

ephrin receptor signaling pathway

17726105

TgeneEPHA7

GO:0050730

regulation of peptidyl-tyrosine phosphorylation

17726105

TgeneEPHA7

GO:0070372

regulation of ERK1 and ERK2 cascade

17726105


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-98-A53B-01AATG5chr6

106756239

-EPHA7chr6

93982140

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000343245ENST00000369303ATG5chr6

106756239

-EPHA7chr6

93982140

-
5CDS-intronENST00000343245ENST00000369297ATG5chr6

106756239

-EPHA7chr6

93982140

-
intron-3CDSENST00000369070ENST00000369303ATG5chr6

106756239

-EPHA7chr6

93982140

-
intron-intronENST00000369070ENST00000369297ATG5chr6

106756239

-EPHA7chr6

93982140

-
In-frameENST00000369076ENST00000369303ATG5chr6

106756239

-EPHA7chr6

93982140

-
5CDS-intronENST00000369076ENST00000369297ATG5chr6

106756239

-EPHA7chr6

93982140

-
intron-3CDSENST00000360666ENST00000369303ATG5chr6

106756239

-EPHA7chr6

93982140

-
intron-intronENST00000360666ENST00000369297ATG5chr6

106756239

-EPHA7chr6

93982140

-
intron-3CDSENST00000475645ENST00000369303ATG5chr6

106756239

-EPHA7chr6

93982140

-
intron-intronENST00000475645ENST00000369297ATG5chr6

106756239

-EPHA7chr6

93982140

-

Top

FusionProtFeatures for ATG5_EPHA7


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ATG5

Q9H1Y0

EPHA7

Q15375

Involved in autophagic vesicle formation. Conjugationwith ATG12, through a ubiquitin-like conjugating system involvingATG7 as an E1-like activating enzyme and ATG10 as an E2-likeconjugating enzyme, is essential for its function. The ATG12-ATG5conjugate acts as an E3-like enzyme which is required forlipidation of ATG8 family proteins and their association to thevesicle membranes. Involved in mitochondrial quality control afteroxidative damage, and in subsequent cellular longevity. Plays acritical role in multiple aspects of lymphocyte development and isessential for both B and T lymphocyte survival and proliferation.Required for optimal processing and presentation of antigens forMHC II. Involved in the maintenance of axon morphology andmembrane structures, as well as in normal adipocytedifferentiation. Promotes primary ciliogenesis through removal ofOFD1 from centriolar satellites and degradation of IFT20 via theautophagic pathway. {ECO:0000250|UniProtKB:Q99J83,ECO:0000269|PubMed:12207896, ECO:0000269|PubMed:20580051,ECO:0000269|PubMed:22170153, ECO:0000269|PubMed:26812546}. May play an important role in the apoptotic process,possibly within the modified cytoskeleton. Its expression is arelatively late event in the apoptotic process, occurringdownstream of caspase activity. Plays a crucial role in IFN-gamma-induced autophagic cell death by interacting with FADD.{ECO:0000269|PubMed:15778222, ECO:0000269|PubMed:7796880}. (Microbial infection) May act as a proviral factor. Inassociation with ATG12, negatively regulates the innate antiviralimmune response by impairing the type I IFN production pathwayupon vesicular stomatitis virus (VSV) infection (PubMed:17709747).Required for the translation of incoming hepatitis C virus (HCV)RNA and, thereby, for initiation of HCV replication, but notrequired once infection is established (PubMed:19666601).{ECO:0000269|PubMed:17709747, ECO:0000269|PubMed:19666601}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ATG5_EPHA7


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ATG5_ENST00000369076_chr6_106756239_-_EPHA7_ENST00000369303_chr6_93982140_-_636aa
MTDDKDVLRDVWFGRIPTCFTLTQDEITEREAEPYTLLLPRVSTLTLVTDKVKKHFQKVMRQEDISEIWFETEGTPLKCSLASEWSNEGE
STAAECRAFLAGTRASQWSHHRI_NQVLRERSKGTDLLNSKNQVYFSLH__SETRNSVCFPDSGFYCCWLWKLQSQT_CCYTRGSYR_NV
_SYSCLQ_TESCTTHCCGCCSWDHHFGVHGLWLHHWEKALWL_QS_PRRR_RALLSF_ISRHQNLH_P_NL_GPK_SCPSIRQGARCLLT
_N_ACDWCRRIR_SLQWPFETSREKRCCSSHKNPESWLHRKTKERLFV_SKHHGAV_PPECCPFGRGCYKRETSHDSNRVHGKWSPRCIS
QET_WAIYSHSVSRNAERNCCWNEIFG_TGICSQGPCSSQTSCQQQSRL_SVRFWPVPSTRG_SRSCLYNYWWKNSSKVDSTRSHPVPEI
HISQ_CMELWNSHVGSTVLWRKTLLGHVKSRCTKSNRRRLSFTSTHGLPSWPSPANVGLLAKGAC_KAKI_TDSWNSRQNDSKPK_SENS
PGNL__ANKPSSGSKHS_FHYLLFSWRMATST_DGKI_R_FHGSWLQFP_ISSQDDT_GCDEFRDHTGWSSKENHEQHSDTESTNATFTW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ATG5_ENST00000369076_chr6_106756239_-_EPHA7_ENST00000369303_chr6_93982140_-_1909nt
ATGACAGATGACAAAGATGTGCTTCGAGATGTGTGGTTTGGACGAATTCCAACTTGTTTCACGCTATATCAGGATGAGATAACTGAAAGG
GAAGCAGAACCATACTATTTGCTTTTGCCAAGAGTAAGTTATTTGACGTTGGTAACTGACAAAGTGAAAAAGCACTTTCAGAAGGTTATG
AGACAAGAAGACATTAGTGAGATATGGTTTGAATATGAAGGCACACCACTGAAATGCTCCCTCGCAAGTGAGTGGAGTAATGAAGGAGAG
AGTACTGCAGCGGAGTGTCGAGCTTTCCTGGCAGGAACCAGAGCATCCCAATGGAGTCATCACAGAATATGAAATCAAGTATTACGAGAA
AGATCAAAGGGAACGGACCTACTCAACAGTAAAAACCAAGTCTACTTCAGCCTCCATTAATAATCTGAAACCAGGAACAGTGTATGTTTT
CCAGATTCGGGCTTTTACTGCTGCTGGTTATGGAAATTACAGTCCCAGACTTGATGTTGCTACACTAGAGGAAGCTACAGGTAAAATGTT
TGAAGCTACAGCTGTCTCCAGTGAACAGAATCCTGTTATTATCATTGCTGTGGTTGCTGTAGCTGGGACCATCATTTTGGTGTTCATGGT
CTTTGGCTTCATCATTGGGAGAAGGCACTGTGGTTATAGCAAAGCTGACCAAGAAGGCGATGAAGAGCTTTACTTTCATTTTAAATTTCC
AGGCACCAAAACCTACATTGACCCTGAAACCTATGAGGACCCAAATAGAGCTGTCCATCAATTCGCCAAGGAGCTAGATGCCTCCTGTAT
TAAAATTGAGCGTGTGATTGGTGCAGGAGAATTCGGTGAAGTCTGCAGTGGCCGTTTGAAACTTCCAGGGAAAAGAGATGTTGCAGTAGC
CATAAAAACCCTGAAAGTTGGTTACACAGAAAAACAAAGGAGAGACTTTTTGTGTGAAGCAAGCATCATGGGGCAGTTTGACCACCCGAA
TGTTGTCCATTTGGAAGGGGTTGTTACAAGAGGGAAACCAGTCATGATAGTAATAGAGTTCATGGAAAATGGAGCCCTAGATGCATTTCT
CAGGAAACATGATGGGCAATTTACAGTCATTCAGTTAGTAGGAATGCTGAGAGGAATTGCTGCTGGAATGAGATATTTGGCTGATATGGG
ATATGTTCACAGGGACCTTGCAGCTCGCAATATTCTTGTCAACAGCAATCTCGTTTGTAAAGTGTCAGATTTTGGCCTGTCCCGAGTTAT
AGAGGATGATCCAGAAGCTGTCTATACAACTACTGGTGGAAAAATTCCAGTAAGGTGGACAGCACCCGAAGCCATCCAGTACCGGAAATT
CACATCAGCCAGTGATGTATGGAGCTATGGAATAGTCATGTGGGAAGTTATGTCTTATGGAGAAAGACCTTATTGGGACATGTCAAATCA
AGATGTTATAAAAGCAATAGAAGAAGGTTATCGTTTACCAGCACCCATGGACTGCCCAGCTGGCCTTCACCAGCTAATGTTGGATTGTTG
GCAAAAGGAGCGTGCTGAAAGGCCAAAATTTGAACAGATAGTTGGAATTCTAGACAAAATGATTCGAAACCCAAATAGTCTGAAAACTCC
CCTGGGAACTTGTAGTAGGCCAATAAGCCCTCTTCTGGATCAAAACACTCCTGATTTCACTACCTTTTGTTCAGTTGGAGAATGGCTACA
AGCTATTAAGATGGAAAGATATAAAGATAATTTCACGGCAGCTGGCTACAATTCCCTTGAATCAGTAGCCAGGATGACTATTGAGGATGT
GATGAGTTTAGGGATCACACTGGTTGGTCATCAAAAGAAAATCATGAGCAGCATTCAGACTATGAGAGCACAAATGCTACATTTACATGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ATG5_ENST00000369076_chr6_106756239_-_EPHA7_ENST00000369303_chr6_93982140_-_5639nt
CTGGACTTGTGGTGCGCTGCCAGGGCTCCGCAGCGTTGCCGGTTGTATTCGCTGGATACCAGAGGGCGGAAGTGCAGCAGGGTTCAGCTC
CGACCTCCGCGCCGGTGCTTTTTGCGGCTGCGCGGGCTTCCTGGAGTCCTGCTACCGCGTCCCCGCAGGACAGTGTGTCAGGCGGGCAGC
TTGCCCCGCCGCCCCACCGGAGCGCGGAATCTGGGCGTCCCCACCAGTGCGGGGAGCCGGAAGGAGGAGCCATAGCTTGGAGTAGGTTTG
GCTTTGGTTGAAATAAGAATTTAGCCTGTATGTACTGCTTTAACTCCTGGAAGAATGACAGATGACAAAGATGTGCTTCGAGATGTGTGG
TTTGGACGAATTCCAACTTGTTTCACGCTATATCAGGATGAGATAACTGAAAGGGAAGCAGAACCATACTATTTGCTTTTGCCAAGAGTA
AGTTATTTGACGTTGGTAACTGACAAAGTGAAAAAGCACTTTCAGAAGGTTATGAGACAAGAAGACATTAGTGAGATATGGTTTGAATAT
GAAGGCACACCACTGAAATGCTCCCTCGCAAGTGAGTGGAGTAATGAAGGAGAGAGTACTGCAGCGGAGTGTCGAGCTTTCCTGGCAGGA
ACCAGAGCATCCCAATGGAGTCATCACAGAATATGAAATCAAGTATTACGAGAAAGATCAAAGGGAACGGACCTACTCAACAGTAAAAAC
CAAGTCTACTTCAGCCTCCATTAATAATCTGAAACCAGGAACAGTGTATGTTTTCCAGATTCGGGCTTTTACTGCTGCTGGTTATGGAAA
TTACAGTCCCAGACTTGATGTTGCTACACTAGAGGAAGCTACAGGTAAAATGTTTGAAGCTACAGCTGTCTCCAGTGAACAGAATCCTGT
TATTATCATTGCTGTGGTTGCTGTAGCTGGGACCATCATTTTGGTGTTCATGGTCTTTGGCTTCATCATTGGGAGAAGGCACTGTGGTTA
TAGCAAAGCTGACCAAGAAGGCGATGAAGAGCTTTACTTTCATTTTAAATTTCCAGGCACCAAAACCTACATTGACCCTGAAACCTATGA
GGACCCAAATAGAGCTGTCCATCAATTCGCCAAGGAGCTAGATGCCTCCTGTATTAAAATTGAGCGTGTGATTGGTGCAGGAGAATTCGG
TGAAGTCTGCAGTGGCCGTTTGAAACTTCCAGGGAAAAGAGATGTTGCAGTAGCCATAAAAACCCTGAAAGTTGGTTACACAGAAAAACA
AAGGAGAGACTTTTTGTGTGAAGCAAGCATCATGGGGCAGTTTGACCACCCGAATGTTGTCCATTTGGAAGGGGTTGTTACAAGAGGGAA
ACCAGTCATGATAGTAATAGAGTTCATGGAAAATGGAGCCCTAGATGCATTTCTCAGGAAACATGATGGGCAATTTACAGTCATTCAGTT
AGTAGGAATGCTGAGAGGAATTGCTGCTGGAATGAGATATTTGGCTGATATGGGATATGTTCACAGGGACCTTGCAGCTCGCAATATTCT
TGTCAACAGCAATCTCGTTTGTAAAGTGTCAGATTTTGGCCTGTCCCGAGTTATAGAGGATGATCCAGAAGCTGTCTATACAACTACTGG
TGGAAAAATTCCAGTAAGGTGGACAGCACCCGAAGCCATCCAGTACCGGAAATTCACATCAGCCAGTGATGTATGGAGCTATGGAATAGT
CATGTGGGAAGTTATGTCTTATGGAGAAAGACCTTATTGGGACATGTCAAATCAAGATGTTATAAAAGCAATAGAAGAAGGTTATCGTTT
ACCAGCACCCATGGACTGCCCAGCTGGCCTTCACCAGCTAATGTTGGATTGTTGGCAAAAGGAGCGTGCTGAAAGGCCAAAATTTGAACA
GATAGTTGGAATTCTAGACAAAATGATTCGAAACCCAAATAGTCTGAAAACTCCCCTGGGAACTTGTAGTAGGCCAATAAGCCCTCTTCT
GGATCAAAACACTCCTGATTTCACTACCTTTTGTTCAGTTGGAGAATGGCTACAAGCTATTAAGATGGAAAGATATAAAGATAATTTCAC
GGCAGCTGGCTACAATTCCCTTGAATCAGTAGCCAGGATGACTATTGAGGATGTGATGAGTTTAGGGATCACACTGGTTGGTCATCAAAA
GAAAATCATGAGCAGCATTCAGACTATGAGAGCACAAATGCTACATTTACATGGAACTGGCATTCAAGTGTGATATGCATTTCTCCCTTT
TAAGGGAGATTACAGACTGCAAGAGAACAGTACTGGCCTTCAGTATATGCATAGAATGCTGCTAGAAGACAAGTGATGTCCTGGGTCCTT
CCAACAGTGAAGAGAAGATTTAAGAAGCACCTATAGACTTGAACTCCTAAGTGCCACCAGAATATATAAAAAGGGAATTTAGGATCCACC
ATCGGTGGCCAGGAAAATAGCAGTGACAATAAACAAAGTACTACCTGAAAAACATCCAAACACCTTGAGCTCTCTAACCTCCTTTTTGTC
TTATAGACTTTTTAAAATGTACATAAAGAATTTAAGAAAGAATATATTTGTCAAATAAAATCATGATCTTATTGTTAAAATTAATGAAAT
ATTTTCCTTAAATATGTGATTTCAGACTATTCCTTTTTAAAATCATTTGTGTTTATTCTTCATAAGGACTTTGTTTTAGAAAGCTGTTTA
TAGCTTTGGACCTTTTTAGTGTTAAATCTGTAACATTACTACACTGGGTACCTTTGAAAGAATCTCAAATTTCAAAAGAAATAGCATGAT
TGAAGATACATCTCTGTTAGAACATTGGTATCCTTTTTGTGCCATTTTATTCTGTTTAATCAGTGCTGTTTTGATATTGTTTGCTAATTG
GCAGGTAGTCAAGAAAATGCAAGTTGCCAAGAGCTCTGATATTTTTTAAAAAGAATTTTTTTGTAAAGATCAGACAACACACTATCTTTT
CAATGAAAAAAGCAATAATGATCCATACATACTATAAGGCACTTTTAACAGATTGTTTATAGAGTGATTTTACTAGAAAGAATTTAATAA
ACTCGAAGTTTAGGTTTATGAGTATATAAACAAATGAGGCACTTCATCTGAAGAATGTTGGTGAAGGCAAGTCTCTGAAAGCAGAACTAT
CCAGTGTTATCTAAAAATTAATCTGAGCACATCAAGATTTTTTCATTCTCGTGACATTAGGAAATTTAGGATAAATAGTTGACATATATT
TTATATCCTCTTCTGTTGAATGCAGTCCAAACATGAAAGGAAATAATTGTTTTATATTATAACTCTGAAGCATGATAAAGGGGCAGTTCA
CAATTTTCACCATTTAAACACAAATTTGCTGCACAGAATATCACCATTGCAGTTCAAAACAAAACAAAACAAAAAGTCTTTTGTTTGTGA
ACACTGATGCAAGAAACTTGTTAAATGAAAGGACTCTTTACCCTAGAAGGAAGAGGTGAAGGATCTGGCTTGTTTTTAAAGCTTTATTTA
TTAAACCATATTATTTGATTACTGTGTTAGAATTTCATAAGCAATAATTAAATGTGTCTTTATAGATATTGCAGGAATGTATACATATTG
TGATTAATGCTTTCAAAACTTATGAAAATCATGAACTACCCCAGAATTGAACTGTTGTACTTCCAAAGAGAATTGGGCTGTTTATAATGA
TTTTAATAGAGAAAGATCCCAGGGATCGGTCATAATTGGTCTTGTTTGATAATGTGGGCATCCACAAACAAACAAACAAATAACAGAAAC
AAAATCTGTAAATGTTCCTTTGTAAAACTTGTAAATTTTATTTATACTGTCTTGTTTTGTACACACATTTCTCTGTAGTGGGCTCTGAAT
ACATTGAAAATGCACTATATTTTTCTATTTTACTTGCAGAGCATCACAAAAGAACAGGTATTTTCAGTGCTACATAATGTGTTTTCCCAC
ATTTAGGACCAAAGACGGCTATAGAAAAACTCAAATGGATTGCTTCCCAAACCCCTCCCCACCCTTTTTTTTTGGTTTTAAATCACTGTA
CAGTGTTATTTGATATTTTAATTTATTTTTTGATTGACTAGAAAAATCATTTTAATTTCACTAAAATGTTTTTTGTCCCTAAGGAAAAGT
AATCTGTAAAAATAATTTTAATTAGCATAATACAGTCACCTAGACACTTCCATTTGTAATCTTTGTAATAGACTGTAAATATATTTTTGG
AACTATAACACAATGTGCTTGAGGGTTATTTTTCAGTGTCTGCAGTGTGTACAAGTGTTTATACTAAGTCCAGCACTTTACAATTCTAAT
CAGTAGCATTGGCCTTTGTGAGAATGAGTGAAAGAGTTTGAGTGAGTGTTCTTAATTCCTTTTGGATTCTAGACTCACTAATAATGAAGT
TCTTTTCTTGTTCATAGCTTAAGGTGCTTATTTTTTCTATTAAAATTAAATTAACAAAAGCCATTCTAGAAATAGAAGACATAGTATGGT
ACATGCAAACGGTGTCTTTCCTGCTTTTTTCTAGCACTAGATTTATAGTTGAGTAGTCTTTCTTGAGTAGAAGGGCAGAATAAAAGTTTT
TTTGAGTTTTTTTCAAAAATAAATTTTTCCTTCAGCAATATACCTCATCTGCCTTAAATTTTTTACAGCTCTTTACAGGGAAAGGGGAGA
AGGGATGGGAAAGACACACAGCACAATAGGAAGTGTATGATTACATCACTATCTCGTTTGTAAGTTTCTTTTCCTAATCAACATTATGAT
TTCGAAATACATGTATGTGAAACAAATATTAAGAGAAAAAGAATTAACATTGTAATGCTGATTGTAATACTCTCTTCCAGAAAGAGATGA
GATGGTATAACGATAAGAATGTACAACTTGCACCTTGAAATCTTTTTTTTTAAATAAATTAGTGCTCAGGGGAGGAAAAGTAGAGAAAGT
GAACGTCAAAAATAGAATTCCAAAATTATAAAAATGCAAAAGGAAATGGCCTCCTTGCTTTAATAGAGCCACCTTTTTTAGAACACTGTC
CTCACACTTGACCTGTGTTTTGCATTCAGTACTGAAATAAAAGTAACTTGTTCTACATTTGAATCTAACATTTTCTCAGCAATTGATCTG
GTCCTTGTTTACTAGAACTGGTGGTTTATGCTTGTCAGAGCACTATTAGTTGAATCATATTGTATACTTATGTAATCTACATTAGCTAGT
ACTGTTTAGGACTATATTTTAATTGCTCTTCTTATCCGTGTTTTTAAGACAATTAAAATGGTGTGATTCACCTCTCTTTTTTATTTAGGT
AATGCTGATATTCTCCCTTTTGTTTCTTGAGTAGCCTAGAACTATGCTACTCACTGATGTGCATGTTCAAATAAATTACTGATGTGTATT
TTTTTGCTATATGTGGAGAAATCATGGGGAACTCGGGGCGAGATGTGCTTTTCGTTGGTTGAATTTGTCCCTCCTTGCCTAAGAAATACT
ACAGGGGTCATCCTTTTATAAGGACAAACTGCTTTTGAACAGTGTCTTCAATGTATCAAGCACAAATAACTCTTTCTTCAACATGAATCA


Top

FusionGenePPI for ATG5_EPHA7


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ATG5ATG12, IMPDH2, ATG16L1, ATG3, TECPR1, TKT, MAP1LC3B, MAP1LC3C, SIRT1, ELAVL1, TAB2, TAB3, WDFY3, HTT, CAV1, EXOC4, RB1CC1, FADD, WIPI2, MEOX2, VCP, KEAP1, CCHCR1, TEKT4, CAPN1, CAPN2, BCL2L1, XPO1, BCL10, SQSTM1, CALCOCO2, OPTN, BSN, IKBIPEPHA7EFNA2, EFNA3, EFNA5, MLLT4, MAP1LC3A, GNB1, ZNF267, HLA-DPA1, CACNG2, TMEM231, TMEM30A, PICK1, UBR2, HERC2, TMEM216, EPHA10, MBLAC2, EPHA3, TMPRSS11B, BCAM, TMEM30B, TMX1, NID2, SMOC1, MICA, RPL23, EPHA4, LRRIQ1, MRAP2, NPTX1, TUBA4A, HSPA5, BORA, MANSC1, AGAP1, EMC1, IL17RC, IL17RB, OAF, IARS2, RAET1E, WNT5A, PC, DUSP18, DUSP26, STYX, MTMR14


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ATG5_EPHA7


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ATG5_EPHA7


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneATG5C0002871Anemia1CTD_human
HgeneATG5C0019209Hepatomegaly1CTD_human
HgeneATG5C0023380Lethargy1CTD_human
HgeneATG5C0024312Lymphopenia1CTD_human
HgeneATG5C0027540Necrosis1CTD_human
HgeneATG5C1262477Weight decreased1CTD_human
HgeneATG5C4277682Chemical and Drug Induced Liver Injury1CTD_human
TgeneEPHA7C0149925Small cell carcinoma of lung1CTD_human