FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31851

FusionGeneSummary for RPL24_SLC9A9

check button Fusion gene summary
Fusion gene informationFusion gene name: RPL24_SLC9A9
Fusion gene ID: 31851
HgeneTgene
Gene symbol

RPL24

SLC9A9

Gene ID

51187

285195

Gene nameribosomal L24 domain containing 1solute carrier family 9 member A9
SynonymsC15orf15|HRP-L30-iso|L30|RLP24|RPL24|RPL24L|TVAS3AUTS16|NHE9
Cytomap

15q21.3

3q24

Type of geneprotein-codingprotein-coding
Descriptionprobable ribosome biogenesis protein RLP2460S ribosomal protein L30 isologhomolog of yeast ribosomal like protein 24my024 proteinribosomal L24 domain-containing protein 1sodium/hydrogen exchanger 9Na(+)/H(+) exchanger 9putative protein product of Nbla00118sodium/proton exchanger NHE9solute carrier family 9 (sodium/hydrogen exchanger)solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9
Modification date2018052320180523
UniProtAcc

P83731

Q8IVB4

Ensembl transtripts involved in fusion geneENST00000394077, ENST00000495401, 
ENST00000469605, 
ENST00000316549, 
ENST00000498717, 
Fusion gene scores* DoF score1 X 1 X 1=17 X 7 X 5=245
# samples 17
** MAII scorelog2(1/1*10)=3.32192809488736log2(7/245*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RPL24 [Title/Abstract] AND SLC9A9 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-18-3421-01ARPL24chr3

101401273

-SLC9A9chr3

143214290

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000394077ENST00000316549RPL24chr3

101401273

-SLC9A9chr3

143214290

-
5CDS-intronENST00000394077ENST00000498717RPL24chr3

101401273

-SLC9A9chr3

143214290

-
intron-3CDSENST00000495401ENST00000316549RPL24chr3

101401273

-SLC9A9chr3

143214290

-
intron-intronENST00000495401ENST00000498717RPL24chr3

101401273

-SLC9A9chr3

143214290

-
intron-3CDSENST00000469605ENST00000316549RPL24chr3

101401273

-SLC9A9chr3

143214290

-
intron-intronENST00000469605ENST00000498717RPL24chr3

101401273

-SLC9A9chr3

143214290

-

Top

FusionProtFeatures for RPL24_SLC9A9


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RPL24

P83731

SLC9A9

Q8IVB4

May act in electroneutral exchange of protons for Na(+)across membranes. Involved in the effusion of Golgi luminal H(+)in exchange for cytosolic cations. Involved in organelle ionhomeostasis by contributing to the maintenance of the uniqueacidic pH values of the Golgi and post-Golgi compartments in thecell. {ECO:0000269|PubMed:15522866}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSLC9A9chr3:101401273chr3:143214290ENST00000316549-816365_385363646TransmembraneHelical
TgeneSLC9A9chr3:101401273chr3:143214290ENST00000316549-816387_407363646TransmembraneHelical
TgeneSLC9A9chr3:101401273chr3:143214290ENST00000316549-816430_450363646TransmembraneHelical
TgeneSLC9A9chr3:101401273chr3:143214290ENST00000316549-816466_486363646TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSLC9A9chr3:101401273chr3:143214290ENST00000316549-816127_147363646TransmembraneHelical
TgeneSLC9A9chr3:101401273chr3:143214290ENST00000316549-816165_185363646TransmembraneHelical
TgeneSLC9A9chr3:101401273chr3:143214290ENST00000316549-816204_224363646TransmembraneHelical
TgeneSLC9A9chr3:101401273chr3:143214290ENST00000316549-81621_41363646TransmembraneHelical
TgeneSLC9A9chr3:101401273chr3:143214290ENST00000316549-816236_256363646TransmembraneHelical
TgeneSLC9A9chr3:101401273chr3:143214290ENST00000316549-816278_298363646TransmembraneHelical
TgeneSLC9A9chr3:101401273chr3:143214290ENST00000316549-816302_322363646TransmembraneHelical
TgeneSLC9A9chr3:101401273chr3:143214290ENST00000316549-816323_343363646TransmembraneHelical
TgeneSLC9A9chr3:101401273chr3:143214290ENST00000316549-81646_66363646TransmembraneHelical


Top

FusionGeneSequence for RPL24_SLC9A9


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RPL24_ENST00000394077_chr3_101401273_-_SLC9A9_ENST00000316549_chr3_143214290_-_414aa
MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQRAITGASLADI
MAKRNQKPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAAKLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILGAFLAIFVARACNI
YPLSFLLNLGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPKQMMFTTTLLLVFFTVWVFGGGTTPMLTWLQIRVGVDLDENLKED
PSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPISRLLTSPQAYGEQLKEDDVECIVNQDELAINYQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RPL24_ENST00000394077_chr3_101401273_-_SLC9A9_ENST00000316549_chr3_143214290_-_1242nt
ATGAAGGTCGAGCTGTGCAGTTTTAGCGGGTACAAGATCTACCCCGGACACGGGAGGCGCTACGCCAGGACCGACGGGAAGGTTTTCCAG
TTTCTTAATGCGAAATGCGAGTCGGCTTTCCTTTCCAAGAGGAATCCTCGGCAGATAAACTGGACTGTCCTCTACAGAAGGAAGCACAAA
AAGGGACAGTCGGAAGAAATTCAAAAGAAAAGAACCCGCCGAGCAGTCAAATTCCAGAGGGCCATTACTGGTGCATCTCTTGCTGATATA
ATGGCCAAGAGGAATCAGAAACCTGAAGTTAGAAAGGCTCAACGAGAACAAGCTATCAGGGCTGCTAAGGAAGCAAAAAAGGCTAAGCAA
GCATCTAAAAAGACTGCAATGGCTGCTGCTAAGTTGTTTGAATTTATGAACTTTTTGGCGGAGAACGTCATCTTCTGTTACATGGGCCTG
GCACTGTTCACGTTCCAGAATCATATCTTTAATGCTCTTTTTATACTTGGAGCCTTTCTAGCAATTTTTGTTGCCAGAGCCTGCAACATA
TATCCCCTCTCCTTCCTCCTGAATCTAGGCCGAAAACAGAAGATCCCCTGGAACTTTCAGCACATGATGATGTTTTCAGGTTTGCGAGGA
GCGATCGCATTTGCCTTAGCTATTCGGAACACAGAATCTCAGCCCAAACAAATGATGTTTACCACTACGCTGCTCCTCGTGTTCTTCACT
GTCTGGGTATTTGGAGGAGGAACAACCCCCATGTTGACTTGGCTTCAGATCAGAGTTGGCGTGGACCTGGATGAAAATCTGAAGGAGGAC
CCCTCCTCACAACACCAGGAAGCAAATAACTTGGATAAAAACATGACGAAAGCAGAGAGTGCTCGGCTCTTCAGAATGTGGTATAGCTTT
GACCACAAGTATCTGAAACCAATTTTAACCCACTCTGGTCCTCCGCTGACTACAACATTACCTGAATGGTGTGGTCCGATTTCCAGGCTG
CTTACCAGTCCTCAAGCCTATGGGGAACAGCTAAAAGAGGATGATGTGGAATGCATTGTAAACCAGGATGAACTAGCCATAAATTACCAG
GAGCAAGCCTCCTCACCCTGCAGTCCTCCTGCAAGGCTAGGTCTGGACCAGAAAGCTTCACCCCAGACGCCAGGCAAGGAAAACATTTAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_RPL24_ENST00000394077_chr3_101401273_-_SLC9A9_ENST00000316549_chr3_143214290_-_2828nt
GGGGAGGAGATTTCCGGCCCCCATCCCCGCAGCGACCTTATAAGGTCTCTTCCCATGATTCTCTCTTTCTTTTCGCCATCTTTTGTCTTT
CCGTGGAGCTGTCGCCATGAAGGTCGAGCTGTGCAGTTTTAGCGGGTACAAGATCTACCCCGGACACGGGAGGCGCTACGCCAGGACCGA
CGGGAAGGTTTTCCAGTTTCTTAATGCGAAATGCGAGTCGGCTTTCCTTTCCAAGAGGAATCCTCGGCAGATAAACTGGACTGTCCTCTA
CAGAAGGAAGCACAAAAAGGGACAGTCGGAAGAAATTCAAAAGAAAAGAACCCGCCGAGCAGTCAAATTCCAGAGGGCCATTACTGGTGC
ATCTCTTGCTGATATAATGGCCAAGAGGAATCAGAAACCTGAAGTTAGAAAGGCTCAACGAGAACAAGCTATCAGGGCTGCTAAGGAAGC
AAAAAAGGCTAAGCAAGCATCTAAAAAGACTGCAATGGCTGCTGCTAAGTTGTTTGAATTTATGAACTTTTTGGCGGAGAACGTCATCTT
CTGTTACATGGGCCTGGCACTGTTCACGTTCCAGAATCATATCTTTAATGCTCTTTTTATACTTGGAGCCTTTCTAGCAATTTTTGTTGC
CAGAGCCTGCAACATATATCCCCTCTCCTTCCTCCTGAATCTAGGCCGAAAACAGAAGATCCCCTGGAACTTTCAGCACATGATGATGTT
TTCAGGTTTGCGAGGAGCGATCGCATTTGCCTTAGCTATTCGGAACACAGAATCTCAGCCCAAACAAATGATGTTTACCACTACGCTGCT
CCTCGTGTTCTTCACTGTCTGGGTATTTGGAGGAGGAACAACCCCCATGTTGACTTGGCTTCAGATCAGAGTTGGCGTGGACCTGGATGA
AAATCTGAAGGAGGACCCCTCCTCACAACACCAGGAAGCAAATAACTTGGATAAAAACATGACGAAAGCAGAGAGTGCTCGGCTCTTCAG
AATGTGGTATAGCTTTGACCACAAGTATCTGAAACCAATTTTAACCCACTCTGGTCCTCCGCTGACTACAACATTACCTGAATGGTGTGG
TCCGATTTCCAGGCTGCTTACCAGTCCTCAAGCCTATGGGGAACAGCTAAAAGAGGATGATGTGGAATGCATTGTAAACCAGGATGAACT
AGCCATAAATTACCAGGAGCAAGCCTCCTCACCCTGCAGTCCTCCTGCAAGGCTAGGTCTGGACCAGAAAGCTTCACCCCAGACGCCAGG
CAAGGAAAACATTTATGAGGGAGACCTCGGCCTGGGAGGCTATGAACTCAAGCTTGAGCAAACTTTGGGTCAATCCCAGTTGAATTAATT
GGCATGAAGAGTACAGATGTAATCACAAGTAATGCAAGACTCACTGAGGAATACAAGCCAAGCTGATGAGGCAGTACAGGGGAGAGGCTG
GAAAACATATTAAGAGCATAAATTGGAGAGAATCAAAGCCTTGTCACATGGATCCTCTGGTGCCTGAAGAAATGAGATTTTATTATCCCT
CTCTATTATGCAAATGAATTTAGTTTTTTGACAGCAGCCATTCTGATTACTGGATTGGCTGGGGTGGGGATGGAGGTATCAGGAGTCTAG
CTGCTGGAGGATGGGACAGCTGTGCTGGGTCTTCAGGGCATTTCTGCTGCGAATGCGGCTCTCCAGGCCCTTCACTTCTATTCTGGATTT
TATTCCCTCCATTAAGGAGAGTTTAAAAATAAAAGAAAGCTTCTGAGAGTAAACATTTTGCTCCTAAGCTGAAGGGAATGCCCAGCTATT
TAGTAAGTGATAAGTTTCTTATTTTGAGGACTTGACTCCCATTTGCTCTCAGTGACCCCAGGGCAGAGCCCAGAGAAGTGTTCCGTACCC
ACTGCTGATGGTTTCCCAGAGCCCACACTGAGTTGAAGAACCTATTGTTCTTCTTGGCATCCTTCTTATGCTACTTCTCCCATCGCTCAA
AGGGGTTGCCTATGGCTGGGTGTGCCCTGCCCTAAATGCAGCACCACTTTCAAGCTTAGTAGGACCATTCCAAGAAAACCAGGTTTCTTC
TCCCCATACCACGTTGTGCCTGAAGAACAAGCCTTCCCGTCCTTGCCTGCATGTGAGTCACTTCTTGGCTGTGCAGCAGGTCCCCCCCTC
CCCGCGATATGCTGGAGGGTAGGATTCTGCAGCCTGTGTTGCTCTCTACCTGGCAGCAGACTGTGCAGGAGCCCCAACCTGTCCTCCAAT
TCCAGCATTCACAGCTGATGAGCAGTGCAGGAGCAGGGCGAGAGGAACAGAGCCAATGATGTGTGGGTTACACTGAGGAGCCAAGGACAG
GGCCTCAGGTCTCCCCCTTACAAGGCGTGGCTCATGGCCTGCATTCCAGAGACCAACATGATAGCTTTTAATTCAGCTGCATGACCTGTG
CCTTTTAAGCCATAAAGATACCTCAAGCCTAGCACCTCTTGAAATCCAGATGTTCATATTAGACTCGAAAAAATAGGCTCCAGGCCTAGG
TGCCCAGGCTATGATGAGTCTGCTTTTGAAGGAGGTAGGGAATGACATCTTCCTTGGACCCAAAGCTTAAAAGTAATGTATGCTTTGCTG
ACCACTGTTTGTTAGGCCTTAAACAACATTCACTGTGGTGGTATCAGGCACACTGCTATGTGCATCAATTATTTTTTTGCTTTCCAAACA
GAATCTCTGGGGCACAAGTTTTACACTCAAGCTAAGTATAACTTTGTCATTTCAGGTAAATATGACAAGTGGTGGAGCATGAAGTTTTCT


Top

FusionGenePPI for RPL24_SLC9A9


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RPL24POU5F1, AGO4, NDRG1, TCF3, ISG15, CUL3, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, CAND1, RPL10A, RPL11, RPL12, RPL13, RPL14, RPL15, RPL18A, RPL18, RPL19, RPL21, RPL22, RPL23A, RPL23, RPL31, RPL37A, RPL4, RPL5, RPL6, RPL7, RPL9, RPS11, RPS13, RPS15A, RPS16, RPS17, RPS20, RPS23, RPS25, RPS28, RPS2, RPS3A, RPS3, RPS4X, RPS5, RPS6, RPS8, RPSA, RPL27A, RPL7A, RPS19, RPS26, RPS12, RPS24, RPL17, RPS21, EEF1A1, RPS27A, ILF3, NPM1, NCL, RPS27L, RPL10L, RPLP0P6, RPS10P5, CHCHD2, TIMM13, STRAP, PSMB1, ESR1, MAGOH, EIF4A3, SMURF1, TRAF3IP1, FN1, VCAM1, TP63, UBL4A, PAN2, CD81, IGSF8, ICAM1, LSM8, HECW2, HIRIP3, OXR1, PURB, RANBP3, EEF1E1, FAF1, FARSB, GART, HIST1H4A, IARS, NARS, PLOD2, RPLP0, SAMHD1, SRSF6, TROVE2, XRCC5, SF1, SYNCRIP, VPS35, ZBTB1, STAU1, CEP250, CEP76, TP53, TUBG1, TUBGCP3, VCP, EED, RNF2, LUZP4, NAP1L1, RPS6KB2, RPL10, RPL13A, RPL3, RPL34, RPL8, RRP7A, RPL26, RPL27, RPL30, RPL32, RPL35, RPL35A, RPL36, RPL38, RPL3L, RPLP1, RPLP2, RPS10, RPS14, RPS15, RPS18, LOC101929876, RPS27, RPS7, RPS9, UBA52, SFN, XPO1, HIST1H3E, HNRNPU, NOP56, MPHOSPH8, MCM2, RC3H1, CDH1, DEFA5, INO80B, BRCA1, YAP1SLC9A9ZDHHC17, TP53


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RPL24_SLC9A9


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RPL24_SLC9A9


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSLC9A9C0004352Autistic Disorder1CTD_human