FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31733

FusionGeneSummary for RPA1_WDR81

check button Fusion gene summary
Fusion gene informationFusion gene name: RPA1_WDR81
Fusion gene ID: 31733
HgeneTgene
Gene symbol

RPA1

WDR81

Gene ID

25885

124997

Gene nameRNA polymerase I subunit AWD repeat domain 81
SynonymsA190|AFDCIN|RPA1|RPA194|RPO1-4|RPO14CAMRQ2|PPP1R166|SORF-2
Cytomap

2p11.2

17p13.3

Type of geneprotein-codingprotein-coding
DescriptionDNA-directed RNA polymerase I subunit RPA1DNA-directed RNA polymerase I largest subunitDNA-directed RNA polymerase I subunit ADNA-directed RNA polymerase I subunit A1RNA polymerase I 194 kDa subunitpolymerase (RNA) I polypeptide A, 194kDapolymerase WD repeat-containing protein 81protein phosphatase 1, regulatory subunit 166
Modification date2018052320180519
UniProtAcc

P27694

Q562E7

Ensembl transtripts involved in fusion geneENST00000254719, ENST00000573924, 
ENST00000437219, ENST00000309182, 
ENST00000446363, ENST00000419248, 
ENST00000409644, ENST00000545662, 
Fusion gene scores* DoF score2 X 2 X 2=83 X 3 X 3=27
# samples 23
** MAII scorelog2(2/8*10)=1.32192809488736log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RPA1 [Title/Abstract] AND WDR81 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneWDR81

GO:0010923

negative regulation of phosphatase activity

19389623


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCHOLTCGA-W5-AA31-01ARPA1chr17

1756483

+WDR81chr17

1633674

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000254719ENST00000437219RPA1chr17

1756483

+WDR81chr17

1633674

+
In-frameENST00000254719ENST00000309182RPA1chr17

1756483

+WDR81chr17

1633674

+
5CDS-intronENST00000254719ENST00000446363RPA1chr17

1756483

+WDR81chr17

1633674

+
5CDS-5UTRENST00000254719ENST00000419248RPA1chr17

1756483

+WDR81chr17

1633674

+
5CDS-5UTRENST00000254719ENST00000409644RPA1chr17

1756483

+WDR81chr17

1633674

+
5CDS-intronENST00000254719ENST00000545662RPA1chr17

1756483

+WDR81chr17

1633674

+
intron-3CDSENST00000573924ENST00000437219RPA1chr17

1756483

+WDR81chr17

1633674

+
intron-3CDSENST00000573924ENST00000309182RPA1chr17

1756483

+WDR81chr17

1633674

+
intron-intronENST00000573924ENST00000446363RPA1chr17

1756483

+WDR81chr17

1633674

+
intron-5UTRENST00000573924ENST00000419248RPA1chr17

1756483

+WDR81chr17

1633674

+
intron-5UTRENST00000573924ENST00000409644RPA1chr17

1756483

+WDR81chr17

1633674

+
intron-intronENST00000573924ENST00000545662RPA1chr17

1756483

+WDR81chr17

1633674

+

Top

FusionProtFeatures for RPA1_WDR81


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RPA1

P27694

WDR81

Q562E7

As part of the heterotrimeric replication protein Acomplex (RPA/RP-A), binds and stabilizes single-stranded DNAintermediates, that form during DNA replication or upon DNAstress. It prevents their reannealing and in parallel, recruitsand activates different proteins and complexes involved in DNAmetabolism (PubMed:27723720, PubMed:27723717). Thereby, it playsan essential role both in DNA replication and the cellularresponse to DNA damage (PubMed:9430682). In the cellular responseto DNA damage, the RPA complex controls DNA repair and DNA damagecheckpoint activation. Through recruitment of ATRIP activates theATR kinase a master regulator of the DNA damage response(PubMed:24332808). It is required for the recruitment of the DNAdouble-strand break repair factors RAD51 and RAD52 to chromatin inresponse to DNA damage (PubMed:17765923). Also recruits to sitesof DNA damage proteins like XPA and XPG that are involved innucleotide excision repair and is required for this mechanism ofDNA repair (PubMed:7697716). Plays also a role in base excisionrepair (BER) probably through interaction with UNG(PubMed:9765279). Also recruits SMARCAL1/HARP, which is involvedin replication fork restart, to sites of DNA damage. May also playa role in telomere maintenance (PubMed:17959650). As part of thealternative replication protein A complex, aRPA, binds single-stranded DNA and probably plays a role in DNA repair. Compared tothe RPA2-containing, canonical RPA complex, may not supportchromosomal DNA replication and cell cycle progression through S-phase. The aRPA may not promote efficient priming by DNApolymerase alpha but could support DNA synthesis by polymerasedelta in presence of PCNA and replication factor C (RFC), the dualincision/excision reaction of nucleotide excision repair andRAD51-dependent strand exchange (PubMed:19996105).{ECO:0000269|PubMed:12791985, ECO:0000269|PubMed:17765923,ECO:0000269|PubMed:17959650, ECO:0000269|PubMed:19116208,ECO:0000269|PubMed:19996105, ECO:0000269|PubMed:24332808,ECO:0000269|PubMed:27723717, ECO:0000269|PubMed:27723720,ECO:0000269|PubMed:7697716, ECO:0000269|PubMed:7700386,ECO:0000269|PubMed:9430682, ECO:0000269|PubMed:9765279}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneWDR81chr17:1756483chr17:1633674ENST00000309182+1111150_1217171891Compositional biasNote=Glu-rich
TgeneWDR81chr17:1756483chr17:1633674ENST00000309182+1111587_1596171891Compositional biasNote=Poly-Gly
TgeneWDR81chr17:1756483chr17:1633674ENST00000409644+0101587_159612221942Compositional biasNote=Poly-Gly
TgeneWDR81chr17:1756483chr17:1633674ENST00000419248+0101150_1217-5715Compositional biasNote=Glu-rich
TgeneWDR81chr17:1756483chr17:1633674ENST00000419248+0101587_1596-5715Compositional biasNote=Poly-Gly
TgeneWDR81chr17:1756483chr17:1633674ENST00000437219+0101150_121719739Compositional biasNote=Glu-rich
TgeneWDR81chr17:1756483chr17:1633674ENST00000437219+0101587_159619739Compositional biasNote=Poly-Gly
TgeneWDR81chr17:1756483chr17:1633674ENST00000309182+111337_614171891DomainBEACH
TgeneWDR81chr17:1756483chr17:1633674ENST00000419248+010337_614-5715DomainBEACH
TgeneWDR81chr17:1756483chr17:1633674ENST00000437219+010337_61419739DomainBEACH
TgeneWDR81chr17:1756483chr17:1633674ENST00000309182+1111639_1677171891RepeatNote=WD 1
TgeneWDR81chr17:1756483chr17:1633674ENST00000309182+1111686_1724171891RepeatNote=WD 2
TgeneWDR81chr17:1756483chr17:1633674ENST00000309182+1111729_1769171891RepeatNote=WD 3
TgeneWDR81chr17:1756483chr17:1633674ENST00000309182+1111777_1815171891RepeatNote=WD 4
TgeneWDR81chr17:1756483chr17:1633674ENST00000309182+1111819_1856171891RepeatNote=WD 5
TgeneWDR81chr17:1756483chr17:1633674ENST00000309182+1111860_1896171891RepeatNote=WD 6
TgeneWDR81chr17:1756483chr17:1633674ENST00000309182+1111902_1941171891RepeatNote=WD 7
TgeneWDR81chr17:1756483chr17:1633674ENST00000409644+0101639_167712221942RepeatNote=WD 1
TgeneWDR81chr17:1756483chr17:1633674ENST00000409644+0101686_172412221942RepeatNote=WD 2
TgeneWDR81chr17:1756483chr17:1633674ENST00000409644+0101729_176912221942RepeatNote=WD 3
TgeneWDR81chr17:1756483chr17:1633674ENST00000409644+0101777_181512221942RepeatNote=WD 4
TgeneWDR81chr17:1756483chr17:1633674ENST00000409644+0101819_185612221942RepeatNote=WD 5
TgeneWDR81chr17:1756483chr17:1633674ENST00000409644+0101860_189612221942RepeatNote=WD 6
TgeneWDR81chr17:1756483chr17:1633674ENST00000409644+0101902_194112221942RepeatNote=WD 7
TgeneWDR81chr17:1756483chr17:1633674ENST00000419248+0101639_1677-5715RepeatNote=WD 1
TgeneWDR81chr17:1756483chr17:1633674ENST00000419248+0101686_1724-5715RepeatNote=WD 2
TgeneWDR81chr17:1756483chr17:1633674ENST00000419248+0101729_1769-5715RepeatNote=WD 3
TgeneWDR81chr17:1756483chr17:1633674ENST00000419248+0101777_1815-5715RepeatNote=WD 4
TgeneWDR81chr17:1756483chr17:1633674ENST00000419248+0101819_1856-5715RepeatNote=WD 5
TgeneWDR81chr17:1756483chr17:1633674ENST00000419248+0101860_1896-5715RepeatNote=WD 6
TgeneWDR81chr17:1756483chr17:1633674ENST00000419248+0101902_1941-5715RepeatNote=WD 7
TgeneWDR81chr17:1756483chr17:1633674ENST00000437219+0101639_167719739RepeatNote=WD 1
TgeneWDR81chr17:1756483chr17:1633674ENST00000437219+0101686_172419739RepeatNote=WD 2
TgeneWDR81chr17:1756483chr17:1633674ENST00000437219+0101729_176919739RepeatNote=WD 3
TgeneWDR81chr17:1756483chr17:1633674ENST00000437219+0101777_181519739RepeatNote=WD 4
TgeneWDR81chr17:1756483chr17:1633674ENST00000437219+0101819_185619739RepeatNote=WD 5
TgeneWDR81chr17:1756483chr17:1633674ENST00000437219+0101860_189619739RepeatNote=WD 6
TgeneWDR81chr17:1756483chr17:1633674ENST00000437219+0101902_194119739RepeatNote=WD 7

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRPA1chr17:1756483chr17:1633674ENST00000254719+517197_281120617DNA bindingNote=OB
HgeneRPA1chr17:1756483chr17:1633674ENST00000254719+517481_503120617Zinc fingerC4-type
TgeneWDR81chr17:1756483chr17:1633674ENST00000409644+0101150_121712221942Compositional biasNote=Glu-rich
TgeneWDR81chr17:1756483chr17:1633674ENST00000409644+010337_61412221942DomainBEACH


Top

FusionGeneSequence for RPA1_WDR81


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RPA1_ENST00000254719_chr17_1756483_+_WDR81_ENST00000437219_chr17_1633674_+_840aa
MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDG
RRVVILMELEVLKSAEAVGVKIGNPVPYNEDTACKMVRWLSAKLGPTVASRHVARNLLRLLTSCYVGPTRQQFTVSSGESPPLSAGNIYQ
KRPVLGDIVSGPVLSCLLHIARLYGEPVLTYQYLPYISYLVAPGSASGPSRLNSRKEAGLLAAVTLTQKIIVYLSDTTLMDILPRISHEV
LLPVLSFLTSLVTGFPSGAQARTILCVKTISLIALICLRIGQEMVQQHLSEPVATFFQVFSQLHELRQQDLKLDPAGRGEGQLPQVVFSD
GQQRPVDPALLDELQKVFTLEMAYTIYVPFSCLLGDIIRKIIPNHELVGELAALYLESISPSSRNPASVEPTMPGTGPEWDPHGGGCPQD
DGHSGTFGSVLVGNRIQIPNDSRPENPGPLGPISGVGGGGLGSGSDDNALKQELPRSVHGLSGNWLAYWQYEIGVSQQDAHFHFHQIRLQ
SFPGHSGAVKCVAPLSSEDFFLSGSKDRTVRLWPLYNYGDGTSETAPRLVYTQHRKSVFFVGQLEAPQHVVSCDGAVHVWDPFTGKTLRT
VEPLDSRVPLTAVAVMPAPHTSITMASSDSTLRFVDCRKPGLQHEFRLGGGLNPGLVRALAISPSGRSVVAGFSSGFMVLLDTRTGLVLR
GWPAHEGDILQIKAVEGSVLVSSSSDHSLTVWKELEQKPTHHYKSASDPIHTFDLYGSEVVTGTVSNKIGVCSLLEPPSQATTKLSSENF

>In-frame_RPA1_ENST00000254719_chr17_1756483_+_WDR81_ENST00000309182_chr17_1633674_+_840aa
MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDG
RRVVILMELEVLKSAEAVGVKIGNPVPYNEDTACKMVRWLSAKLGPTVASRHVARNLLRLLTSCYVGPTRQQFTVSSGESPPLSAGNIYQ
KRPVLGDIVSGPVLSCLLHIARLYGEPVLTYQYLPYISYLVAPGSASGPSRLNSRKEAGLLAAVTLTQKIIVYLSDTTLMDILPRISHEV
LLPVLSFLTSLVTGFPSGAQARTILCVKTISLIALICLRIGQEMVQQHLSEPVATFFQVFSQLHELRQQDLKLDPAGRGEGQLPQVVFSD
GQQRPVDPALLDELQKVFTLEMAYTIYVPFSCLLGDIIRKIIPNHELVGELAALYLESISPSSRNPASVEPTMPGTGPEWDPHGGGCPQD
DGHSGTFGSVLVGNRIQIPNDSRPENPGPLGPISGVGGGGLGSGSDDNALKQELPRSVHGLSGNWLAYWQYEIGVSQQDAHFHFHQIRLQ
SFPGHSGAVKCVAPLSSEDFFLSGSKDRTVRLWPLYNYGDGTSETAPRLVYTQHRKSVFFVGQLEAPQHVVSCDGAVHVWDPFTGKTLRT
VEPLDSRVPLTAVAVMPAPHTSITMASSDSTLRFVDCRKPGLQHEFRLGGGLNPGLVRALAISPSGRSVVAGFSSGFMVLLDTRTGLVLR
GWPAHEGDILQIKAVEGSVLVSSSSDHSLTVWKELEQKPTHHYKSASDPIHTFDLYGSEVVTGTVSNKIGVCSLLEPPSQATTKLSSENF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RPA1_ENST00000254719_chr17_1756483_+_WDR81_ENST00000437219_chr17_1633674_+_2520nt
ATGGTCGGCCAACTGAGCGAGGGGGCCATTGCGGCCATCATGCAGAAGGGGGATACAAACATAAAGCCCATCCTCCAAGTCATCAACATC
CGTCCCATTACTACGGGGAATAGTCCGCCGCGTTATCGACTGCTCATGAGTGATGGATTGAACACTCTATCCTCTTTCATGTTGGCGACA
CAGTTGAACCCTCTCGTGGAGGAAGAACAATTGTCCAGCAACTGTGTATGCCAGATTCACAGATTTATTGTGAACACTCTGAAAGACGGA
AGGAGAGTAGTTATCTTGATGGAATTAGAAGTTTTGAAGTCAGCTGAAGCAGTTGGAGTGAAGATTGGCAATCCAGTGCCCTATAATGAA
GATACAGCCTGCAAGATGGTCCGCTGGCTGTCTGCCAAGCTCGGCCCCACAGTGGCCTCTCGCCACGTGGCCCGGAACCTGCTCCGCCTG
CTGACGTCTTGTTATGTTGGACCCACTCGGCAGCAGTTCACAGTGAGCAGTGGCGAGAGCCCACCGCTGAGCGCCGGCAACATCTACCAG
AAGAGGCCGGTCCTGGGCGACATCGTGTCAGGGCCTGTGCTCAGCTGCCTCCTCCACATCGCCCGCCTGTATGGGGAGCCTGTCCTCACC
TACCAGTACCTGCCCTACATCAGCTACCTGGTGGCCCCAGGGAGTGCCTCAGGCCCCAGCCGACTGAACAGCCGTAAGGAGGCGGGGCTG
CTGGCCGCGGTGACGCTGACTCAGAAGATCATCGTGTACCTCTCAGACACCACACTCATGGACATCCTGCCCCGGATCAGCCATGAGGTC
CTGCTGCCCGTGCTCAGCTTCCTCACCTCCCTCGTCACGGGGTTCCCAAGTGGGGCCCAGGCTCGGACCATCCTGTGTGTGAAAACCATC
AGCCTCATCGCCCTCATCTGCCTGCGCATTGGACAGGAGATGGTCCAGCAGCACCTGAGCGAGCCCGTGGCCACCTTTTTCCAGGTCTTC
TCTCAGCTGCATGAGCTTCGGCAACAGGATCTGAAGCTGGACCCTGCGGGCCGTGGTGAGGGCCAGCTGCCACAGGTGGTCTTCTCTGAT
GGGCAGCAGCGGCCCGTGGACCCCGCCCTGCTGGACGAGCTGCAGAAGGTGTTCACCCTGGAGATGGCATACACAATCTACGTGCCCTTC
TCCTGCCTGTTGGGTGACATCATCCGGAAAATCATCCCCAACCACGAGCTGGTTGGGGAGCTGGCGGCGCTGTACTTGGAGAGCATCAGC
CCCAGCAGTCGCAACCCTGCCAGCGTGGAGCCCACCATGCCCGGCACCGGGCCCGAGTGGGACCCCCATGGTGGGGGCTGCCCTCAGGAT
GACGGCCACTCAGGGACCTTTGGGAGCGTCCTGGTGGGGAACCGCATTCAGATCCCCAATGACTCTCGGCCTGAGAACCCCGGACCACTG
GGCCCCATCTCGGGGGTGGGTGGCGGGGGCCTGGGCAGCGGGAGCGACGACAACGCCCTGAAGCAGGAGCTGCCGCGGAGCGTGCACGGG
CTGAGCGGAAACTGGCTGGCGTACTGGCAGTACGAGATCGGCGTGAGCCAGCAGGATGCCCACTTTCACTTCCACCAGATCCGCCTGCAG
AGCTTCCCGGGCCACTCGGGGGCCGTCAAGTGCGTGGCACCCCTAAGCAGCGAGGACTTCTTCCTGAGCGGCAGCAAGGATCGTACCGTG
CGCCTCTGGCCGCTGTACAACTACGGCGACGGGACCAGCGAGACGGCCCCACGCCTCGTCTACACCCAGCACCGCAAGAGCGTCTTCTTC
GTGGGCCAGCTTGAGGCCCCGCAGCACGTGGTGAGCTGTGACGGGGCTGTGCACGTCTGGGACCCCTTCACAGGGAAGACCCTTCGCACA
GTGGAGCCGCTGGACAGCCGGGTGCCCCTGACTGCGGTGGCTGTCATGCCCGCCCCCCACACCAGCATCACCATGGCCAGCTCTGACTCT
ACCCTGCGCTTTGTGGACTGCAGGAAGCCTGGTCTGCAGCACGAGTTCCGACTGGGCGGTGGGCTGAACCCTGGGCTTGTCCGTGCCCTG
GCCATCAGCCCCAGTGGCCGTAGTGTCGTGGCCGGCTTCTCCTCAGGCTTCATGGTGCTCCTGGACACCCGCACAGGCCTGGTTCTGCGA
GGCTGGCCAGCCCACGAGGGGGACATTCTGCAGATCAAGGCGGTGGAGGGCAGCGTCCTGGTCAGCTCCTCCTCTGACCATTCCTTGACC
GTCTGGAAGGAGCTGGAGCAGAAGCCCACCCATCACTACAAGTCAGCATCCGACCCCATCCACACCTTTGACCTGTACGGCAGCGAGGTG
GTCACTGGCACCGTGTCCAACAAGATTGGCGTCTGCTCCCTGCTTGAGCCACCCTCGCAGGCCACCACGAAGCTCAGCTCTGAGAACTTC
CGCGGCACGCTCACCAGCCTGGCCTTGCTGCCCACTAAACGCCACCTCCTGCTGGGCTCAGACAACGGGGTTATCCGCCTCCTGGCATAG

>In-frame_RPA1_ENST00000254719_chr17_1756483_+_WDR81_ENST00000309182_chr17_1633674_+_2520nt
ATGGTCGGCCAACTGAGCGAGGGGGCCATTGCGGCCATCATGCAGAAGGGGGATACAAACATAAAGCCCATCCTCCAAGTCATCAACATC
CGTCCCATTACTACGGGGAATAGTCCGCCGCGTTATCGACTGCTCATGAGTGATGGATTGAACACTCTATCCTCTTTCATGTTGGCGACA
CAGTTGAACCCTCTCGTGGAGGAAGAACAATTGTCCAGCAACTGTGTATGCCAGATTCACAGATTTATTGTGAACACTCTGAAAGACGGA
AGGAGAGTAGTTATCTTGATGGAATTAGAAGTTTTGAAGTCAGCTGAAGCAGTTGGAGTGAAGATTGGCAATCCAGTGCCCTATAATGAA
GATACAGCCTGCAAGATGGTCCGCTGGCTGTCTGCCAAGCTCGGCCCCACAGTGGCCTCTCGCCACGTGGCCCGGAACCTGCTCCGCCTG
CTGACGTCTTGTTATGTTGGACCCACTCGGCAGCAGTTCACAGTGAGCAGTGGCGAGAGCCCACCGCTGAGCGCCGGCAACATCTACCAG
AAGAGGCCGGTCCTGGGCGACATCGTGTCAGGGCCTGTGCTCAGCTGCCTCCTCCACATCGCCCGCCTGTATGGGGAGCCTGTCCTCACC
TACCAGTACCTGCCCTACATCAGCTACCTGGTGGCCCCAGGGAGTGCCTCAGGCCCCAGCCGACTGAACAGCCGTAAGGAGGCGGGGCTG
CTGGCCGCGGTGACGCTGACTCAGAAGATCATCGTGTACCTCTCAGACACCACACTCATGGACATCCTGCCCCGGATCAGCCATGAGGTC
CTGCTGCCCGTGCTCAGCTTCCTCACCTCCCTCGTCACGGGGTTCCCAAGTGGGGCCCAGGCTCGGACCATCCTGTGTGTGAAAACCATC
AGCCTCATCGCCCTCATCTGCCTGCGCATTGGACAGGAGATGGTCCAGCAGCACCTGAGCGAGCCCGTGGCCACCTTTTTCCAGGTCTTC
TCTCAGCTGCATGAGCTTCGGCAACAGGATCTGAAGCTGGACCCTGCGGGCCGTGGTGAGGGCCAGCTGCCACAGGTGGTCTTCTCTGAT
GGGCAGCAGCGGCCCGTGGACCCCGCCCTGCTGGACGAGCTGCAGAAGGTGTTCACCCTGGAGATGGCATACACAATCTACGTGCCCTTC
TCCTGCCTGTTGGGTGACATCATCCGGAAAATCATCCCCAACCACGAGCTGGTTGGGGAGCTGGCGGCGCTGTACTTGGAGAGCATCAGC
CCCAGCAGTCGCAACCCTGCCAGCGTGGAGCCCACCATGCCCGGCACCGGGCCCGAGTGGGACCCCCATGGTGGGGGCTGCCCTCAGGAT
GACGGCCACTCAGGGACCTTTGGGAGCGTCCTGGTGGGGAACCGCATTCAGATCCCCAATGACTCTCGGCCTGAGAACCCCGGACCACTG
GGCCCCATCTCGGGGGTGGGTGGCGGGGGCCTGGGCAGCGGGAGCGACGACAACGCCCTGAAGCAGGAGCTGCCGCGGAGCGTGCACGGG
CTGAGCGGAAACTGGCTGGCGTACTGGCAGTACGAGATCGGCGTGAGCCAGCAGGATGCCCACTTTCACTTCCACCAGATCCGCCTGCAG
AGCTTCCCGGGCCACTCGGGGGCCGTCAAGTGCGTGGCACCCCTAAGCAGCGAGGACTTCTTCCTGAGCGGCAGCAAGGATCGTACCGTG
CGCCTCTGGCCGCTGTACAACTACGGCGACGGGACCAGCGAGACGGCCCCACGCCTCGTCTACACCCAGCACCGCAAGAGCGTCTTCTTC
GTGGGCCAGCTTGAGGCCCCGCAGCACGTGGTGAGCTGTGACGGGGCTGTGCACGTCTGGGACCCCTTCACAGGGAAGACCCTTCGCACA
GTGGAGCCGCTGGACAGCCGGGTGCCCCTGACTGCGGTGGCTGTCATGCCCGCCCCCCACACCAGCATCACCATGGCCAGCTCTGACTCT
ACCCTGCGCTTTGTGGACTGCAGGAAGCCTGGTCTGCAGCACGAGTTCCGACTGGGCGGTGGGCTGAACCCTGGGCTTGTCCGTGCCCTG
GCCATCAGCCCCAGTGGCCGTAGTGTCGTGGCCGGCTTCTCCTCAGGCTTCATGGTGCTCCTGGACACCCGCACAGGCCTGGTTCTGCGA
GGCTGGCCAGCCCACGAGGGGGACATTCTGCAGATCAAGGCGGTGGAGGGCAGCGTCCTGGTCAGCTCCTCCTCTGACCATTCCTTGACC
GTCTGGAAGGAGCTGGAGCAGAAGCCCACCCATCACTACAAGTCAGCATCCGACCCCATCCACACCTTTGACCTGTACGGCAGCGAGGTG
GTCACTGGCACCGTGTCCAACAAGATTGGCGTCTGCTCCCTGCTTGAGCCACCCTCGCAGGCCACCACGAAGCTCAGCTCTGAGAACTTC
CGCGGCACGCTCACCAGCCTGGCCTTGCTGCCCACTAAACGCCACCTCCTGCTGGGCTCAGACAACGGGGTTATCCGCCTCCTGGCATAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RPA1_ENST00000254719_chr17_1756483_+_WDR81_ENST00000437219_chr17_1633674_+_3544nt
CGGGAGCGGTGCGCGCAACTTCTCGGGCCAATAACTGCGCAGCGCGCGGGACCCGGGTGGGGAAGCTGGAGCTGTTGCGGGGTCCGCGGG
GAAGTCTTGGCGGTGGAGCCATGGTCGGCCAACTGAGCGAGGGGGCCATTGCGGCCATCATGCAGAAGGGGGATACAAACATAAAGCCCA
TCCTCCAAGTCATCAACATCCGTCCCATTACTACGGGGAATAGTCCGCCGCGTTATCGACTGCTCATGAGTGATGGATTGAACACTCTAT
CCTCTTTCATGTTGGCGACACAGTTGAACCCTCTCGTGGAGGAAGAACAATTGTCCAGCAACTGTGTATGCCAGATTCACAGATTTATTG
TGAACACTCTGAAAGACGGAAGGAGAGTAGTTATCTTGATGGAATTAGAAGTTTTGAAGTCAGCTGAAGCAGTTGGAGTGAAGATTGGCA
ATCCAGTGCCCTATAATGAAGATACAGCCTGCAAGATGGTCCGCTGGCTGTCTGCCAAGCTCGGCCCCACAGTGGCCTCTCGCCACGTGG
CCCGGAACCTGCTCCGCCTGCTGACGTCTTGTTATGTTGGACCCACTCGGCAGCAGTTCACAGTGAGCAGTGGCGAGAGCCCACCGCTGA
GCGCCGGCAACATCTACCAGAAGAGGCCGGTCCTGGGCGACATCGTGTCAGGGCCTGTGCTCAGCTGCCTCCTCCACATCGCCCGCCTGT
ATGGGGAGCCTGTCCTCACCTACCAGTACCTGCCCTACATCAGCTACCTGGTGGCCCCAGGGAGTGCCTCAGGCCCCAGCCGACTGAACA
GCCGTAAGGAGGCGGGGCTGCTGGCCGCGGTGACGCTGACTCAGAAGATCATCGTGTACCTCTCAGACACCACACTCATGGACATCCTGC
CCCGGATCAGCCATGAGGTCCTGCTGCCCGTGCTCAGCTTCCTCACCTCCCTCGTCACGGGGTTCCCAAGTGGGGCCCAGGCTCGGACCA
TCCTGTGTGTGAAAACCATCAGCCTCATCGCCCTCATCTGCCTGCGCATTGGACAGGAGATGGTCCAGCAGCACCTGAGCGAGCCCGTGG
CCACCTTTTTCCAGGTCTTCTCTCAGCTGCATGAGCTTCGGCAACAGGATCTGAAGCTGGACCCTGCGGGCCGTGGTGAGGGCCAGCTGC
CACAGGTGGTCTTCTCTGATGGGCAGCAGCGGCCCGTGGACCCCGCCCTGCTGGACGAGCTGCAGAAGGTGTTCACCCTGGAGATGGCAT
ACACAATCTACGTGCCCTTCTCCTGCCTGTTGGGTGACATCATCCGGAAAATCATCCCCAACCACGAGCTGGTTGGGGAGCTGGCGGCGC
TGTACTTGGAGAGCATCAGCCCCAGCAGTCGCAACCCTGCCAGCGTGGAGCCCACCATGCCCGGCACCGGGCCCGAGTGGGACCCCCATG
GTGGGGGCTGCCCTCAGGATGACGGCCACTCAGGGACCTTTGGGAGCGTCCTGGTGGGGAACCGCATTCAGATCCCCAATGACTCTCGGC
CTGAGAACCCCGGACCACTGGGCCCCATCTCGGGGGTGGGTGGCGGGGGCCTGGGCAGCGGGAGCGACGACAACGCCCTGAAGCAGGAGC
TGCCGCGGAGCGTGCACGGGCTGAGCGGAAACTGGCTGGCGTACTGGCAGTACGAGATCGGCGTGAGCCAGCAGGATGCCCACTTTCACT
TCCACCAGATCCGCCTGCAGAGCTTCCCGGGCCACTCGGGGGCCGTCAAGTGCGTGGCACCCCTAAGCAGCGAGGACTTCTTCCTGAGCG
GCAGCAAGGATCGTACCGTGCGCCTCTGGCCGCTGTACAACTACGGCGACGGGACCAGCGAGACGGCCCCACGCCTCGTCTACACCCAGC
ACCGCAAGAGCGTCTTCTTCGTGGGCCAGCTTGAGGCCCCGCAGCACGTGGTGAGCTGTGACGGGGCTGTGCACGTCTGGGACCCCTTCA
CAGGGAAGACCCTTCGCACAGTGGAGCCGCTGGACAGCCGGGTGCCCCTGACTGCGGTGGCTGTCATGCCCGCCCCCCACACCAGCATCA
CCATGGCCAGCTCTGACTCTACCCTGCGCTTTGTGGACTGCAGGAAGCCTGGTCTGCAGCACGAGTTCCGACTGGGCGGTGGGCTGAACC
CTGGGCTTGTCCGTGCCCTGGCCATCAGCCCCAGTGGCCGTAGTGTCGTGGCCGGCTTCTCCTCAGGCTTCATGGTGCTCCTGGACACCC
GCACAGGCCTGGTTCTGCGAGGCTGGCCAGCCCACGAGGGGGACATTCTGCAGATCAAGGCGGTGGAGGGCAGCGTCCTGGTCAGCTCCT
CCTCTGACCATTCCTTGACCGTCTGGAAGGAGCTGGAGCAGAAGCCCACCCATCACTACAAGTCAGCATCCGACCCCATCCACACCTTTG
ACCTGTACGGCAGCGAGGTGGTCACTGGCACCGTGTCCAACAAGATTGGCGTCTGCTCCCTGCTTGAGCCACCCTCGCAGGCCACCACGA
AGCTCAGCTCTGAGAACTTCCGCGGCACGCTCACCAGCCTGGCCTTGCTGCCCACTAAACGCCACCTCCTGCTGGGCTCAGACAACGGGG
TTATCCGCCTCCTGGCATAGACTGAGGCAGGAGCTGGCCGGGCAAGGGTGGGAAGACATCTGCGGGCGCGTGTCCACTCACCCTGTTCCC
TGAGCAGCAGCTCCCTCCAGGGAGGCCCTGGGTCCCACGCCCTGGGTGCCCACATGGCCTGCCAACTAGGGCCTGCAAATGGAGTGGGGG
AGTCCTGGCCCCTGAATCACCAGAGCCACCAAGCCTGCCAGAGGGGTCTCATTCATGGCTTGGGGACACAGGGCTCCTAGCAAGCAGGAA
GTTAAGAGCAGGAGGAAGCGTTGCTACCTTCACTTCTCCCCAGCTCTGCCCTCTGGGTCCACATGAGGACAGGGAAGCTCGGGAAGGGGA
AGGGAGACTGGCCCTGCCCAGCCGGTCTCTAGCCCCTCAGCCCCCGCTGGGCACTCTCTGTCCCATCCCTCTAGGACAGGGAAGCTGGCC
TGGTCCAGGGCACTGATGGTGCTTGGATTCCAGCCTAAGGAAGGCTGGCCGTGGTCCAGGAGTTAAGGGCTTGGGTCTGGGGTTTAAGTG
GCCACCCATCCAGGCCCTGGCCAGTGTGGGACCGGGACGGGAAGGAAGAAGGAGGCTAGGAGCAGGGGGAAAAGGTGCACTTGGCCAGTG
GCGCCTGCCAGGAGTGAGTCCATGCGTTGTCTGCCCACCCCTACCACAGTGTTTGTGCCTTCAGCTGAGGGGGCAGCCTCTGGGCCCTGA
ACCCCTGCTGGGGCTCCACGACCCTGAGAGAAGGGGTGAGAAGAATCATCTCTGCACCTCGGGTCTCTGCCAGAGGAAGACTTAAGCATC
CCTGCGACCTCACATTCTAGACAGAGATGAGGTCCAGGGGTTGGCCCCTGCTGCCTTCTCACAATTTGCAATAGATGTAAATAGGACCAA

>In-frame_RPA1_ENST00000254719_chr17_1756483_+_WDR81_ENST00000309182_chr17_1633674_+_3544nt
CGGGAGCGGTGCGCGCAACTTCTCGGGCCAATAACTGCGCAGCGCGCGGGACCCGGGTGGGGAAGCTGGAGCTGTTGCGGGGTCCGCGGG
GAAGTCTTGGCGGTGGAGCCATGGTCGGCCAACTGAGCGAGGGGGCCATTGCGGCCATCATGCAGAAGGGGGATACAAACATAAAGCCCA
TCCTCCAAGTCATCAACATCCGTCCCATTACTACGGGGAATAGTCCGCCGCGTTATCGACTGCTCATGAGTGATGGATTGAACACTCTAT
CCTCTTTCATGTTGGCGACACAGTTGAACCCTCTCGTGGAGGAAGAACAATTGTCCAGCAACTGTGTATGCCAGATTCACAGATTTATTG
TGAACACTCTGAAAGACGGAAGGAGAGTAGTTATCTTGATGGAATTAGAAGTTTTGAAGTCAGCTGAAGCAGTTGGAGTGAAGATTGGCA
ATCCAGTGCCCTATAATGAAGATACAGCCTGCAAGATGGTCCGCTGGCTGTCTGCCAAGCTCGGCCCCACAGTGGCCTCTCGCCACGTGG
CCCGGAACCTGCTCCGCCTGCTGACGTCTTGTTATGTTGGACCCACTCGGCAGCAGTTCACAGTGAGCAGTGGCGAGAGCCCACCGCTGA
GCGCCGGCAACATCTACCAGAAGAGGCCGGTCCTGGGCGACATCGTGTCAGGGCCTGTGCTCAGCTGCCTCCTCCACATCGCCCGCCTGT
ATGGGGAGCCTGTCCTCACCTACCAGTACCTGCCCTACATCAGCTACCTGGTGGCCCCAGGGAGTGCCTCAGGCCCCAGCCGACTGAACA
GCCGTAAGGAGGCGGGGCTGCTGGCCGCGGTGACGCTGACTCAGAAGATCATCGTGTACCTCTCAGACACCACACTCATGGACATCCTGC
CCCGGATCAGCCATGAGGTCCTGCTGCCCGTGCTCAGCTTCCTCACCTCCCTCGTCACGGGGTTCCCAAGTGGGGCCCAGGCTCGGACCA
TCCTGTGTGTGAAAACCATCAGCCTCATCGCCCTCATCTGCCTGCGCATTGGACAGGAGATGGTCCAGCAGCACCTGAGCGAGCCCGTGG
CCACCTTTTTCCAGGTCTTCTCTCAGCTGCATGAGCTTCGGCAACAGGATCTGAAGCTGGACCCTGCGGGCCGTGGTGAGGGCCAGCTGC
CACAGGTGGTCTTCTCTGATGGGCAGCAGCGGCCCGTGGACCCCGCCCTGCTGGACGAGCTGCAGAAGGTGTTCACCCTGGAGATGGCAT
ACACAATCTACGTGCCCTTCTCCTGCCTGTTGGGTGACATCATCCGGAAAATCATCCCCAACCACGAGCTGGTTGGGGAGCTGGCGGCGC
TGTACTTGGAGAGCATCAGCCCCAGCAGTCGCAACCCTGCCAGCGTGGAGCCCACCATGCCCGGCACCGGGCCCGAGTGGGACCCCCATG
GTGGGGGCTGCCCTCAGGATGACGGCCACTCAGGGACCTTTGGGAGCGTCCTGGTGGGGAACCGCATTCAGATCCCCAATGACTCTCGGC
CTGAGAACCCCGGACCACTGGGCCCCATCTCGGGGGTGGGTGGCGGGGGCCTGGGCAGCGGGAGCGACGACAACGCCCTGAAGCAGGAGC
TGCCGCGGAGCGTGCACGGGCTGAGCGGAAACTGGCTGGCGTACTGGCAGTACGAGATCGGCGTGAGCCAGCAGGATGCCCACTTTCACT
TCCACCAGATCCGCCTGCAGAGCTTCCCGGGCCACTCGGGGGCCGTCAAGTGCGTGGCACCCCTAAGCAGCGAGGACTTCTTCCTGAGCG
GCAGCAAGGATCGTACCGTGCGCCTCTGGCCGCTGTACAACTACGGCGACGGGACCAGCGAGACGGCCCCACGCCTCGTCTACACCCAGC
ACCGCAAGAGCGTCTTCTTCGTGGGCCAGCTTGAGGCCCCGCAGCACGTGGTGAGCTGTGACGGGGCTGTGCACGTCTGGGACCCCTTCA
CAGGGAAGACCCTTCGCACAGTGGAGCCGCTGGACAGCCGGGTGCCCCTGACTGCGGTGGCTGTCATGCCCGCCCCCCACACCAGCATCA
CCATGGCCAGCTCTGACTCTACCCTGCGCTTTGTGGACTGCAGGAAGCCTGGTCTGCAGCACGAGTTCCGACTGGGCGGTGGGCTGAACC
CTGGGCTTGTCCGTGCCCTGGCCATCAGCCCCAGTGGCCGTAGTGTCGTGGCCGGCTTCTCCTCAGGCTTCATGGTGCTCCTGGACACCC
GCACAGGCCTGGTTCTGCGAGGCTGGCCAGCCCACGAGGGGGACATTCTGCAGATCAAGGCGGTGGAGGGCAGCGTCCTGGTCAGCTCCT
CCTCTGACCATTCCTTGACCGTCTGGAAGGAGCTGGAGCAGAAGCCCACCCATCACTACAAGTCAGCATCCGACCCCATCCACACCTTTG
ACCTGTACGGCAGCGAGGTGGTCACTGGCACCGTGTCCAACAAGATTGGCGTCTGCTCCCTGCTTGAGCCACCCTCGCAGGCCACCACGA
AGCTCAGCTCTGAGAACTTCCGCGGCACGCTCACCAGCCTGGCCTTGCTGCCCACTAAACGCCACCTCCTGCTGGGCTCAGACAACGGGG
TTATCCGCCTCCTGGCATAGACTGAGGCAGGAGCTGGCCGGGCAAGGGTGGGAAGACATCTGCGGGCGCGTGTCCACTCACCCTGTTCCC
TGAGCAGCAGCTCCCTCCAGGGAGGCCCTGGGTCCCACGCCCTGGGTGCCCACATGGCCTGCCAACTAGGGCCTGCAAATGGAGTGGGGG
AGTCCTGGCCCCTGAATCACCAGAGCCACCAAGCCTGCCAGAGGGGTCTCATTCATGGCTTGGGGACACAGGGCTCCTAGCAAGCAGGAA
GTTAAGAGCAGGAGGAAGCGTTGCTACCTTCACTTCTCCCCAGCTCTGCCCTCTGGGTCCACATGAGGACAGGGAAGCTCGGGAAGGGGA
AGGGAGACTGGCCCTGCCCAGCCGGTCTCTAGCCCCTCAGCCCCCGCTGGGCACTCTCTGTCCCATCCCTCTAGGACAGGGAAGCTGGCC
TGGTCCAGGGCACTGATGGTGCTTGGATTCCAGCCTAAGGAAGGCTGGCCGTGGTCCAGGAGTTAAGGGCTTGGGTCTGGGGTTTAAGTG
GCCACCCATCCAGGCCCTGGCCAGTGTGGGACCGGGACGGGAAGGAAGAAGGAGGCTAGGAGCAGGGGGAAAAGGTGCACTTGGCCAGTG
GCGCCTGCCAGGAGTGAGTCCATGCGTTGTCTGCCCACCCCTACCACAGTGTTTGTGCCTTCAGCTGAGGGGGCAGCCTCTGGGCCCTGA
ACCCCTGCTGGGGCTCCACGACCCTGAGAGAAGGGGTGAGAAGAATCATCTCTGCACCTCGGGTCTCTGCCAGAGGAAGACTTAAGCATC
CCTGCGACCTCACATTCTAGACAGAGATGAGGTCCAGGGGTTGGCCCCTGCTGCCTTCTCACAATTTGCAATAGATGTAAATAGGACCAA


Top

FusionGenePPI for RPA1_WDR81


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RPA1MCM2, MCM7, ORC2, BRCA2, TP53, BLM, ATR, TP53BP1, FANCA, TIPIN, KIN, ORC6, MCM4, MCM6, TCEA2, ASCC2, CPE, AKTIP, HGH1, RBM23, SELENBP1, RPA2, PRKDC, ATRIP, RPA4, RPA3, MUTYH, RAD52, RAD51, MSH4, XPA, RPA1, PCNA, RAD9A, RAD1, HUS1, CCNA2, FANCM, ATG101, FYCO1, RB1CC1, CHAF1A, CHD1L, PRIM1, MCPH1, HNRNPUL1, BRCA1, TOPBP1, BRIP1, TOP3A, FANCG, POLK, RFWD3, CENPA, DYRK2, CSNK2B, TK1, ANXA1, RCC1, ANXA7, GTF2H1, HDGF, PSMD4, RNF4, ARRB2, SH3KBP1, CDK1, CDK2, CCNA1, CCNB1, BID, POLR2A, ERCC6, HERC2, NEURL4, SPRTN, SMARCAL1, MCM3, SMC2, XPC, RAD23B, POLD1, UBXN1, MSH3, PPME1, PAXIP1, FN1, ATM, AICDA, PAN2, HAX1, VIM, SMAD3, RPS6KA5, GNB5, FBXO6, AARSD1, FUBP1, GRPEL1, ACTR2, ACTR3, ANP32B, ARPC2, ARPC4, CALR, NSUN2, PFDN5, PPP1R12A, PUS1, RPRD1B, SH3GL1, EXO5, PARP1, HNRNPM, MYH9, PARP14, LIG3, FBXO18, DHX36, DNA2, XRCC1, HLTF, XRN2, HNRNPD, XRCC6, GTF2I, MYH10, IQGAP1, CDKN2AIP, SFPQ, RMI1, MSI2, RTEL1, XRCC5, TIAL1, WRN, FUS, MPG, TARDBP, HNRNPA0, UNG, PARP9, HNRNPA2B1, ANXA2P2, PURB, GAPDH, PNKP, MSH2, RFC5, RBM4, NPM1, RBFOX2, FLNA, EIF2S1, ACTB, HNRNPA1, NUDT21, HNRNPAB, KCNAB2, YTHDF1, XRN1, YTHDF3, SNRNP200, NONO, INTS6, C14orf166, ELAVL1, CSNK1A1, CUL1, RBM14, DTX3L, FUBP3, RFC4, HNRNPU, RPLP0, RAVER1, ACTA2, PTBP1, EWSR1, PRDX1, IMPDH2, PARP12, RNASEH1, SLFN11, RAB11B, RPL7, EEF1A2, RAB13, SERPINB12, ANXA2, NTHL1, TAF15, NTPCR, DAZAP1, EEF1A1, YTHDF2, CELF1, ESRP2, HNRNPDL, MATR3, SF3B1, TUBB4B, DHX15, TUBA4A, ACTBL2, HNRNPA3, KHDRBS1, RAB5C, HSPB1, SNRPB, TUBA1C, APEX1, MYH11, DDX5, PRPF6, DDX17, RPS9, RAB7A, SEC22B, RAB1A, TUBB, RPS7, CAPZA1, EMG1, RAB8A, RAI14, HNRNPK, PDS5A, LMO7, RBM27, SF3B2, NCL, RPL13A, RPS5, LDHA, PPP1CC, RFC2, EFTUD2, SF3A1, MPRIP, CHTF18, RBM25, ILF3, SF3B3, RBM26, SPTAN1, BCAP31, MNAT1, DDX3X, BCAS2, MDC1, RAB35, RBM39, RPL19, RPL9, BUB3, RPS8, CSNK1A1L, RAB10, TMEM33, MYO1C, DSP, PRPF8, TOP2B, PABPC1, TCOF1, TFRC, MYO1E, RBM15, PRPF40A, SKIV2L2, MYOF, PPP1R10, SMC3, INTS3, THOC2, RAD50, SYMPK, CLTC, KIAA0196, TRIM28, ARHGEF2, HNRNPR, LIMCH1, ALPP, CDC5L, CKAP5, RPL6, SMC1A, HSPA8, CCAR2, LIMA1, LMAN2, MYO1B, WDR82, ADAR, FKBP15, HNRNPL, ILF2, MOV10, RFC1, SPTBN1, THOC6, AHNAK, PRRC2A, CHD4, DHX9, HSPA5, KDM1A, MRE11A, MTHFD1, NAPA, SYNCRIP, TOP2A, DDX23, DNTTIP1, LOC442497, SCAMP3, U2SURP, TSR1, WDR3, ADD1, CAPRIN1, CCNH, CPSF7, EXOSC10, GTF2H3, MAP4, NBN, POLA1, PSIP1, RAB2A, RFC3, RPL18A, SNRNP40, SRBD1, TAGLN2, TMPO, TPX2, AP1B1, BAG2, BBX, ELMSAN1, CALD1, CANX, CDK7, COPA, CSNK2A2, DDX46, EGFR, ERGIC1, GEMIN5, GTF3C2, PKP3, POLR1B, POLR2E, RALY, SMC4, STRBP, THOC7, TRIP12, WDR33, ATP6V0D1, C7orf50, CAV1, CLINT1, COBL, CPSF1, CTTN, DDB1, DDX1, DIDO1, DNAJC9, EDC4, EIF2S2, ESYT1, HCFC1, INTS1, MORF4L2, PCF11, PPP2CA, RAB14, RAB6B, RPL15, RPS7P4, SMARCA5, THOC1, TPM2, UBC, ZNF638, AKAP8, AP2A1, AP2A2, AP2B1, ARG1, CHERP, EPRS, EXOSC7, EXOSC8, FBL, GEMIN4, HNRNPCL1, HNRNPF, HNRNPH1, ITGB1, KIAA1033, MED4, MYO1F, NIPBL, NUMA1, PABPC4, PELP1, PGRMC1, PRPF19, RAB6A, RAD21, RBM10, RPL10L, RPL13P12, RPL18, RPRD2, RPS3A, RTN4, RUVBL2, SEH1L, SCAF4, SMARCC2, TCERG1, TERF2, TEX10, USP7, WAPAL, WDHD1, ZCCHC8, ZFR, ZNF598, TRIM25, ATRX, APITD1, STRA13, MTUS2, CUL7, CCDC8, RNF2, LUZP4, RPAIN, LTN1, CORO1C, LMNA, LMNB1, TFAM, NTRK1, CEP162, TOP3B, KIF3A, PROSC, DROSHA, OBSCN, SLX4, NF2, USP37, SHFM1, SNW1, NFATC1, NFATC2, DERL1, EYA1, MACROD1, RBM3, POLL, ERCC1, HELQ, FANCD2, SPTA1, DLD, PDHA1, CCND2, UHRF2WDR81PPP4C, BLNK, CUL3, MAPK15, ENO1, SHMT2, MOV10, NXF1, NTRK1, TMEM237, XPO1, WFDC2, BECN1, SQSTM1, MAP1LC3C, UBC, WDR91


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RPA1_WDR81


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RPA1_WDR81


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRPA1C0263454Chloracne1CTD_human
TgeneWDR81C2750234Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 21UNIPROT