FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31724

FusionGeneSummary for ROS1_CD74

check button Fusion gene summary
Fusion gene informationFusion gene name: ROS1_CD74
Fusion gene ID: 31724
HgeneTgene
Gene symbol

ROS1

CD74

Gene ID

6098

972

Gene nameROS proto-oncogene 1, receptor tyrosine kinaseCD74 molecule
SynonymsMCF3|ROS|c-ros-1DHLAG|HLADG|II|Ia-GAMMA
Cytomap

6q22.1

5q33.1

Type of geneprotein-codingprotein-coding
Descriptionproto-oncogene tyrosine-protein kinase ROSROS proto-oncogene 1 , receptor tyrosine kinasec-ros oncogene 1 , receptor tyrosine kinaseproto-oncogene c-Ros-1transmembrane tyrosine-specific protein kinasev-ros avian UR2 sarcoma virus oncogene homolog 1HLA class II histocompatibility antigen gamma chainCD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)CD74 molecule, major histocompatibility complex, class II invariant chainHLA-DR antigens-associated
Modification date2018052320180522
UniProtAcc

P08922

P04233

Ensembl transtripts involved in fusion geneENST00000368508, ENST00000368507, 
ENST00000377795, ENST00000353334, 
ENST00000524315, ENST00000009530, 
Fusion gene scores* DoF score3 X 3 X 1=916 X 15 X 5=1200
# samples 327
** MAII scorelog2(3/9*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(27/1200*10)=-2.15200309344505
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ROS1 [Title/Abstract] AND CD74 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneROS1

GO:0001558

regulation of cell growth

16885344

HgeneROS1

GO:0006468

protein phosphorylation

16885344

HgeneROS1

GO:0032006

regulation of TOR signaling

16885344

TgeneCD74

GO:0001516

prostaglandin biosynthetic process

12782713

TgeneCD74

GO:0001934

positive regulation of protein phosphorylation

24942581

TgeneCD74

GO:0002792

negative regulation of peptide secretion

19849849

TgeneCD74

GO:0007165

signal transduction

12782713

TgeneCD74

GO:0008283

cell proliferation

12782713

TgeneCD74

GO:0033674

positive regulation of kinase activity

24942581

TgeneCD74

GO:0043066

negative regulation of apoptotic process

12782713

TgeneCD74

GO:0043123

positive regulation of I-kappaB kinase/NF-kappaB signaling

24942581

TgeneCD74

GO:0043410

positive regulation of MAPK cascade

24942581

TgeneCD74

GO:0043518

negative regulation of DNA damage response, signal transduction by p53 class mediator

17045821

TgeneCD74

GO:0045657

positive regulation of monocyte differentiation

24942581

TgeneCD74

GO:0045893

positive regulation of transcription, DNA-templated

24942581

TgeneCD74

GO:0046598

positive regulation of viral entry into host cell

24942581

TgeneCD74

GO:0050731

positive regulation of peptidyl-tyrosine phosphorylation

17045821

TgeneCD74

GO:0051290

protein heterotetramerization

24942581

TgeneCD74

GO:0070374

positive regulation of ERK1 and ERK2 cascade

17045821|24942581


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-86-8278-01AROS1chr6

117700222

-CD74chr5

149782188

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000368508ENST00000377795ROS1chr6

117700222

-CD74chr5

149782188

-
Frame-shitENST00000368508ENST00000353334ROS1chr6

117700222

-CD74chr5

149782188

-
5CDS-intronENST00000368508ENST00000524315ROS1chr6

117700222

-CD74chr5

149782188

-
5CDS-intronENST00000368508ENST00000009530ROS1chr6

117700222

-CD74chr5

149782188

-
In-frameENST00000368507ENST00000377795ROS1chr6

117700222

-CD74chr5

149782188

-
Frame-shitENST00000368507ENST00000353334ROS1chr6

117700222

-CD74chr5

149782188

-
5CDS-intronENST00000368507ENST00000524315ROS1chr6

117700222

-CD74chr5

149782188

-
5CDS-intronENST00000368507ENST00000009530ROS1chr6

117700222

-CD74chr5

149782188

-

Top

FusionProtFeatures for ROS1_CD74


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ROS1

P08922

CD74

P04233

Orphan receptor tyrosine kinase (RTK) that plays a rolein epithelial cell differentiation and regionalization of theproximal epididymal epithelium. May activate several downstreamsignaling pathways related to cell differentiation, proliferation,growth and survival including the PI3 kinase-mTOR signalingpathway. Mediates the phosphorylation of PTPN11, an activator ofthis pathway. May also phosphorylate and activate thetranscription factor STAT3 to control anchorage-independent cellgrowth. Mediates the phosphorylation and the activation of VAV3, aguanine nucleotide exchange factor regulating cell morphology. Mayactivate other downstream signaling proteins including AKT1,MAPK1, MAPK3, IRS1 and PLCG2. {ECO:0000269|PubMed:11094073,ECO:0000269|PubMed:16885344}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-1743101_1968652348DomainFibronectin type-III 1
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-1743197_2858652348DomainFibronectin type-III 2
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-1743557_6718652348DomainFibronectin type-III 3
TgeneCD74chr6:117700222chr5:149782188ENST00000353334-58210_271208233DomainThyroglobulin type-1
TgeneCD74chr6:117700222chr5:149782188ENST00000377795-36210_271147280DomainThyroglobulin type-1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-17431043_11508652348DomainFibronectin type-III 5
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-17431450_15568652348DomainFibronectin type-III 6
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-17431557_16568652348DomainFibronectin type-III 7
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-17431658_17518652348DomainFibronectin type-III 8
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-17431752_18548652348DomainFibronectin type-III 9
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-17431945_22228652348DomainProtein kinase
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-1743947_10428652348DomainFibronectin type-III 4
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-17431951_19598652348Nucleotide bindingATP
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-17431883_23478652348Topological domainCytoplasmic
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-174328_18598652348Topological domainExtracellular
HgeneROS1chr6:117700222chr5:149782188ENST00000368508-17431860_18828652348TransmembraneHelical
TgeneCD74chr6:117700222chr5:149782188ENST00000009530-69210_271272297DomainThyroglobulin type-1
TgeneCD74chr6:117700222chr5:149782188ENST00000009530-69103_117272297RegionNote=CLIP
TgeneCD74chr6:117700222chr5:149782188ENST00000353334-58103_117208233RegionNote=CLIP
TgeneCD74chr6:117700222chr5:149782188ENST00000377795-36103_117147280RegionNote=CLIP
TgeneCD74chr6:117700222chr5:149782188ENST00000009530-691_46272297Topological domainCytoplasmic
TgeneCD74chr6:117700222chr5:149782188ENST00000009530-6973_296272297Topological domainExtracellular
TgeneCD74chr6:117700222chr5:149782188ENST00000353334-581_46208233Topological domainCytoplasmic
TgeneCD74chr6:117700222chr5:149782188ENST00000353334-5873_296208233Topological domainExtracellular
TgeneCD74chr6:117700222chr5:149782188ENST00000377795-361_46147280Topological domainCytoplasmic
TgeneCD74chr6:117700222chr5:149782188ENST00000377795-3673_296147280Topological domainExtracellular
TgeneCD74chr6:117700222chr5:149782188ENST00000009530-6947_72272297TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneCD74chr6:117700222chr5:149782188ENST00000353334-5847_72208233TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneCD74chr6:117700222chr5:149782188ENST00000377795-3647_72147280TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for ROS1_CD74


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ROS1_ENST00000368508_chr6_117700222_-_CD74_ENST00000377795_chr5_149782188_-_879aa
MKNIYCLIPKLVNFATLGCLWISVVQCTVLNSCLKSCVTNLGQQLDLGTPHNLSEPCIQGCHFWNSVDQKNCALKCRESCEVGCSSAEGA
TEEEVLENADLPTAPFASSIGSHNMTLRWKSANFSGVKYIIQWKTAQLLGSWTTTKTVSRPSTVVKPLHPFTEYIFRVVWIFTAQLQLYS
PPSPSYRTHPHGVPETAPLIRNIESSSPDTVEVSWDPPQFPGGPILGTNLRLISKNQKLDAGTQRTSFQFYSTLPNTIYRFSIAAVNEVG
EGPEAESSITTSSSAVQQEEQWLFLSRKTSLRKRSLKHLVDEAHCLRLDAIYHNITGISVDVHQQIVTFSEGTLIWAKKAANMSDVSDLR
IFYRGSGLISSISIDWLTQRMTFIMDELVCVCDLENCSNIEEITPPSISAPQKIVADSYNGTVFYLLRDGITRADLPVPSGRCAEAVRIV
ESCTLKDFAIKPQAKRIIYFNDTAQVFMSTFLDGSASHLILPRIPFADVKSFACENNDFLVTDGKVIFQQDALSFNEFIVGCDLSHIEEF
GFGNLVIFGSSSQLHPLPGRPQELSVLFGSHQALVQWKPPALAIGANVILISDIIELFELGPSAWQNWTTEVKVSTQDPPEVTHIFLNIS
GTMLNVPELQSAMKYKVSVRASSPKRPGPWSEPSVGTTLVPASEPPFIMAVKEDGLWSKPLNSFGPGEFLSSDIGNVSDMDWTNNSLYYS
DTKGDVFVWLLNGTDISENTHLPSIAGAGALAFEWLGHFLYWAGKTTVIQRQSVLTGHTDIVTHVKLLVNDMVVDSVGGTLYWTTLTSVE

>In-frame_ROS1_ENST00000368507_chr6_117700222_-_CD74_ENST00000377795_chr5_149782188_-_874aa
MKNIYCLIPKLVNFATLGCLWISVVQCTVLNSCLKSCVTNLGQQLDLGTPHNLSEPCIQGCHFWNSVDQKNCALKCNDTTATVCERESCE
VGCSSAEGATEEEVLENADLPTAPFASSIGSHNMTLRWKSANFSGVKYIIQWKTAQLLGSWTTTKTVSRPSTVVKPLHPFTEYIFRVVWI
FTAQLQLYSPPSPSYRTHPHGVPETAPLIRNIESSSPDTVEVSWDPPQFPGGPILGTNLRLISKNQKLDAGTQRTSFQFYSTLPNTIYRF
SIAAVNEVGEGPEAESSITTSSSAVQQEEQWLFLSRKTSLRKRSLKHLVDEAHCLRLDAIYHNITGISVDVHQQIVTFSEGTLIWAKKAA
NMSDVSDLRIFYRGSGLISSISIDWLTQRMTFIMDELVCVCDLENCSNIEEITPPSISAPQKIVADSYNGTVFYLLRDGITRADLPVPSG
RCAEAVRIVESCTLKDFAIKPQAKRIIYFNDTAQVFMSTFLDGSASHLILPRIPFADVKSFACENNDFLVTDGKVIFQQDALSFNEFIVG
CDLSHIEEFGFGNLVIFGSSSQLHPLPGRPQELSVLFGSHQALVQWKPPALAIGASPSAWQNWTTEVKVSTQDPPEVTHIFLNISGTMLN
VPELQSAMKYKVSVRASSPKRPGPWSEPSVGTTLVPASEPPFIMAVKEDGLWSKPLNSFGPGEFLSSDIGNVSDMDWTNNSLYYSDTKGD
VFVWLLNGTDISENTHLPSIAGAGALAFEWLGHFLYWAGKTTVIQRQSVLTGHTDIVTHVKLLVNDMVVDSVGGTLYWTTLTSVESTRLN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ROS1_ENST00000368508_chr6_117700222_-_CD74_ENST00000377795_chr5_149782188_-_2639nt
ATGAAGAACATTTACTGTCTTATTCCGAAGCTTGTCAATTTTGCAACTCTTGGCTGCCTATGGATTTCTGTGGTGCAGTGTACAGTTTTA
AATAGCTGCCTAAAGTCGTGTGTAACTAATCTGGGCCAGCAGCTTGACCTTGGCACACCACATAATCTGAGTGAACCGTGTATCCAAGGA
TGTCACTTTTGGAACTCTGTAGATCAGAAAAACTGTGCTTTAAAGTGTCGGGAGTCGTGTGAGGTTGGCTGTAGCAGCGCGGAAGGTGCA
TATGAAGAGGAAGTACTGGAAAATGCAGACCTACCAACTGCTCCCTTTGCTTCTTCCATTGGAAGCCACAATATGACATTACGATGGAAA
TCTGCAAACTTCTCTGGAGTAAAATACATCATTCAGTGGAAATATGCACAACTTCTGGGAAGCTGGACTTATACTAAGACTGTGTCCAGA
CCGTCCTATGTGGTCAAGCCCCTGCACCCCTTCACTGAGTACATTTTCCGAGTGGTTTGGATCTTCACAGCGCAGCTGCAGCTCTACTCC
CCTCCAAGTCCCAGTTACAGGACTCATCCTCATGGAGTTCCTGAAACTGCACCTTTGATTAGGAATATTGAGAGCTCAAGTCCCGACACT
GTGGAAGTCAGCTGGGATCCACCTCAATTCCCAGGTGGACCTATTTTGGGTTATAACTTAAGGCTGATCAGCAAAAATCAAAAATTAGAT
GCAGGGACACAGAGAACCAGTTTCCAGTTTTACTCCACTTTACCAAATACTATCTACAGGTTTTCTATTGCAGCAGTAAATGAAGTTGGT
GAGGGTCCAGAAGCAGAATCTAGTATTACCACTTCATCTTCAGCAGTTCAACAAGAGGAACAGTGGCTCTTTTTATCCAGAAAAACTTCT
CTAAGAAAGAGATCTTTAAAACATTTAGTAGATGAAGCACATTGCCTTCGGTTGGATGCTATATACCATAATATTACAGGAATATCTGTT
GATGTCCACCAGCAAATTGTTTATTTCTCTGAAGGAACTCTCATATGGGCGAAGAAGGCTGCCAACATGTCTGATGTATCTGACCTGAGA
ATTTTTTACAGAGGTTCAGGATTAATTTCTTCTATCTCCATAGATTGGCTTTATCAAAGAATGTATTTCATCATGGATGAACTGGTATGT
GTCTGTGATTTAGAGAACTGCTCAAACATCGAGGAAATTACTCCACCCTCTATTAGTGCACCTCAAAAAATTGTGGCTGATTCATACAAT
GGGTATGTCTTTTACCTCCTGAGAGATGGCATTTATAGAGCAGACCTTCCTGTACCATCTGGCCGGTGTGCAGAAGCTGTGCGTATTGTG
GAGAGTTGCACGTTAAAGGACTTTGCAATCAAGCCACAAGCCAAGCGAATCATTTACTTCAATGACACTGCCCAAGTCTTCATGTCAACA
TTTCTGGATGGCTCTGCTTCCCATCTCATCCTACCTCGCATCCCCTTTGCTGATGTGAAAAGTTTTGCTTGTGAAAACAATGACTTTCTT
GTCACAGATGGCAAGGTCATTTTCCAACAGGATGCTTTGTCTTTTAATGAATTCATCGTGGGATGTGACCTGAGTCACATAGAAGAATTT
GGGTTTGGTAACTTGGTCATCTTTGGCTCATCCTCCCAGCTGCACCCTCTGCCAGGCCGCCCGCAGGAGCTTTCGGTGCTGTTTGGCTCT
CACCAGGCTCTTGTTCAATGGAAGCCTCCTGCCCTTGCCATAGGAGCCAATGTCATCCTGATCAGTGATATTATTGAACTCTTTGAATTA
GGCCCTTCTGCCTGGCAGAACTGGACCTATGAGGTGAAAGTATCCACCCAAGACCCTCCTGAAGTCACTCATATTTTCTTGAACATAAGT
GGAACCATGCTGAATGTACCTGAGCTGCAGAGTGCTATGAAATACAAGGTTTCTGTGAGAGCAAGTTCTCCAAAGAGGCCAGGCCCCTGG
TCAGAGCCCTCAGTGGGTACTACCCTGGTGCCAGCTAGTGAACCACCATTTATCATGGCTGTGAAAGAAGATGGGCTTTGGAGTAAACCA
TTAAATAGCTTTGGCCCAGGAGAGTTCTTATCCTCTGATATAGGAAATGTGTCAGACATGGATTGGTATAACAACAGCCTCTACTACAGT
GACACGAAAGGCGACGTTTTTGTGTGGCTGCTGAATGGGACGGATATCTCAGAGAATTATCACCTACCCAGCATTGCAGGAGCAGGGGCT
TTAGCTTTTGAGTGGCTGGGTCACTTTCTCTACTGGGCTGGAAAGACATATGTGATACAAAGGCAGTCTGTGTTGACGGGACACACAGAC
ATTGTTACCCACGTGAAGCTATTGGTGAATGACATGGTGGTGGATTCAGTTGGTGGATATCTCTACTGGACCACACTCTATTCAGTGGAA
AGCACCAGACTAAATGGGGAAAGTTCCCTTGTACTACAGACACAGCCTTGGTTTTCTGGGAAAAAGGTAATTGCTCTAACTTTAGACCTC
AGTGATGGGCTCCTGTATTGGTTGGTTCAAGACAGTCAATGTATTCACCTGTACACAGCTGTTCTTCGGGGACAGAGAGTCACTGGAACT

>In-frame_ROS1_ENST00000368507_chr6_117700222_-_CD74_ENST00000377795_chr5_149782188_-_2624nt
ATGAAGAACATTTACTGTCTTATTCCGAAGCTTGTCAATTTTGCAACTCTTGGCTGCCTATGGATTTCTGTGGTGCAGTGTACAGTTTTA
AATAGCTGCCTAAAGTCGTGTGTAACTAATCTGGGCCAGCAGCTTGACCTTGGCACACCACATAATCTGAGTGAACCGTGTATCCAAGGA
TGTCACTTTTGGAACTCTGTAGATCAGAAAAACTGTGCTTTAAAGTGTAATGATACTTATGCCACCGTTTGTGAGCGGGAGTCGTGTGAG
GTTGGCTGTAGCAGCGCGGAAGGTGCATATGAAGAGGAAGTACTGGAAAATGCAGACCTACCAACTGCTCCCTTTGCTTCTTCCATTGGA
AGCCACAATATGACATTACGATGGAAATCTGCAAACTTCTCTGGAGTAAAATACATCATTCAGTGGAAATATGCACAACTTCTGGGAAGC
TGGACTTATACTAAGACTGTGTCCAGACCGTCCTATGTGGTCAAGCCCCTGCACCCCTTCACTGAGTACATTTTCCGAGTGGTTTGGATC
TTCACAGCGCAGCTGCAGCTCTACTCCCCTCCAAGTCCCAGTTACAGGACTCATCCTCATGGAGTTCCTGAAACTGCACCTTTGATTAGG
AATATTGAGAGCTCAAGTCCCGACACTGTGGAAGTCAGCTGGGATCCACCTCAATTCCCAGGTGGACCTATTTTGGGTTATAACTTAAGG
CTGATCAGCAAAAATCAAAAATTAGATGCAGGGACACAGAGAACCAGTTTCCAGTTTTACTCCACTTTACCAAATACTATCTACAGGTTT
TCTATTGCAGCAGTAAATGAAGTTGGTGAGGGTCCAGAAGCAGAATCTAGTATTACCACTTCATCTTCAGCAGTTCAACAAGAGGAACAG
TGGCTCTTTTTATCCAGAAAAACTTCTCTAAGAAAGAGATCTTTAAAACATTTAGTAGATGAAGCACATTGCCTTCGGTTGGATGCTATA
TACCATAATATTACAGGAATATCTGTTGATGTCCACCAGCAAATTGTTTATTTCTCTGAAGGAACTCTCATATGGGCGAAGAAGGCTGCC
AACATGTCTGATGTATCTGACCTGAGAATTTTTTACAGAGGTTCAGGATTAATTTCTTCTATCTCCATAGATTGGCTTTATCAAAGAATG
TATTTCATCATGGATGAACTGGTATGTGTCTGTGATTTAGAGAACTGCTCAAACATCGAGGAAATTACTCCACCCTCTATTAGTGCACCT
CAAAAAATTGTGGCTGATTCATACAATGGGTATGTCTTTTACCTCCTGAGAGATGGCATTTATAGAGCAGACCTTCCTGTACCATCTGGC
CGGTGTGCAGAAGCTGTGCGTATTGTGGAGAGTTGCACGTTAAAGGACTTTGCAATCAAGCCACAAGCCAAGCGAATCATTTACTTCAAT
GACACTGCCCAAGTCTTCATGTCAACATTTCTGGATGGCTCTGCTTCCCATCTCATCCTACCTCGCATCCCCTTTGCTGATGTGAAAAGT
TTTGCTTGTGAAAACAATGACTTTCTTGTCACAGATGGCAAGGTCATTTTCCAACAGGATGCTTTGTCTTTTAATGAATTCATCGTGGGA
TGTGACCTGAGTCACATAGAAGAATTTGGGTTTGGTAACTTGGTCATCTTTGGCTCATCCTCCCAGCTGCACCCTCTGCCAGGCCGCCCG
CAGGAGCTTTCGGTGCTGTTTGGCTCTCACCAGGCTCTTGTTCAATGGAAGCCTCCTGCCCTTGCCATAGGAGCCAGCCCTTCTGCCTGG
CAGAACTGGACCTATGAGGTGAAAGTATCCACCCAAGACCCTCCTGAAGTCACTCATATTTTCTTGAACATAAGTGGAACCATGCTGAAT
GTACCTGAGCTGCAGAGTGCTATGAAATACAAGGTTTCTGTGAGAGCAAGTTCTCCAAAGAGGCCAGGCCCCTGGTCAGAGCCCTCAGTG
GGTACTACCCTGGTGCCAGCTAGTGAACCACCATTTATCATGGCTGTGAAAGAAGATGGGCTTTGGAGTAAACCATTAAATAGCTTTGGC
CCAGGAGAGTTCTTATCCTCTGATATAGGAAATGTGTCAGACATGGATTGGTATAACAACAGCCTCTACTACAGTGACACGAAAGGCGAC
GTTTTTGTGTGGCTGCTGAATGGGACGGATATCTCAGAGAATTATCACCTACCCAGCATTGCAGGAGCAGGGGCTTTAGCTTTTGAGTGG
CTGGGTCACTTTCTCTACTGGGCTGGAAAGACATATGTGATACAAAGGCAGTCTGTGTTGACGGGACACACAGACATTGTTACCCACGTG
AAGCTATTGGTGAATGACATGGTGGTGGATTCAGTTGGTGGATATCTCTACTGGACCACACTCTATTCAGTGGAAAGCACCAGACTAAAT
GGGGAAAGTTCCCTTGTACTACAGACACAGCCTTGGTTTTCTGGGAAAAAGGTAATTGCTCTAACTTTAGACCTCAGTGATGGGCTCCTG
TATTGGTTGGTTCAAGACAGTCAATGTATTCACCTGTACACAGCTGTTCTTCGGGGACAGAGAGTCACTGGAACTGGAGGACCCGTCTTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ROS1_ENST00000368508_chr6_117700222_-_CD74_ENST00000377795_chr5_149782188_-_3473nt
CAAGCTTTCAAGCATTCAAAGGTCTAAATGAAAAAGGCTAAGTATTATTTCAAAAGGCAAGTATATCCTAATATAGCAAAACAAACAAAG
CAAAATCCATCAGCTACTCCTCCAATTGAAGTGATGAAGCCCAAATAATTCATATAGCAAAATGGAGAAAATTAGACCGGCCATCTAAAA
ATCTGCCATTGGTGAAGTGATGAAGAACATTTACTGTCTTATTCCGAAGCTTGTCAATTTTGCAACTCTTGGCTGCCTATGGATTTCTGT
GGTGCAGTGTACAGTTTTAAATAGCTGCCTAAAGTCGTGTGTAACTAATCTGGGCCAGCAGCTTGACCTTGGCACACCACATAATCTGAG
TGAACCGTGTATCCAAGGATGTCACTTTTGGAACTCTGTAGATCAGAAAAACTGTGCTTTAAAGTGTCGGGAGTCGTGTGAGGTTGGCTG
TAGCAGCGCGGAAGGTGCATATGAAGAGGAAGTACTGGAAAATGCAGACCTACCAACTGCTCCCTTTGCTTCTTCCATTGGAAGCCACAA
TATGACATTACGATGGAAATCTGCAAACTTCTCTGGAGTAAAATACATCATTCAGTGGAAATATGCACAACTTCTGGGAAGCTGGACTTA
TACTAAGACTGTGTCCAGACCGTCCTATGTGGTCAAGCCCCTGCACCCCTTCACTGAGTACATTTTCCGAGTGGTTTGGATCTTCACAGC
GCAGCTGCAGCTCTACTCCCCTCCAAGTCCCAGTTACAGGACTCATCCTCATGGAGTTCCTGAAACTGCACCTTTGATTAGGAATATTGA
GAGCTCAAGTCCCGACACTGTGGAAGTCAGCTGGGATCCACCTCAATTCCCAGGTGGACCTATTTTGGGTTATAACTTAAGGCTGATCAG
CAAAAATCAAAAATTAGATGCAGGGACACAGAGAACCAGTTTCCAGTTTTACTCCACTTTACCAAATACTATCTACAGGTTTTCTATTGC
AGCAGTAAATGAAGTTGGTGAGGGTCCAGAAGCAGAATCTAGTATTACCACTTCATCTTCAGCAGTTCAACAAGAGGAACAGTGGCTCTT
TTTATCCAGAAAAACTTCTCTAAGAAAGAGATCTTTAAAACATTTAGTAGATGAAGCACATTGCCTTCGGTTGGATGCTATATACCATAA
TATTACAGGAATATCTGTTGATGTCCACCAGCAAATTGTTTATTTCTCTGAAGGAACTCTCATATGGGCGAAGAAGGCTGCCAACATGTC
TGATGTATCTGACCTGAGAATTTTTTACAGAGGTTCAGGATTAATTTCTTCTATCTCCATAGATTGGCTTTATCAAAGAATGTATTTCAT
CATGGATGAACTGGTATGTGTCTGTGATTTAGAGAACTGCTCAAACATCGAGGAAATTACTCCACCCTCTATTAGTGCACCTCAAAAAAT
TGTGGCTGATTCATACAATGGGTATGTCTTTTACCTCCTGAGAGATGGCATTTATAGAGCAGACCTTCCTGTACCATCTGGCCGGTGTGC
AGAAGCTGTGCGTATTGTGGAGAGTTGCACGTTAAAGGACTTTGCAATCAAGCCACAAGCCAAGCGAATCATTTACTTCAATGACACTGC
CCAAGTCTTCATGTCAACATTTCTGGATGGCTCTGCTTCCCATCTCATCCTACCTCGCATCCCCTTTGCTGATGTGAAAAGTTTTGCTTG
TGAAAACAATGACTTTCTTGTCACAGATGGCAAGGTCATTTTCCAACAGGATGCTTTGTCTTTTAATGAATTCATCGTGGGATGTGACCT
GAGTCACATAGAAGAATTTGGGTTTGGTAACTTGGTCATCTTTGGCTCATCCTCCCAGCTGCACCCTCTGCCAGGCCGCCCGCAGGAGCT
TTCGGTGCTGTTTGGCTCTCACCAGGCTCTTGTTCAATGGAAGCCTCCTGCCCTTGCCATAGGAGCCAATGTCATCCTGATCAGTGATAT
TATTGAACTCTTTGAATTAGGCCCTTCTGCCTGGCAGAACTGGACCTATGAGGTGAAAGTATCCACCCAAGACCCTCCTGAAGTCACTCA
TATTTTCTTGAACATAAGTGGAACCATGCTGAATGTACCTGAGCTGCAGAGTGCTATGAAATACAAGGTTTCTGTGAGAGCAAGTTCTCC
AAAGAGGCCAGGCCCCTGGTCAGAGCCCTCAGTGGGTACTACCCTGGTGCCAGCTAGTGAACCACCATTTATCATGGCTGTGAAAGAAGA
TGGGCTTTGGAGTAAACCATTAAATAGCTTTGGCCCAGGAGAGTTCTTATCCTCTGATATAGGAAATGTGTCAGACATGGATTGGTATAA
CAACAGCCTCTACTACAGTGACACGAAAGGCGACGTTTTTGTGTGGCTGCTGAATGGGACGGATATCTCAGAGAATTATCACCTACCCAG
CATTGCAGGAGCAGGGGCTTTAGCTTTTGAGTGGCTGGGTCACTTTCTCTACTGGGCTGGAAAGACATATGTGATACAAAGGCAGTCTGT
GTTGACGGGACACACAGACATTGTTACCCACGTGAAGCTATTGGTGAATGACATGGTGGTGGATTCAGTTGGTGGATATCTCTACTGGAC
CACACTCTATTCAGTGGAAAGCACCAGACTAAATGGGGAAAGTTCCCTTGTACTACAGACACAGCCTTGGTTTTCTGGGAAAAAGGTAAT
TGCTCTAACTTTAGACCTCAGTGATGGGCTCCTGTATTGGTTGGTTCAAGACAGTCAATGTATTCACCTGTACACAGCTGTTCTTCGGGG
ACAGAGAGTCACTGGAACTGGAGGACCCGTCTTCTGGGCTGGGTGTGACCAAGCAGGATCTGGGCCCAGTCCCCATGTGAGAGCAGCAGA
GGCGGTCTTCAACATCCTGCCAGCCCCACACAGCTACAGCTTTCTTGCTCCCTTCAGCCCCCAGCCCCTCCCCCATCTCCCACCCTGTAC
CTCATCCCATGAGACCCTGGTGCCTGGCTCTTTCGTCACCCTTGGACAAGACAAACCAAGTCGGAACAGCAGATAACAATGCAGCAAGGC
CCTGCTGCCCAATCTCCATCTGTCAACAGGGGCGTGAGGTCCCAGGAAGTGGCCAAAAGCTAGACAGATCCCCGTTCCTGACATCACAGC
AGCCTCCAACACAAGGCTCCAAGACCTAGGCTCATGGACGAGATGGGAAGGCACAGGGAGAAGGGATAACCCTACACCCAGACCCCAGGC
TGGACATGCTGACTGTCCTCTCCCCTCCAGCCTTTGGCCTTGGCTTTTCTAGCCTATTTACCTGCAGGCTGAGCCACTCTCTTCCCTTTC
CCCAGCATCACTCCCCAAGGAAGAGCCAATGTTTTCCACCCATAATCCTTTCTGCCGACCCCTAGTTCCCTCTGCTCAGCCAAGCTTGTT

>In-frame_ROS1_ENST00000368507_chr6_117700222_-_CD74_ENST00000377795_chr5_149782188_-_3458nt
CAAGCTTTCAAGCATTCAAAGGTCTAAATGAAAAAGGCTAAGTATTATTTCAAAAGGCAAGTATATCCTAATATAGCAAAACAAACAAAG
CAAAATCCATCAGCTACTCCTCCAATTGAAGTGATGAAGCCCAAATAATTCATATAGCAAAATGGAGAAAATTAGACCGGCCATCTAAAA
ATCTGCCATTGGTGAAGTGATGAAGAACATTTACTGTCTTATTCCGAAGCTTGTCAATTTTGCAACTCTTGGCTGCCTATGGATTTCTGT
GGTGCAGTGTACAGTTTTAAATAGCTGCCTAAAGTCGTGTGTAACTAATCTGGGCCAGCAGCTTGACCTTGGCACACCACATAATCTGAG
TGAACCGTGTATCCAAGGATGTCACTTTTGGAACTCTGTAGATCAGAAAAACTGTGCTTTAAAGTGTAATGATACTTATGCCACCGTTTG
TGAGCGGGAGTCGTGTGAGGTTGGCTGTAGCAGCGCGGAAGGTGCATATGAAGAGGAAGTACTGGAAAATGCAGACCTACCAACTGCTCC
CTTTGCTTCTTCCATTGGAAGCCACAATATGACATTACGATGGAAATCTGCAAACTTCTCTGGAGTAAAATACATCATTCAGTGGAAATA
TGCACAACTTCTGGGAAGCTGGACTTATACTAAGACTGTGTCCAGACCGTCCTATGTGGTCAAGCCCCTGCACCCCTTCACTGAGTACAT
TTTCCGAGTGGTTTGGATCTTCACAGCGCAGCTGCAGCTCTACTCCCCTCCAAGTCCCAGTTACAGGACTCATCCTCATGGAGTTCCTGA
AACTGCACCTTTGATTAGGAATATTGAGAGCTCAAGTCCCGACACTGTGGAAGTCAGCTGGGATCCACCTCAATTCCCAGGTGGACCTAT
TTTGGGTTATAACTTAAGGCTGATCAGCAAAAATCAAAAATTAGATGCAGGGACACAGAGAACCAGTTTCCAGTTTTACTCCACTTTACC
AAATACTATCTACAGGTTTTCTATTGCAGCAGTAAATGAAGTTGGTGAGGGTCCAGAAGCAGAATCTAGTATTACCACTTCATCTTCAGC
AGTTCAACAAGAGGAACAGTGGCTCTTTTTATCCAGAAAAACTTCTCTAAGAAAGAGATCTTTAAAACATTTAGTAGATGAAGCACATTG
CCTTCGGTTGGATGCTATATACCATAATATTACAGGAATATCTGTTGATGTCCACCAGCAAATTGTTTATTTCTCTGAAGGAACTCTCAT
ATGGGCGAAGAAGGCTGCCAACATGTCTGATGTATCTGACCTGAGAATTTTTTACAGAGGTTCAGGATTAATTTCTTCTATCTCCATAGA
TTGGCTTTATCAAAGAATGTATTTCATCATGGATGAACTGGTATGTGTCTGTGATTTAGAGAACTGCTCAAACATCGAGGAAATTACTCC
ACCCTCTATTAGTGCACCTCAAAAAATTGTGGCTGATTCATACAATGGGTATGTCTTTTACCTCCTGAGAGATGGCATTTATAGAGCAGA
CCTTCCTGTACCATCTGGCCGGTGTGCAGAAGCTGTGCGTATTGTGGAGAGTTGCACGTTAAAGGACTTTGCAATCAAGCCACAAGCCAA
GCGAATCATTTACTTCAATGACACTGCCCAAGTCTTCATGTCAACATTTCTGGATGGCTCTGCTTCCCATCTCATCCTACCTCGCATCCC
CTTTGCTGATGTGAAAAGTTTTGCTTGTGAAAACAATGACTTTCTTGTCACAGATGGCAAGGTCATTTTCCAACAGGATGCTTTGTCTTT
TAATGAATTCATCGTGGGATGTGACCTGAGTCACATAGAAGAATTTGGGTTTGGTAACTTGGTCATCTTTGGCTCATCCTCCCAGCTGCA
CCCTCTGCCAGGCCGCCCGCAGGAGCTTTCGGTGCTGTTTGGCTCTCACCAGGCTCTTGTTCAATGGAAGCCTCCTGCCCTTGCCATAGG
AGCCAGCCCTTCTGCCTGGCAGAACTGGACCTATGAGGTGAAAGTATCCACCCAAGACCCTCCTGAAGTCACTCATATTTTCTTGAACAT
AAGTGGAACCATGCTGAATGTACCTGAGCTGCAGAGTGCTATGAAATACAAGGTTTCTGTGAGAGCAAGTTCTCCAAAGAGGCCAGGCCC
CTGGTCAGAGCCCTCAGTGGGTACTACCCTGGTGCCAGCTAGTGAACCACCATTTATCATGGCTGTGAAAGAAGATGGGCTTTGGAGTAA
ACCATTAAATAGCTTTGGCCCAGGAGAGTTCTTATCCTCTGATATAGGAAATGTGTCAGACATGGATTGGTATAACAACAGCCTCTACTA
CAGTGACACGAAAGGCGACGTTTTTGTGTGGCTGCTGAATGGGACGGATATCTCAGAGAATTATCACCTACCCAGCATTGCAGGAGCAGG
GGCTTTAGCTTTTGAGTGGCTGGGTCACTTTCTCTACTGGGCTGGAAAGACATATGTGATACAAAGGCAGTCTGTGTTGACGGGACACAC
AGACATTGTTACCCACGTGAAGCTATTGGTGAATGACATGGTGGTGGATTCAGTTGGTGGATATCTCTACTGGACCACACTCTATTCAGT
GGAAAGCACCAGACTAAATGGGGAAAGTTCCCTTGTACTACAGACACAGCCTTGGTTTTCTGGGAAAAAGGTAATTGCTCTAACTTTAGA
CCTCAGTGATGGGCTCCTGTATTGGTTGGTTCAAGACAGTCAATGTATTCACCTGTACACAGCTGTTCTTCGGGGACAGAGAGTCACTGG
AACTGGAGGACCCGTCTTCTGGGCTGGGTGTGACCAAGCAGGATCTGGGCCCAGTCCCCATGTGAGAGCAGCAGAGGCGGTCTTCAACAT
CCTGCCAGCCCCACACAGCTACAGCTTTCTTGCTCCCTTCAGCCCCCAGCCCCTCCCCCATCTCCCACCCTGTACCTCATCCCATGAGAC
CCTGGTGCCTGGCTCTTTCGTCACCCTTGGACAAGACAAACCAAGTCGGAACAGCAGATAACAATGCAGCAAGGCCCTGCTGCCCAATCT
CCATCTGTCAACAGGGGCGTGAGGTCCCAGGAAGTGGCCAAAAGCTAGACAGATCCCCGTTCCTGACATCACAGCAGCCTCCAACACAAG
GCTCCAAGACCTAGGCTCATGGACGAGATGGGAAGGCACAGGGAGAAGGGATAACCCTACACCCAGACCCCAGGCTGGACATGCTGACTG
TCCTCTCCCCTCCAGCCTTTGGCCTTGGCTTTTCTAGCCTATTTACCTGCAGGCTGAGCCACTCTCTTCCCTTTCCCCAGCATCACTCCC
CAAGGAAGAGCCAATGTTTTCCACCCATAATCCTTTCTGCCGACCCCTAGTTCCCTCTGCTCAGCCAAGCTTGTTATCAGCTTTCAGGGC


Top

FusionGenePPI for ROS1_CD74


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ROS1PTPN6, PTPN11, VAV3, IKBKG, GRB2CD74MIF, CD74, APP, HADHA, LAMTOR5, MAP3K1, TM4SF20, COPG1, COPG2, HLA-DPB1, HLA-DQA1, CD44


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ROS1_CD74


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ROS1_CD74


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneROS1C0007131Non-Small Cell Lung Carcinoma4CTD_human
HgeneROS1C0017638Glioma1CTD_human
HgeneROS1C0025202melanoma1CTD_human
HgeneROS1C0152013Adenocarcinoma of lung (disorder)1CTD_human
TgeneCD74C0007131Non-Small Cell Lung Carcinoma1CTD_human
TgeneCD74C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneCD74C0162557Liver Failure, Acute1CTD_human
TgeneCD74C1458155Mammary Neoplasms1CTD_human