FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31698

FusionGeneSummary for ROCK2_DTNB

check button Fusion gene summary
Fusion gene informationFusion gene name: ROCK2_DTNB
Fusion gene ID: 31698
HgeneTgene
Gene symbol

ROCK2

DTNB

Gene ID

9475

1838

Gene nameRho associated coiled-coil containing protein kinase 2dystrobrevin beta
SynonymsROCK-II-
Cytomap

2p25.1

2p23.3

Type of geneprotein-codingprotein-coding
Descriptionrho-associated protein kinase 2p164 ROCK-2rho-associated, coiled-coil-containing protein kinase IIdystrobrevin betaDTN-Bbeta-dystrobrevin
Modification date2018052720180522
UniProtAcc

O75116

O60941

Ensembl transtripts involved in fusion geneENST00000315872, ENST00000462366, 
ENST00000401753, 
ENST00000496972, 
ENST00000405222, ENST00000407661, 
ENST00000406818, ENST00000407038, 
ENST00000404103, ENST00000407186, 
ENST00000288642, ENST00000545439, 
ENST00000472690, 
Fusion gene scores* DoF score10 X 6 X 8=4808 X 7 X 7=392
# samples 109
** MAII scorelog2(10/480*10)=-2.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/392*10)=-2.12285674778553
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ROCK2 [Title/Abstract] AND DTNB [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneROCK2

GO:0006468

protein phosphorylation

18559669


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-67-3770-01AROCK2chr2

11484122

-DTNBchr2

25656864

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000315872ENST00000496972ROCK2chr2

11484122

-DTNBchr2

25656864

-
In-frameENST00000315872ENST00000405222ROCK2chr2

11484122

-DTNBchr2

25656864

-
In-frameENST00000315872ENST00000407661ROCK2chr2

11484122

-DTNBchr2

25656864

-
In-frameENST00000315872ENST00000406818ROCK2chr2

11484122

-DTNBchr2

25656864

-
In-frameENST00000315872ENST00000407038ROCK2chr2

11484122

-DTNBchr2

25656864

-
In-frameENST00000315872ENST00000404103ROCK2chr2

11484122

-DTNBchr2

25656864

-
In-frameENST00000315872ENST00000407186ROCK2chr2

11484122

-DTNBchr2

25656864

-
In-frameENST00000315872ENST00000288642ROCK2chr2

11484122

-DTNBchr2

25656864

-
In-frameENST00000315872ENST00000545439ROCK2chr2

11484122

-DTNBchr2

25656864

-
5CDS-intronENST00000315872ENST00000472690ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000462366ENST00000496972ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000462366ENST00000405222ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000462366ENST00000407661ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000462366ENST00000406818ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000462366ENST00000407038ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000462366ENST00000404103ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000462366ENST00000407186ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000462366ENST00000288642ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000462366ENST00000545439ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-intronENST00000462366ENST00000472690ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000401753ENST00000496972ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000401753ENST00000405222ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000401753ENST00000407661ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000401753ENST00000406818ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000401753ENST00000407038ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000401753ENST00000404103ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000401753ENST00000407186ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000401753ENST00000288642ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-3CDSENST00000401753ENST00000545439ROCK2chr2

11484122

-DTNBchr2

25656864

-
intron-intronENST00000401753ENST00000472690ROCK2chr2

11484122

-DTNBchr2

25656864

-

Top

FusionProtFeatures for ROCK2_DTNB


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ROCK2

O75116

DTNB

O60941

Protein kinase which is a key regulator of actincytoskeleton and cell polarity. Involved in regulation of smoothmuscle contraction, actin cytoskeleton organization, stress fiberand focal adhesion formation, neurite retraction, cell adhesionand motility via phosphorylation of ADD1, BRCA2, CNN1, EZR,DPYSL2, EP300, MSN, MYL9/MLC2, NPM1, RDX, PPP1R12A and VIM.Phosphorylates SORL1 and IRF4. Acts as a negative regulator ofVEGF-induced angiogenic endothelial cell activation. Positivelyregulates the activation of p42/MAPK1-p44/MAPK3 and ofp90RSK/RPS6KA1 during myogenic differentiation. Plays an importantrole in the timely initiation of centrosome duplication. Inhibitskeratinocyte terminal differentiation. May regulate closure of theeyelids and ventral body wall through organization of actomyosinbundles. Plays a critical role in the regulation of spine andsynaptic properties in the hippocampus. Plays an important role ingenerating the circadian rhythm of the aortic myofilament Ca(2+)sensitivity and vascular contractility by modulating the myosinlight chain phosphorylation. {ECO:0000269|PubMed:10579722,ECO:0000269|PubMed:15699075, ECO:0000269|PubMed:16574662,ECO:0000269|PubMed:17015463, ECO:0000269|PubMed:19131646,ECO:0000269|PubMed:19997641, ECO:0000269|PubMed:21084279,ECO:0000269|PubMed:21147781}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneDTNBchr2:11484122chr2:25656864ENST00000404103-1120428_529419607Coiled coilOntology_term=ECO:0000255
TgeneDTNBchr2:11484122chr2:25656864ENST00000405222-1018428_529389570Coiled coilOntology_term=ECO:0000255
TgeneDTNBchr2:11484122chr2:25656864ENST00000406818-1121428_529419637Coiled coilOntology_term=ECO:0000255
TgeneDTNBchr2:11484122chr2:25656864ENST00000407038-1019428_529389577Coiled coilOntology_term=ECO:0000255
TgeneDTNBchr2:11484122chr2:25656864ENST00000407661-1120428_529419619Coiled coilOntology_term=ECO:0000255
TgeneDTNBchr2:11484122chr2:25656864ENST00000496972-1018428_529362581Coiled coilOntology_term=ECO:0000255
TgeneDTNBchr2:11484122chr2:25656864ENST00000405222-1018399_448389570RegionNote=Syntrophin-binding region
TgeneDTNBchr2:11484122chr2:25656864ENST00000407038-1019399_448389577RegionNote=Syntrophin-binding region
TgeneDTNBchr2:11484122chr2:25656864ENST00000496972-1018399_448362581RegionNote=Syntrophin-binding region

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneROCK2chr2:11484122chr2:25656864ENST00000315872-1331053_1131471389Coiled coilOntology_term=ECO:0000255
HgeneROCK2chr2:11484122chr2:25656864ENST00000315872-133429_1024471389Coiled coilOntology_term=ECO:0000255
HgeneROCK2chr2:11484122chr2:25656864ENST00000315872-1331150_1349471389DomainPH
HgeneROCK2chr2:11484122chr2:25656864ENST00000315872-133357_425471389DomainNote=AGC-kinase C-terminal
HgeneROCK2chr2:11484122chr2:25656864ENST00000315872-133497_573471389DomainREM-1
HgeneROCK2chr2:11484122chr2:25656864ENST00000315872-13392_354471389DomainProtein kinase
HgeneROCK2chr2:11484122chr2:25656864ENST00000315872-13398_106471389Nucleotide bindingATP
HgeneROCK2chr2:11484122chr2:25656864ENST00000315872-133979_1047471389RegionRHOA binding
HgeneROCK2chr2:11484122chr2:25656864ENST00000315872-1331260_1315471389Zinc fingerPhorbol-ester/DAG-type
TgeneDTNBchr2:11484122chr2:25656864ENST00000404103-1120399_448419607RegionNote=Syntrophin-binding region
TgeneDTNBchr2:11484122chr2:25656864ENST00000406818-1121399_448419637RegionNote=Syntrophin-binding region
TgeneDTNBchr2:11484122chr2:25656864ENST00000407661-1120399_448419619RegionNote=Syntrophin-binding region
TgeneDTNBchr2:11484122chr2:25656864ENST00000404103-1120237_284419607Zinc fingerZZ-type
TgeneDTNBchr2:11484122chr2:25656864ENST00000405222-1018237_284389570Zinc fingerZZ-type
TgeneDTNBchr2:11484122chr2:25656864ENST00000406818-1121237_284419637Zinc fingerZZ-type
TgeneDTNBchr2:11484122chr2:25656864ENST00000407038-1019237_284389577Zinc fingerZZ-type
TgeneDTNBchr2:11484122chr2:25656864ENST00000407661-1120237_284419619Zinc fingerZZ-type
TgeneDTNBchr2:11484122chr2:25656864ENST00000496972-1018237_284362581Zinc fingerZZ-type


Top

FusionGeneSequence for ROCK2_DTNB


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000496972_chr2_25656864_-_231aa
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLTRPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHE
QASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTH

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000405222_chr2_25656864_-_219aa
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLTRPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHE
QASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTH

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000407661_chr2_25656864_-_238aa
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLTRPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHE
QASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKEEEQKQAAQATGSPHTSPTHGGGRPMPMPVRSTS

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000406818_chr2_25656864_-_256aa
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLTRPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHE
QASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKEEEQKQAAQATGSPHTSPTHGGGRPMPMPVRSTS

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000407038_chr2_25656864_-_226aa
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLTRPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHE
QASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKEEEQKQAAQATGSPHTSPTHGGGRPMPMPVRSTS

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000404103_chr2_25656864_-_226aa
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLTRPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHE
QASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKEEEQKQAAQATGSPHTSPTHGGGRPMPMPVRSTS

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000407186_chr2_25656864_-_249aa
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLTRPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHE
QASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTH

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000288642_chr2_25656864_-_226aa
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLTRPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHE
QASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKEAEARESAQATGSPHTSPTHGGGRPMPMPVRSTS

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000545439_chr2_25656864_-_249aa
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLTRPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHE
QASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000496972_chr2_25656864_-_693nt
ATGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTG
GAGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCC
AACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAG
CAGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTG
GAGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGCTCAGGCCACA
GGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCTGCCGGCTCCACCCCCACCCAC
TGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGGTACGAGGAGAAACCTCCGCAATGACCTGCTG

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000405222_chr2_25656864_-_657nt
ATGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTG
GAGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCC
AACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAG
CAGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTG
GAGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGCTCAGGCCACA
GGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCTGCCGGCTCCACCCCCACCCAC
TGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGCAGAGGAAGGTGCAGAGGAAGAAGAAGAGAAG

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000407661_chr2_25656864_-_714nt
ATGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTG
GAGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCC
AACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAG
CAGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTG
GAGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGAGGAAGAGCAA
AAGCAGGCAGCTCAGGCCACAGGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCT
GCCGGCTCCACCCCCACCCACTGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGGTACGAGGAGA

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000406818_chr2_25656864_-_768nt
ATGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTG
GAGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCC
AACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAG
CAGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTG
GAGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGAGGAAGAGCAA
AAGCAGGCAGCTCAGGCCACAGGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCT
GCCGGCTCCACCCCCACCCACTGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGGTACGAGGAGA
AACCTCCGCAATGACCTGCTGGTGGCAGCTGACTCCATCACCAACACCATGTCATCCCTGGTGAAGGAGCTCCATTCAGCAGAGGAAGGT

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000407038_chr2_25656864_-_678nt
ATGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTG
GAGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCC
AACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAG
CAGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTG
GAGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGAGGAAGAGCAA
AAGCAGGCAGCTCAGGCCACAGGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCT
GCCGGCTCCACCCCCACCCACTGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGCAGAGGAAGGT

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000404103_chr2_25656864_-_678nt
ATGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTG
GAGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCC
AACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAG
CAGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTG
GAGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGAGGAAGAGCAA
AAGCAGGCAGCTCAGGCCACAGGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCT
GCCGGCTCCACCCCCACCCACTGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGCAGAGGAAGGT

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000407186_chr2_25656864_-_747nt
ATGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTG
GAGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCC
AACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAG
CAGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTG
GAGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGCTCAGGCCACA
GGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCTGCCGGCTCCACCCCCACCCAC
TGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGGTACGAGGAGAAACCTCCGCAATGACCTGCTG
GTGGCAGCTGACTCCATCACCAACACCATGTCATCCCTGGTGAAGGAGCTCCATTCAGCAGAGGAAGGTGCAGAGGAAGAAGAAGAGAAG

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000288642_chr2_25656864_-_678nt
ATGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTG
GAGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCC
AACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAG
CAGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTG
GAGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGAAGCTGAGGCA
CGAGAATCAGCTCAGGCCACAGGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCT
GCCGGCTCCACCCCCACCCACTGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGCAGAGGAAGGT

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000545439_chr2_25656864_-_747nt
ATGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTG
GAGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCC
AACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAG
CAGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTG
GAGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGCTCAGGCCACA
GGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCTGCCGGCTCCACCCCCACCCAC
TGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGGTACGAGGAGAAACCTCCGCAATGACCTGCTG
GTGGCAGCTGACTCCATCACCAACACCATGTCATCCCTGGTGAAGGAGCTCCATTCAGCAGAGGAAGGTGCAGAGGAAGAAGAAGAGAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000496972_chr2_25656864_-_1527nt
CAAGGCGGCCGGCGGCGACCATGGCAGCGGGCCGGCGGCGGCCGTAGTGGCCCAGGCCTGGGCTTCAGCCTCCCGGGGCCCCAGAGGGCG
GGGCGGTCCGGGCCGCGGCGGTGGCGGCGCCACTTCCCTGCTCCCGCCCGAGGACTCCTGCGGGCACTCGCTGAGGACCAGCGGACCGGC
GGCGCGAATCTGACTGAGGGGCGGGGACGCCGTCTGTTCCCCGCCGCTCCCGGCAGGGCCGGGCCGGGCTGGGCCGGGCTGGGCCGGGCG
GGCCCCTGGGAGCAGCCCCCAGGCGGGGGACCGCCTTGGAGACCCGAAGCCGGAGCTAGAGGCAGGCGGTGGGCCCGGGTGGAGTCCCGG
CCGGAGCTGGTGGTTCGGGGGCGGTGCTAGGCCCCGAGGCTGCGGGACCTGAGCGCGAGGAGCCTGAGTGCGGGTCCAGCGGTGGCGGCA
TGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTGG
AGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCCA
ACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAGC
AGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTGG
AGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGCTCAGGCCACAG
GGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCTGCCGGCTCCACCCCCACCCACT
GTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGGTACGAGGAGAAACCTCCGCAATGACCTGCTGG
TGGCAGCTGACTCCATCACCAACACCATGTCATCCCTGGTGAAGGAGCTCCATTCAGGTTAGCAGAGGAGCCGGACACAGAGGAAGCTCA
GGCACAGAGGACGAGGAGCAAGCTGGCGCCGACATGGCGAAGGCAAGGTCTTCCCCCAGAGGCACATTCCTCTCCATCTTTCCACCGCAC
ACCTGGACCAGGCTTGCAGGCTGCCAGACGTCACTCCACCCGCCAGGGAGAGGGGAGCCAGAGCCGGTGGGAAGCGGGGAGGGGCTGCGT
GGCACAGCTAGTGGGCCTCCCCCTGCACAGCCCTGCATGTACTAGCACCTTCATCACTCCCCTCAGGGCATGGTCTCATCTCCGCATCAG

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000405222_chr2_25656864_-_1446nt
CAAGGCGGCCGGCGGCGACCATGGCAGCGGGCCGGCGGCGGCCGTAGTGGCCCAGGCCTGGGCTTCAGCCTCCCGGGGCCCCAGAGGGCG
GGGCGGTCCGGGCCGCGGCGGTGGCGGCGCCACTTCCCTGCTCCCGCCCGAGGACTCCTGCGGGCACTCGCTGAGGACCAGCGGACCGGC
GGCGCGAATCTGACTGAGGGGCGGGGACGCCGTCTGTTCCCCGCCGCTCCCGGCAGGGCCGGGCCGGGCTGGGCCGGGCTGGGCCGGGCG
GGCCCCTGGGAGCAGCCCCCAGGCGGGGGACCGCCTTGGAGACCCGAAGCCGGAGCTAGAGGCAGGCGGTGGGCCCGGGTGGAGTCCCGG
CCGGAGCTGGTGGTTCGGGGGCGGTGCTAGGCCCCGAGGCTGCGGGACCTGAGCGCGAGGAGCCTGAGTGCGGGTCCAGCGGTGGCGGCA
TGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTGG
AGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCCA
ACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAGC
AGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTGG
AGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGCTCAGGCCACAG
GGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCTGCCGGCTCCACCCCCACCCACT
GTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGCAGAGGAAGGTGCAGAGGAAGAAGAAGAGAAGA
TGCAGAATGGGAAAGACAGAGGTTAGCAGAGGAGCCGGACACAGAGGAAGCTCAGGCACAGAGGACGAGGAGCAAGCTGGCGCCGACATG
GCGAAGGCAAGGTCTTCCCCCAGAGGCACATTCCTCTCCATCTTTCCACCGCACACCTGGACCAGGCTTGCAGGCTGCCAGACGTCACTC
CACCCGCCAGGGAGAGGGGAGCCAGAGCCGGTGGGAAGCGGGGAGGGGCTGCGTGGCACAGCTAGTGGGCCTCCCCCTGCACAGCCCTGC
ATGTACTAGCACCTTCATCACTCCCCTCAGGGCATGGTCTCATCTCCGCATCAGGAATTCACCTGGAGGTTGAAAAGAGAAAAGAAAAAG

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000407661_chr2_25656864_-_1503nt
CAAGGCGGCCGGCGGCGACCATGGCAGCGGGCCGGCGGCGGCCGTAGTGGCCCAGGCCTGGGCTTCAGCCTCCCGGGGCCCCAGAGGGCG
GGGCGGTCCGGGCCGCGGCGGTGGCGGCGCCACTTCCCTGCTCCCGCCCGAGGACTCCTGCGGGCACTCGCTGAGGACCAGCGGACCGGC
GGCGCGAATCTGACTGAGGGGCGGGGACGCCGTCTGTTCCCCGCCGCTCCCGGCAGGGCCGGGCCGGGCTGGGCCGGGCTGGGCCGGGCG
GGCCCCTGGGAGCAGCCCCCAGGCGGGGGACCGCCTTGGAGACCCGAAGCCGGAGCTAGAGGCAGGCGGTGGGCCCGGGTGGAGTCCCGG
CCGGAGCTGGTGGTTCGGGGGCGGTGCTAGGCCCCGAGGCTGCGGGACCTGAGCGCGAGGAGCCTGAGTGCGGGTCCAGCGGTGGCGGCA
TGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTGG
AGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCCA
ACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAGC
AGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTGG
AGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGAGGAAGAGCAAA
AGCAGGCAGCTCAGGCCACAGGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCTG
CCGGCTCCACCCCCACCCACTGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGGTACGAGGAGAA
ACCTCCGCAATGACCTGCTGGTGGCAGCTGACTCCATCACCAACACCATGTCATCCCTGGTGAAGGAGCTCCATTCAGGTTAGCAGAGGA
GCCGGACACAGAGGAAGCTCAGGCACAGAGGACGAGGAGCAAGCTGGCGCCGACATGGCGAAGGCAAGGTCTTCCCCCAGAGGCACATTC
CTCTCCATCTTTCCACCGCACACCTGGACCAGGCTTGCAGGCTGCCAGACGTCACTCCACCCGCCAGGGAGAGGGGAGCCAGAGCCGGTG
GGAAGCGGGGAGGGGCTGCGTGGCACAGCTAGTGGGCCTCCCCCTGCACAGCCCTGCATGTACTAGCACCTTCATCACTCCCCTCAGGGC

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000406818_chr2_25656864_-_1557nt
CAAGGCGGCCGGCGGCGACCATGGCAGCGGGCCGGCGGCGGCCGTAGTGGCCCAGGCCTGGGCTTCAGCCTCCCGGGGCCCCAGAGGGCG
GGGCGGTCCGGGCCGCGGCGGTGGCGGCGCCACTTCCCTGCTCCCGCCCGAGGACTCCTGCGGGCACTCGCTGAGGACCAGCGGACCGGC
GGCGCGAATCTGACTGAGGGGCGGGGACGCCGTCTGTTCCCCGCCGCTCCCGGCAGGGCCGGGCCGGGCTGGGCCGGGCTGGGCCGGGCG
GGCCCCTGGGAGCAGCCCCCAGGCGGGGGACCGCCTTGGAGACCCGAAGCCGGAGCTAGAGGCAGGCGGTGGGCCCGGGTGGAGTCCCGG
CCGGAGCTGGTGGTTCGGGGGCGGTGCTAGGCCCCGAGGCTGCGGGACCTGAGCGCGAGGAGCCTGAGTGCGGGTCCAGCGGTGGCGGCA
TGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTGG
AGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCCA
ACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAGC
AGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTGG
AGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGAGGAAGAGCAAA
AGCAGGCAGCTCAGGCCACAGGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCTG
CCGGCTCCACCCCCACCCACTGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGGTACGAGGAGAA
ACCTCCGCAATGACCTGCTGGTGGCAGCTGACTCCATCACCAACACCATGTCATCCCTGGTGAAGGAGCTCCATTCAGCAGAGGAAGGTG
CAGAGGAAGAAGAAGAGAAGATGCAGAATGGGAAAGACAGAGGTTAGCAGAGGAGCCGGACACAGAGGAAGCTCAGGCACAGAGGACGAG
GAGCAAGCTGGCGCCGACATGGCGAAGGCAAGGTCTTCCCCCAGAGGCACATTCCTCTCCATCTTTCCACCGCACACCTGGACCAGGCTT
GCAGGCTGCCAGACGTCACTCCACCCGCCAGGGAGAGGGGAGCCAGAGCCGGTGGGAAGCGGGGAGGGGCTGCGTGGCACAGCTAGTGGG
CCTCCCCCTGCACAGCCCTGCATGTACTAGCACCTTCATCACTCCCCTCAGGGCATGGTCTCATCTCCGCATCAGGAATTCACCTGGAGG

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000407038_chr2_25656864_-_1467nt
CAAGGCGGCCGGCGGCGACCATGGCAGCGGGCCGGCGGCGGCCGTAGTGGCCCAGGCCTGGGCTTCAGCCTCCCGGGGCCCCAGAGGGCG
GGGCGGTCCGGGCCGCGGCGGTGGCGGCGCCACTTCCCTGCTCCCGCCCGAGGACTCCTGCGGGCACTCGCTGAGGACCAGCGGACCGGC
GGCGCGAATCTGACTGAGGGGCGGGGACGCCGTCTGTTCCCCGCCGCTCCCGGCAGGGCCGGGCCGGGCTGGGCCGGGCTGGGCCGGGCG
GGCCCCTGGGAGCAGCCCCCAGGCGGGGGACCGCCTTGGAGACCCGAAGCCGGAGCTAGAGGCAGGCGGTGGGCCCGGGTGGAGTCCCGG
CCGGAGCTGGTGGTTCGGGGGCGGTGCTAGGCCCCGAGGCTGCGGGACCTGAGCGCGAGGAGCCTGAGTGCGGGTCCAGCGGTGGCGGCA
TGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTGG
AGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCCA
ACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAGC
AGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTGG
AGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGAGGAAGAGCAAA
AGCAGGCAGCTCAGGCCACAGGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCTG
CCGGCTCCACCCCCACCCACTGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGCAGAGGAAGGTG
CAGAGGAAGAAGAAGAGAAGATGCAGAATGGGAAAGACAGAGGTTAGCAGAGGAGCCGGACACAGAGGAAGCTCAGGCACAGAGGACGAG
GAGCAAGCTGGCGCCGACATGGCGAAGGCAAGGTCTTCCCCCAGAGGCACATTCCTCTCCATCTTTCCACCGCACACCTGGACCAGGCTT
GCAGGCTGCCAGACGTCACTCCACCCGCCAGGGAGAGGGGAGCCAGAGCCGGTGGGAAGCGGGGAGGGGCTGCGTGGCACAGCTAGTGGG
CCTCCCCCTGCACAGCCCTGCATGTACTAGCACCTTCATCACTCCCCTCAGGGCATGGTCTCATCTCCGCATCAGGAATTCACCTGGAGG

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000404103_chr2_25656864_-_1467nt
CAAGGCGGCCGGCGGCGACCATGGCAGCGGGCCGGCGGCGGCCGTAGTGGCCCAGGCCTGGGCTTCAGCCTCCCGGGGCCCCAGAGGGCG
GGGCGGTCCGGGCCGCGGCGGTGGCGGCGCCACTTCCCTGCTCCCGCCCGAGGACTCCTGCGGGCACTCGCTGAGGACCAGCGGACCGGC
GGCGCGAATCTGACTGAGGGGCGGGGACGCCGTCTGTTCCCCGCCGCTCCCGGCAGGGCCGGGCCGGGCTGGGCCGGGCTGGGCCGGGCG
GGCCCCTGGGAGCAGCCCCCAGGCGGGGGACCGCCTTGGAGACCCGAAGCCGGAGCTAGAGGCAGGCGGTGGGCCCGGGTGGAGTCCCGG
CCGGAGCTGGTGGTTCGGGGGCGGTGCTAGGCCCCGAGGCTGCGGGACCTGAGCGCGAGGAGCCTGAGTGCGGGTCCAGCGGTGGCGGCA
TGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTGG
AGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCCA
ACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAGC
AGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTGG
AGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGAGGAAGAGCAAA
AGCAGGCAGCTCAGGCCACAGGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCTG
CCGGCTCCACCCCCACCCACTGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGCAGAGGAAGGTG
CAGAGGAAGAAGAAGAGAAGATGCAGAATGGGAAAGACAGAGGTTAGCAGAGGAGCCGGACACAGAGGAAGCTCAGGCACAGAGGACGAG
GAGCAAGCTGGCGCCGACATGGCGAAGGCAAGGTCTTCCCCCAGAGGCACATTCCTCTCCATCTTTCCACCGCACACCTGGACCAGGCTT
GCAGGCTGCCAGACGTCACTCCACCCGCCAGGGAGAGGGGAGCCAGAGCCGGTGGGAAGCGGGGAGGGGCTGCGTGGCACAGCTAGTGGG
CCTCCCCCTGCACAGCCCTGCATGTACTAGCACCTTCATCACTCCCCTCAGGGCATGGTCTCATCTCCGCATCAGGAATTCACCTGGAGG

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000407186_chr2_25656864_-_1521nt
CAAGGCGGCCGGCGGCGACCATGGCAGCGGGCCGGCGGCGGCCGTAGTGGCCCAGGCCTGGGCTTCAGCCTCCCGGGGCCCCAGAGGGCG
GGGCGGTCCGGGCCGCGGCGGTGGCGGCGCCACTTCCCTGCTCCCGCCCGAGGACTCCTGCGGGCACTCGCTGAGGACCAGCGGACCGGC
GGCGCGAATCTGACTGAGGGGCGGGGACGCCGTCTGTTCCCCGCCGCTCCCGGCAGGGCCGGGCCGGGCTGGGCCGGGCTGGGCCGGGCG
GGCCCCTGGGAGCAGCCCCCAGGCGGGGGACCGCCTTGGAGACCCGAAGCCGGAGCTAGAGGCAGGCGGTGGGCCCGGGTGGAGTCCCGG
CCGGAGCTGGTGGTTCGGGGGCGGTGCTAGGCCCCGAGGCTGCGGGACCTGAGCGCGAGGAGCCTGAGTGCGGGTCCAGCGGTGGCGGCA
TGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTGG
AGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCCA
ACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAGC
AGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTGG
AGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGCTCAGGCCACAG
GGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCTGCCGGCTCCACCCCCACCCACT
GTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGGTACGAGGAGAAACCTCCGCAATGACCTGCTGG
TGGCAGCTGACTCCATCACCAACACCATGTCATCCCTGGTGAAGGAGCTCCATTCAGCAGAGGAAGGTGCAGAGGAAGAAGAAGAGAAGA
TGCAGAATGGGAAAGACAGAGGTTAGCAGAGGAGCCGGACACAGAGGAAGCTCAGGCACAGAGGACGAGGAGCAAGCTGGCGCCGACATG
GCGAAGGCAAGGTCTTCCCCCAGAGGCACATTCCTCTCCATCTTTCCACCGCACACCTGGACCAGGCTTGCAGGCTGCCAGACGTCACTC
CACCCGCCAGGGAGAGGGGAGCCAGAGCCGGTGGGAAGCGGGGAGGGGCTGCGTGGCACAGCTAGTGGGCCTCCCCCTGCACAGCCCTGC

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000288642_chr2_25656864_-_1448nt
CAAGGCGGCCGGCGGCGACCATGGCAGCGGGCCGGCGGCGGCCGTAGTGGCCCAGGCCTGGGCTTCAGCCTCCCGGGGCCCCAGAGGGCG
GGGCGGTCCGGGCCGCGGCGGTGGCGGCGCCACTTCCCTGCTCCCGCCCGAGGACTCCTGCGGGCACTCGCTGAGGACCAGCGGACCGGC
GGCGCGAATCTGACTGAGGGGCGGGGACGCCGTCTGTTCCCCGCCGCTCCCGGCAGGGCCGGGCCGGGCTGGGCCGGGCTGGGCCGGGCG
GGCCCCTGGGAGCAGCCCCCAGGCGGGGGACCGCCTTGGAGACCCGAAGCCGGAGCTAGAGGCAGGCGGTGGGCCCGGGTGGAGTCCCGG
CCGGAGCTGGTGGTTCGGGGGCGGTGCTAGGCCCCGAGGCTGCGGGACCTGAGCGCGAGGAGCCTGAGTGCGGGTCCAGCGGTGGCGGCA
TGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTGG
AGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCCA
ACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAGC
AGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTGG
AGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGAAGCTGAGGCAC
GAGAATCAGCTCAGGCCACAGGGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCTG
CCGGCTCCACCCCCACCCACTGTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGCAGAGGAAGGTG
CAGAGGAAGAAGAAGAGAAGATGCAGAATGGGAAAGACAGAGGTTAGCAGAGGAGCCGGACACAGAGGAAGCTCAGGCACAGAGGACGAG
GAGCAAGCTGGCGCCGACATGGCGAAGGCAAGGTCTTCCCCCAGAGGCACATTCCTCTCCATCTTTCCACCGCACACCTGGACCAGGCTT
GCAGGCTGCCAGACGTCACTCCACCCGCCAGGGAGAGGGGAGCCAGAGCCGGTGGGAAGCGGGGAGGGGCTGCGTGGCACAGCTAGTGGG
CCTCCCCCTGCACAGCCCTGCATGTACTAGCACCTTCATCACTCCCCTCAGGGCATGGTCTCATCTCCGCATCAGGAATTCACCTGGAGG

>In-frame_ROCK2_ENST00000315872_chr2_11484122_-_DTNB_ENST00000545439_chr2_25656864_-_1263nt
CAAGGCGGCCGGCGGCGACCATGGCAGCGGGCCGGCGGCGGCCGTAGTGGCCCAGGCCTGGGCTTCAGCCTCCCGGGGCCCCAGAGGGCG
GGGCGGTCCGGGCCGCGGCGGTGGCGGCGCCACTTCCCTGCTCCCGCCCGAGGACTCCTGCGGGCACTCGCTGAGGACCAGCGGACCGGC
GGCGCGAATCTGACTGAGGGGCGGGGACGCCGTCTGTTCCCCGCCGCTCCCGGCAGGGCCGGGCCGGGCTGGGCCGGGCTGGGCCGGGCG
GGCCCCTGGGAGCAGCCCCCAGGCGGGGGACCGCCTTGGAGACCCGAAGCCGGAGCTAGAGGCAGGCGGTGGGCCCGGGTGGAGTCCCGG
CCGGAGCTGGTGGTTCGGGGGCGGTGCTAGGCCCCGAGGCTGCGGGACCTGAGCGCGAGGAGCCTGAGTGCGGGTCCAGCGGTGGCGGCA
TGAGCCGGCCCCCGCCGACGGGGAAAATGCCCGGCGCCCCCGAGACCGCGCCGGGGGACGGGGCAGGCGCGAGCCGCCAGAGGAAGCTGG
AGGCGCTGATCCGAGACCCTCGCTCCCCCATCAACGTGGAGAGCTTGCTGACTCGTCCTCCCACTGACTTGAGCTTTAACTTTGATGCCA
ACAAACAACAAAGACAGCTTATTGCAGAACTGGAAAACAAAAACAGAGAGATCCTGCAGGAGATTCAGCGTCTCCGCCTGGAACACGAGC
AGGCCTCCCAGCCCACCCCTGAGAAGGCACAGCAGAACCCCACGCTGCTGGCAGAGCTGCGGCTGCTGAGGCAAAGGAAGGATGAACTGG
AGCAGAGGATGTCGGCCCTGCAGGAGAGCAGGCGGGAGCTGATGGTCCAGCTGGAAGAGCTGATGAAGTTGCTGAAGGCTCAGGCCACAG
GGTCACCACATACATCGCCCACCCATGGAGGCGGCCGGCCAATGCCCATGCCAGTGCGCTCCACGTCTGCCGGCTCCACCCCCACCCACT
GTCCGCAGGACTCGCTGAGCGGAGTCGGGGGAGACGTGCAGGAGGCCTTCGCACAAGGTACGAGGAGAAACCTCCGCAATGACCTGCTGG
TGGCAGCTGACTCCATCACCAACACCATGTCATCCCTGGTGAAGGAGCTCCATTCAGCAGAGGAAGGTGCAGAGGAAGAAGAAGAGAAGA
TGCAGAATGGGAAAGACAGAGGTTAGCAGAGGAGCCGGACACAGAGGAAGCTCAGGCACAGAGGACGAGGAGCAAGCTGGCGCCGACATG


Top

FusionGenePPI for ROCK2_DTNB


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ROCK2IKBKE, STK16, RHOA, ELAVL1, MAGEC1, KIAA0196, RABGEF1, FAM21A, GPHN, LMNA, MTA2, NHP2L1, ZW10, DNAJB11, RACGAP1, NTRK1, SNW1, CDC5L, CDKN3, POLR1C, ROCK1, FBXO42, LRPAP1, ADD2, MYL2, LZTFL1, CYLDDTNBKIF5A, TSACC, NUP62, TRAF2, CCDC85B, PRTFDC1, BEGAIN, HMG20A, PPFIBP2, KIF5B, MLC1, DMD, DTNB, KRT31, VCP, PPFIA1, ABI2, MTUS2, GGA1, ABI3, CEP55, CEP63, NDEL1, USHBP1, DTNBP1, SPZ1, KRT40, TXLNA, ZBTB9, CASK, CCDC101, GAPDH, CEP128, TNS1, TNS3, SNTG2, CPNE5, RHPN1, COG6, OLFM2, TENC1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneROCK2chr2:11484122chr2:25656864ENST00000315872-133373_420471389NPM1
HgeneROCK2chr2:11484122chr2:25656864ENST00000315872-133363_784471389PPP1R12A


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ROCK2_DTNB


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ROCK2_DTNB


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource