FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31692

FusionGeneSummary for ROCK1_RNF38

check button Fusion gene summary
Fusion gene informationFusion gene name: ROCK1_RNF38
Fusion gene ID: 31692
HgeneTgene
Gene symbol

ROCK1

RNF38

Gene ID

6093

152006

Gene nameRho associated coiled-coil containing protein kinase 1ring finger protein 38
SynonymsP160ROCK|ROCK-I-
Cytomap

18q11.1

9p13.2

Type of geneprotein-codingprotein-coding
Descriptionrho-associated protein kinase 1p160 ROCK-1renal carcinoma antigen NY-REN-35E3 ubiquitin-protein ligase RNF38RING-type E3 ubiquitin transferase RNF38
Modification date2018052720180522
UniProtAcc

Q13464

Q9H0F5

Ensembl transtripts involved in fusion geneENST00000399799, ENST00000259605, 
ENST00000353739, ENST00000357058, 
ENST00000350199, ENST00000377885, 
ENST00000377877, ENST00000491349, 
Fusion gene scores* DoF score21 X 11 X 11=25414 X 4 X 4=64
# samples 234
** MAII scorelog2(23/2541*10)=-3.46569060910898
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ROCK1 [Title/Abstract] AND RNF38 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneROCK1

GO:0007159

leukocyte cell-cell adhesion

12082081

HgeneROCK1

GO:0022614

membrane to membrane docking

12082081

HgeneROCK1

GO:0032091

negative regulation of protein binding

18573880

HgeneROCK1

GO:0032956

regulation of actin cytoskeleton organization

25911094

HgeneROCK1

GO:0050900

leukocyte migration

12082081

HgeneROCK1

GO:0050901

leukocyte tethering or rolling

12082081

TgeneRNF38

GO:0016567

protein ubiquitination

23973461


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-56-A49D-01AROCK1chr18

18690779

-RNF38chr9

36390613

-
TCGALDLUSCTCGA-56-A49D-01AROCK1chr18

18690779

-RNF38chr9

36376124

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000399799ENST00000259605ROCK1chr18

18690779

-RNF38chr9

36390613

-
5CDS-intronENST00000399799ENST00000353739ROCK1chr18

18690779

-RNF38chr9

36390613

-
5CDS-5UTRENST00000399799ENST00000357058ROCK1chr18

18690779

-RNF38chr9

36390613

-
5CDS-intronENST00000399799ENST00000350199ROCK1chr18

18690779

-RNF38chr9

36390613

-
5CDS-5UTRENST00000399799ENST00000377885ROCK1chr18

18690779

-RNF38chr9

36390613

-
5CDS-intronENST00000399799ENST00000377877ROCK1chr18

18690779

-RNF38chr9

36390613

-
5CDS-5UTRENST00000399799ENST00000491349ROCK1chr18

18690779

-RNF38chr9

36390613

-
In-frameENST00000399799ENST00000259605ROCK1chr18

18690779

-RNF38chr9

36376124

-
In-frameENST00000399799ENST00000353739ROCK1chr18

18690779

-RNF38chr9

36376124

-
5CDS-5UTRENST00000399799ENST00000357058ROCK1chr18

18690779

-RNF38chr9

36376124

-
5CDS-5UTRENST00000399799ENST00000350199ROCK1chr18

18690779

-RNF38chr9

36376124

-
5CDS-5UTRENST00000399799ENST00000377885ROCK1chr18

18690779

-RNF38chr9

36376124

-
5CDS-5UTRENST00000399799ENST00000377877ROCK1chr18

18690779

-RNF38chr9

36376124

-
5CDS-5UTRENST00000399799ENST00000491349ROCK1chr18

18690779

-RNF38chr9

36376124

-

Top

FusionProtFeatures for ROCK1_RNF38


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ROCK1

Q13464

RNF38

Q9H0F5

Protein kinase which is a key regulator of actincytoskeleton and cell polarity. Involved in regulation of smoothmuscle contraction, actin cytoskeleton organization, stress fiberand focal adhesion formation, neurite retraction, cell adhesionand motility via phosphorylation of DAPK3, GFAP, LIMK1, LIMK2,MYL9/MLC2, PFN1 and PPP1R12A. Phosphorylates FHOD1 and actssynergistically with it to promote SRC-dependent non-apoptoticplasma membrane blebbing. Phosphorylates JIP3 and regulates therecruitment of JNK to JIP3 upon UVB-induced stress. Acts as asuppressor of inflammatory cell migration by regulating PTENphosphorylation and stability. Acts as a negative regulator ofVEGF-induced angiogenic endothelial cell activation. Required forcentrosome positioning and centrosome-dependent exit from mitosis.Plays a role in terminal erythroid differentiation. May regulateclosure of the eyelids and ventral body wall by inducing theassembly of actomyosin bundles. Promotes keratinocyte terminaldifferentiation. Involved in osteoblast compaction through thefibronectin fibrillogenesis cell-mediated matrix assembly process,essential for osteoblast mineralization.{ECO:0000269|PubMed:10436159, ECO:0000269|PubMed:10652353,ECO:0000269|PubMed:11018042, ECO:0000269|PubMed:11283607,ECO:0000269|PubMed:17158456, ECO:0000269|PubMed:18573880,ECO:0000269|PubMed:18694941, ECO:0000269|PubMed:19036714,ECO:0000269|PubMed:19131646, ECO:0000269|PubMed:19181962,ECO:0000269|PubMed:19997641, ECO:0000269|PubMed:21072057,ECO:0000269|PubMed:8617235, ECO:0000269|PubMed:9722579}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRNF38chr18:18690779chr9:36376124ENST00000259605-112239_40454516Compositional biasNote=Pro-rich
TgeneRNF38chr18:18690779chr9:36376124ENST00000350199-011239_404-29433Compositional biasNote=Pro-rich
TgeneRNF38chr18:18690779chr9:36376124ENST00000353739-011239_4044466Compositional biasNote=Pro-rich
TgeneRNF38chr18:18690779chr9:36376124ENST00000357058-112239_404-29433Compositional biasNote=Pro-rich
TgeneRNF38chr18:18690779chr9:36376124ENST00000377885-112239_404-29433Compositional biasNote=Pro-rich
TgeneRNF38chr18:18690779chr9:36390613ENST00000259605-012239_4044516Compositional biasNote=Pro-rich
TgeneRNF38chr18:18690779chr9:36390613ENST00000350199-011239_404-153433Compositional biasNote=Pro-rich
TgeneRNF38chr18:18690779chr9:36390613ENST00000353739-011239_404-64466Compositional biasNote=Pro-rich
TgeneRNF38chr18:18690779chr9:36390613ENST00000357058-012239_404-79433Compositional biasNote=Pro-rich
TgeneRNF38chr18:18690779chr9:36390613ENST00000377885-012239_404-79433Compositional biasNote=Pro-rich
TgeneRNF38chr18:18690779chr9:36376124ENST00000259605-112115_13154516MotifNote=Bipartite nuclear localization signal 2
TgeneRNF38chr18:18690779chr9:36376124ENST00000259605-11257_7154516MotifNote=Bipartite nuclear localization signal 1
TgeneRNF38chr18:18690779chr9:36376124ENST00000350199-011115_131-29433MotifNote=Bipartite nuclear localization signal 2
TgeneRNF38chr18:18690779chr9:36376124ENST00000350199-01157_71-29433MotifNote=Bipartite nuclear localization signal 1
TgeneRNF38chr18:18690779chr9:36376124ENST00000353739-011115_1314466MotifNote=Bipartite nuclear localization signal 2
TgeneRNF38chr18:18690779chr9:36376124ENST00000353739-01157_714466MotifNote=Bipartite nuclear localization signal 1
TgeneRNF38chr18:18690779chr9:36376124ENST00000357058-112115_131-29433MotifNote=Bipartite nuclear localization signal 2
TgeneRNF38chr18:18690779chr9:36376124ENST00000357058-11257_71-29433MotifNote=Bipartite nuclear localization signal 1
TgeneRNF38chr18:18690779chr9:36376124ENST00000377885-112115_131-29433MotifNote=Bipartite nuclear localization signal 2
TgeneRNF38chr18:18690779chr9:36376124ENST00000377885-11257_71-29433MotifNote=Bipartite nuclear localization signal 1
TgeneRNF38chr18:18690779chr9:36390613ENST00000259605-012115_1314516MotifNote=Bipartite nuclear localization signal 2
TgeneRNF38chr18:18690779chr9:36390613ENST00000259605-01257_714516MotifNote=Bipartite nuclear localization signal 1
TgeneRNF38chr18:18690779chr9:36390613ENST00000350199-011115_131-153433MotifNote=Bipartite nuclear localization signal 2
TgeneRNF38chr18:18690779chr9:36390613ENST00000350199-01157_71-153433MotifNote=Bipartite nuclear localization signal 1
TgeneRNF38chr18:18690779chr9:36390613ENST00000353739-011115_131-64466MotifNote=Bipartite nuclear localization signal 2
TgeneRNF38chr18:18690779chr9:36390613ENST00000353739-01157_71-64466MotifNote=Bipartite nuclear localization signal 1
TgeneRNF38chr18:18690779chr9:36390613ENST00000357058-012115_131-79433MotifNote=Bipartite nuclear localization signal 2
TgeneRNF38chr18:18690779chr9:36390613ENST00000357058-01257_71-79433MotifNote=Bipartite nuclear localization signal 1
TgeneRNF38chr18:18690779chr9:36390613ENST00000377885-012115_131-79433MotifNote=Bipartite nuclear localization signal 2
TgeneRNF38chr18:18690779chr9:36390613ENST00000377885-01257_71-79433MotifNote=Bipartite nuclear localization signal 1
TgeneRNF38chr18:18690779chr9:36376124ENST00000259605-112463_50454516Zinc fingerRING-type
TgeneRNF38chr18:18690779chr9:36376124ENST00000350199-011463_504-29433Zinc fingerRING-type
TgeneRNF38chr18:18690779chr9:36376124ENST00000353739-011463_5044466Zinc fingerRING-type
TgeneRNF38chr18:18690779chr9:36376124ENST00000357058-112463_504-29433Zinc fingerRING-type
TgeneRNF38chr18:18690779chr9:36376124ENST00000377885-112463_504-29433Zinc fingerRING-type
TgeneRNF38chr18:18690779chr9:36390613ENST00000259605-012463_5044516Zinc fingerRING-type
TgeneRNF38chr18:18690779chr9:36390613ENST00000350199-011463_504-153433Zinc fingerRING-type
TgeneRNF38chr18:18690779chr9:36390613ENST00000353739-011463_504-64466Zinc fingerRING-type
TgeneRNF38chr18:18690779chr9:36390613ENST00000357058-012463_504-79433Zinc fingerRING-type
TgeneRNF38chr18:18690779chr9:36390613ENST00000377885-012463_504-79433Zinc fingerRING-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneROCK1chr18:18690779chr9:36376124ENST00000399799-1331011_1102311355Coiled coilOntology_term=ECO:0000255
HgeneROCK1chr18:18690779chr9:36376124ENST00000399799-133422_692311355Coiled coilOntology_term=ECO:0000255
HgeneROCK1chr18:18690779chr9:36390613ENST00000399799-1331011_1102311355Coiled coilOntology_term=ECO:0000255
HgeneROCK1chr18:18690779chr9:36390613ENST00000399799-133422_692311355Coiled coilOntology_term=ECO:0000255
HgeneROCK1chr18:18690779chr9:36376124ENST00000399799-133636_980311355Compositional biasNote=Glu-rich
HgeneROCK1chr18:18690779chr9:36390613ENST00000399799-133636_980311355Compositional biasNote=Glu-rich
HgeneROCK1chr18:18690779chr9:36376124ENST00000399799-1331118_1317311355DomainPH
HgeneROCK1chr18:18690779chr9:36376124ENST00000399799-133341_409311355DomainNote=AGC-kinase C-terminal
HgeneROCK1chr18:18690779chr9:36376124ENST00000399799-133479_556311355DomainREM-1
HgeneROCK1chr18:18690779chr9:36376124ENST00000399799-13376_338311355DomainProtein kinase
HgeneROCK1chr18:18690779chr9:36376124ENST00000399799-133949_1015311355DomainRhoBD
HgeneROCK1chr18:18690779chr9:36390613ENST00000399799-1331118_1317311355DomainPH
HgeneROCK1chr18:18690779chr9:36390613ENST00000399799-133341_409311355DomainNote=AGC-kinase C-terminal
HgeneROCK1chr18:18690779chr9:36390613ENST00000399799-133479_556311355DomainREM-1
HgeneROCK1chr18:18690779chr9:36390613ENST00000399799-13376_338311355DomainProtein kinase
HgeneROCK1chr18:18690779chr9:36390613ENST00000399799-133949_1015311355DomainRhoBD
HgeneROCK1chr18:18690779chr9:36376124ENST00000399799-13382_90311355Nucleotide bindingATP
HgeneROCK1chr18:18690779chr9:36390613ENST00000399799-13382_90311355Nucleotide bindingATP
HgeneROCK1chr18:18690779chr9:36376124ENST00000399799-1331115_1354311355RegionNote=Auto-inhibitory
HgeneROCK1chr18:18690779chr9:36376124ENST00000399799-133998_1010311355RegionNote=RHOA binding
HgeneROCK1chr18:18690779chr9:36390613ENST00000399799-1331115_1354311355RegionNote=Auto-inhibitory
HgeneROCK1chr18:18690779chr9:36390613ENST00000399799-133998_1010311355RegionNote=RHOA binding
HgeneROCK1chr18:18690779chr9:36376124ENST00000399799-1331228_1281311355Zinc fingerPhorbol-ester/DAG-type
HgeneROCK1chr18:18690779chr9:36390613ENST00000399799-1331228_1281311355Zinc fingerPhorbol-ester/DAG-type


Top

FusionGeneSequence for ROCK1_RNF38


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ROCK1_ENST00000399799_chr18_18690779_-_RNF38_ENST00000259605_chr9_36390613_-_543aa
MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLISPGANSASLPGHPNKVICERVRLQSLFPLLPSDQNTTVQEDAHFKAFFQSEDSPSPKR
QRLSHSVFDTTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSPPVRRQRGRRDRLSRHNSISQDENTHHLPYAQQQ
AIEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQLHQGTVPVSYTVTTVAPHGIPLCTGQHIPACSTQQVPGCSVVFSGQHLPVCSV
PPPMLQACSVQHLPVPTAAFPPLISSDPFLIHPPHLSPHHPPHLPPPGQFVPFQTQQSRSPLQRIENEVELLGEHLPVGGFTYPPSAHPP
TLPPSAPLQFLTHDPLHQEVSFGVPTPPFMPRRLTGRSRYRSQQPIPPPPTHPSLLPTVLSMLPVPPAVGPTFSFELDVEDGEVENYEAL
LNLAERLGEAKPRGLTKADIEQLPSTRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASEVHRD

>In-frame_ROCK1_ENST00000399799_chr18_18690779_-_RNF38_ENST00000259605_chr9_36376124_-_493aa
MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLSEDSPSPKRQRLSHSVFDTTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTP
ARNRRSPPVRRQRGRRDRLSRHNSISQDENTHHLPYAQQQAIEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQLHQGTVPVSYTVT
TVAPHGIPLCTGQHIPACSTQQVPGCSVVFSGQHLPVCSVPPPMLQACSVQHLPVPTAAFPPLISSDPFLIHPPHLSPHHPPHLPPPGQF
VPFQTQQSRSPLQRIENEVELLGEHLPVGGFTYPPSAHPPTLPPSAPLQFLTHDPLHQEVSFGVPTPPFMPRRLTGRSRYRSQQPIPPPP
THPSLLPTVLSMLPVPPAVGPTFSFELDVEDGEVENYEALLNLAERLGEAKPRGLTKADIEQLPSTRFNPNNHQSEQTLCVVCMCDFESR

>In-frame_ROCK1_ENST00000399799_chr18_18690779_-_RNF38_ENST00000353739_chr9_36376124_-_493aa
MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLSEDSPSPKRQRLSHSVFDTTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTP
ARNRRSPPVRRQRGRRDRLSRHNSISQDENTHHLPYAQQQAIEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQLHQGTVPVSYTVT
TVAPHGIPLCTGQHIPACSTQQVPGCSVVFSGQHLPVCSVPPPMLQACSVQHLPVPTAAFPPLISSDPFLIHPPHLSPHHPPHLPPPGQF
VPFQTQQSRSPLQRIENEVELLGEHLPVGGFTYPPSAHPPTLPPSAPLQFLTHDPLHQEVSFGVPTPPFMPRRLTGRSRYRSQQPIPPPP
THPSLLPTVLSMLPVPPAVGPTFSFELDVEDGEVENYEALLNLAERLGEAKPRGLTKADIEQLPSTRFNPNNHQSEQTLCVVCMCDFESR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ROCK1_ENST00000399799_chr18_18690779_-_RNF38_ENST00000259605_chr9_36390613_-_1629nt
ATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACCTGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTG
CTGATATCTCCCGGGGCCAATTCAGCATCTCTACCTGGCCATCCTAACAAGGTGATTTGTGAAAGGGTGAGACTTCAGAGCCTGTTCCCT
CTCCTCCCAAGTGATCAGAACACTACCGTTCAAGAGGATGCTCACTTCAAAGCTTTCTTCCAGAGTGAAGATAGTCCAAGTCCTAAGAGA
CAGCGCCTCTCTCATTCAGTCTTTGATTATACATCAGCATCACCAGCTCCCTCACCACCAATGCGACCATGGGAGATGACATCAAATAGG
CAGCCCCCTTCAGTTCGACCAAGCCAACATCACTTCTCAGGGGAACGATGCAACACACCTGCACGCAACAGAAGAAGTCCTCCTGTCAGG
CGCCAGAGAGGAAGAAGGGATCGTCTGTCTCGACATAATTCCATTAGTCAAGATGAAAACTATCACCATCTCCCTTACGCACAGCAGCAA
GCAATAGAGGAGCCTCGAGCCTTCCACCCTCCGAATGTATCTCCCCGTCTGCTACATCCTGCTGCTCATCCACCCCAGCAGAATGCAGTC
ATGGTTGACATACATGATCAGCTCCATCAAGGAACAGTCCCTGTTTCTTACACAGTAACAACAGTGGCACCACATGGGATTCCACTCTGC
ACAGGCCAGCACATCCCTGCTTGTAGTACACAGCAGGTCCCAGGATGCTCTGTGGTTTTCAGTGGACAGCACCTCCCTGTCTGTAGTGTG
CCTCCTCCAATGCTTCAGGCATGTTCAGTTCAGCACTTACCAGTACCATATGCTGCATTCCCACCCCTTATTTCTAGTGATCCATTTCTT
ATACATCCTCCTCACCTTTCTCCCCATCATCCTCCTCATTTGCCACCACCAGGCCAGTTTGTCCCTTTCCAAACACAGCAATCACGATCG
CCTCTGCAAAGGATAGAAAATGAAGTGGAACTCTTAGGAGAACATCTTCCAGTAGGAGGTTTTACTTACCCTCCATCAGCCCACCCCCCA
ACATTACCTCCATCAGCTCCCTTGCAGTTCTTAACACATGATCCTTTGCATCAGGAGGTGTCCTTTGGAGTACCTTATCCTCCATTTATG
CCTCGGAGGCTTACAGGACGTAGTAGATACCGATCCCAGCAGCCAATACCACCTCCCCCTTATCATCCCAGCTTACTGCCATATGTGTTA
TCAATGCTTCCAGTGCCACCTGCAGTGGGCCCAACTTTCAGCTTTGAATTAGATGTAGAAGATGGAGAAGTAGAAAATTACGAGGCCCTG
TTAAACCTGGCAGAGCGACTGGGAGAGGCAAAGCCTCGTGGACTGACTAAAGCAGATATTGAACAACTTCCTTCTTATCGGTTCAATCCT
AACAACCACCAGTCAGAACAGACTTTGTGTGTAGTATGCATGTGTGATTTTGAGTCAAGGCAGCTACTTAGAGTCTTACCCTGTAACCAC
GAGTTCCATGCCAAGTGTGTTGACAAATGGCTTAAGGCAAATCGTACTTGCCCAATTTGCCGAGCTGATGCTTCAGAAGTGCATCGGGAT

>In-frame_ROCK1_ENST00000399799_chr18_18690779_-_RNF38_ENST00000259605_chr9_36376124_-_1479nt
ATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACCTGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTG
CTGAGTGAAGATAGTCCAAGTCCTAAGAGACAGCGCCTCTCTCATTCAGTCTTTGATTATACATCAGCATCACCAGCTCCCTCACCACCA
ATGCGACCATGGGAGATGACATCAAATAGGCAGCCCCCTTCAGTTCGACCAAGCCAACATCACTTCTCAGGGGAACGATGCAACACACCT
GCACGCAACAGAAGAAGTCCTCCTGTCAGGCGCCAGAGAGGAAGAAGGGATCGTCTGTCTCGACATAATTCCATTAGTCAAGATGAAAAC
TATCACCATCTCCCTTACGCACAGCAGCAAGCAATAGAGGAGCCTCGAGCCTTCCACCCTCCGAATGTATCTCCCCGTCTGCTACATCCT
GCTGCTCATCCACCCCAGCAGAATGCAGTCATGGTTGACATACATGATCAGCTCCATCAAGGAACAGTCCCTGTTTCTTACACAGTAACA
ACAGTGGCACCACATGGGATTCCACTCTGCACAGGCCAGCACATCCCTGCTTGTAGTACACAGCAGGTCCCAGGATGCTCTGTGGTTTTC
AGTGGACAGCACCTCCCTGTCTGTAGTGTGCCTCCTCCAATGCTTCAGGCATGTTCAGTTCAGCACTTACCAGTACCATATGCTGCATTC
CCACCCCTTATTTCTAGTGATCCATTTCTTATACATCCTCCTCACCTTTCTCCCCATCATCCTCCTCATTTGCCACCACCAGGCCAGTTT
GTCCCTTTCCAAACACAGCAATCACGATCGCCTCTGCAAAGGATAGAAAATGAAGTGGAACTCTTAGGAGAACATCTTCCAGTAGGAGGT
TTTACTTACCCTCCATCAGCCCACCCCCCAACATTACCTCCATCAGCTCCCTTGCAGTTCTTAACACATGATCCTTTGCATCAGGAGGTG
TCCTTTGGAGTACCTTATCCTCCATTTATGCCTCGGAGGCTTACAGGACGTAGTAGATACCGATCCCAGCAGCCAATACCACCTCCCCCT
TATCATCCCAGCTTACTGCCATATGTGTTATCAATGCTTCCAGTGCCACCTGCAGTGGGCCCAACTTTCAGCTTTGAATTAGATGTAGAA
GATGGAGAAGTAGAAAATTACGAGGCCCTGTTAAACCTGGCAGAGCGACTGGGAGAGGCAAAGCCTCGTGGACTGACTAAAGCAGATATT
GAACAACTTCCTTCTTATCGGTTCAATCCTAACAACCACCAGTCAGAACAGACTTTGTGTGTAGTATGCATGTGTGATTTTGAGTCAAGG
CAGCTACTTAGAGTCTTACCCTGTAACCACGAGTTCCATGCCAAGTGTGTTGACAAATGGCTTAAGGCAAATCGTACTTGCCCAATTTGC

>In-frame_ROCK1_ENST00000399799_chr18_18690779_-_RNF38_ENST00000353739_chr9_36376124_-_1479nt
ATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACCTGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTG
CTGAGTGAAGATAGTCCAAGTCCTAAGAGACAGCGCCTCTCTCATTCAGTCTTTGATTATACATCAGCATCACCAGCTCCCTCACCACCA
ATGCGACCATGGGAGATGACATCAAATAGGCAGCCCCCTTCAGTTCGACCAAGCCAACATCACTTCTCAGGGGAACGATGCAACACACCT
GCACGCAACAGAAGAAGTCCTCCTGTCAGGCGCCAGAGAGGAAGAAGGGATCGTCTGTCTCGACATAATTCCATTAGTCAAGATGAAAAC
TATCACCATCTCCCTTACGCACAGCAGCAAGCAATAGAGGAGCCTCGAGCCTTCCACCCTCCGAATGTATCTCCCCGTCTGCTACATCCT
GCTGCTCATCCACCCCAGCAGAATGCAGTCATGGTTGACATACATGATCAGCTCCATCAAGGAACAGTCCCTGTTTCTTACACAGTAACA
ACAGTGGCACCACATGGGATTCCACTCTGCACAGGCCAGCACATCCCTGCTTGTAGTACACAGCAGGTCCCAGGATGCTCTGTGGTTTTC
AGTGGACAGCACCTCCCTGTCTGTAGTGTGCCTCCTCCAATGCTTCAGGCATGTTCAGTTCAGCACTTACCAGTACCATATGCTGCATTC
CCACCCCTTATTTCTAGTGATCCATTTCTTATACATCCTCCTCACCTTTCTCCCCATCATCCTCCTCATTTGCCACCACCAGGCCAGTTT
GTCCCTTTCCAAACACAGCAATCACGATCGCCTCTGCAAAGGATAGAAAATGAAGTGGAACTCTTAGGAGAACATCTTCCAGTAGGAGGT
TTTACTTACCCTCCATCAGCCCACCCCCCAACATTACCTCCATCAGCTCCCTTGCAGTTCTTAACACATGATCCTTTGCATCAGGAGGTG
TCCTTTGGAGTACCTTATCCTCCATTTATGCCTCGGAGGCTTACAGGACGTAGTAGATACCGATCCCAGCAGCCAATACCACCTCCCCCT
TATCATCCCAGCTTACTGCCATATGTGTTATCAATGCTTCCAGTGCCACCTGCAGTGGGCCCAACTTTCAGCTTTGAATTAGATGTAGAA
GATGGAGAAGTAGAAAATTACGAGGCCCTGTTAAACCTGGCAGAGCGACTGGGAGAGGCAAAGCCTCGTGGACTGACTAAAGCAGATATT
GAACAACTTCCTTCTTATCGGTTCAATCCTAACAACCACCAGTCAGAACAGACTTTGTGTGTAGTATGCATGTGTGATTTTGAGTCAAGG
CAGCTACTTAGAGTCTTACCCTGTAACCACGAGTTCCATGCCAAGTGTGTTGACAAATGGCTTAAGGCAAATCGTACTTGCCCAATTTGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ROCK1_ENST00000399799_chr18_18690779_-_RNF38_ENST00000259605_chr9_36390613_-_5926nt
GCTGGTTCCCCTTCCGAGCGTCCGCGCCCCGCATGCGCAGTCTGCCCCGGCGGTCTCCGTTTGTTTGAACAGGAAGGCGGACATATTAGT
CCCTCTCAGCCCCCCTCGCCCCACCCCCCAGGCATTCGCCGCCGCGACTCGCCCTTTCCCCGGCTGGGACCGCAGCCCCTCCCAGAAGCT
CCCCCATCAGCAGCCGCCGGGACCCAACTATCGTCTTCCTCTTCGCCCGCTCTCCAGCCTTTCCTCTGCTAAGTCTCCATCGGGCATCGA
CCTCGCCCTGCCCCACCGGACACCGTAGCAGCAGCCCCAGCAGCGACGGGACAAAATGGGAGAGTGAGGCTGTCCTGCGTGGACCAGCTC
GTGGCCGAGACTGATCGGTGCGTCGGGCCGGGCCGAGTAGAGCCGGGGACGCGGGGCTAGACCGTCTACAGCGCCTCTGAGCGGAGCGGG
CCCGGCCCGTGGCCCGAGCGGCGGCCGCAGCTGGCACAGCTCCTCACCCGCCCTTTGCTTTCGCCTTTCCTCTTCTCCCTCCCTTGTTGC
CCGGAGGGAGTCTCCACCCTGCTTCTCTTTCTCTACCCGCTCCTGCCCATCTCGGGACGGGGACCCCTCCATGGCGACGGCGGCCGGGGC
CCGCTAGACTGAAGCACCTCGCCGGAGCGACGAGGCTGGTGGCGACGGCGCTGTCGGCTGTCGTGAGGGGCTGCCGGGTGGGATGCGACT
TTGGGCGTCCGAGCGGCTGTGGGTCGCTGTTGCCCCCGGCCCGGGGTCTGGAGAGCGGAGGTCCCCTCAGTGAGGGGAAGACGGGGGAAC
CGGGCGCACCTGGTGACCCTGAGGTTCCGGCTCCTCCGCCCCGCGGCTGCGAACCCACCGCGGAGGAAGTTGGTTGAAATTGCTTTCCGC
TGCTGGTGCTGGTAAGAGGGCATTGTCACAGCAGCAGCAACATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACC
TGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTGCTGATATCTCCCGGGGCCAATTCAGCATCTCTACCTGGCCATCCTAACA
AGGTGATTTGTGAAAGGGTGAGACTTCAGAGCCTGTTCCCTCTCCTCCCAAGTGATCAGAACACTACCGTTCAAGAGGATGCTCACTTCA
AAGCTTTCTTCCAGAGTGAAGATAGTCCAAGTCCTAAGAGACAGCGCCTCTCTCATTCAGTCTTTGATTATACATCAGCATCACCAGCTC
CCTCACCACCAATGCGACCATGGGAGATGACATCAAATAGGCAGCCCCCTTCAGTTCGACCAAGCCAACATCACTTCTCAGGGGAACGAT
GCAACACACCTGCACGCAACAGAAGAAGTCCTCCTGTCAGGCGCCAGAGAGGAAGAAGGGATCGTCTGTCTCGACATAATTCCATTAGTC
AAGATGAAAACTATCACCATCTCCCTTACGCACAGCAGCAAGCAATAGAGGAGCCTCGAGCCTTCCACCCTCCGAATGTATCTCCCCGTC
TGCTACATCCTGCTGCTCATCCACCCCAGCAGAATGCAGTCATGGTTGACATACATGATCAGCTCCATCAAGGAACAGTCCCTGTTTCTT
ACACAGTAACAACAGTGGCACCACATGGGATTCCACTCTGCACAGGCCAGCACATCCCTGCTTGTAGTACACAGCAGGTCCCAGGATGCT
CTGTGGTTTTCAGTGGACAGCACCTCCCTGTCTGTAGTGTGCCTCCTCCAATGCTTCAGGCATGTTCAGTTCAGCACTTACCAGTACCAT
ATGCTGCATTCCCACCCCTTATTTCTAGTGATCCATTTCTTATACATCCTCCTCACCTTTCTCCCCATCATCCTCCTCATTTGCCACCAC
CAGGCCAGTTTGTCCCTTTCCAAACACAGCAATCACGATCGCCTCTGCAAAGGATAGAAAATGAAGTGGAACTCTTAGGAGAACATCTTC
CAGTAGGAGGTTTTACTTACCCTCCATCAGCCCACCCCCCAACATTACCTCCATCAGCTCCCTTGCAGTTCTTAACACATGATCCTTTGC
ATCAGGAGGTGTCCTTTGGAGTACCTTATCCTCCATTTATGCCTCGGAGGCTTACAGGACGTAGTAGATACCGATCCCAGCAGCCAATAC
CACCTCCCCCTTATCATCCCAGCTTACTGCCATATGTGTTATCAATGCTTCCAGTGCCACCTGCAGTGGGCCCAACTTTCAGCTTTGAAT
TAGATGTAGAAGATGGAGAAGTAGAAAATTACGAGGCCCTGTTAAACCTGGCAGAGCGACTGGGAGAGGCAAAGCCTCGTGGACTGACTA
AAGCAGATATTGAACAACTTCCTTCTTATCGGTTCAATCCTAACAACCACCAGTCAGAACAGACTTTGTGTGTAGTATGCATGTGTGATT
TTGAGTCAAGGCAGCTACTTAGAGTCTTACCCTGTAACCACGAGTTCCATGCCAAGTGTGTTGACAAATGGCTTAAGGCAAATCGTACTT
GCCCAATTTGCCGAGCTGATGCTTCAGAAGTGCATCGGGATTCAGAATGACCAACCTAAGAAGCACAAATTTAGTTTGGGTGTTCCTCAT
CACATGTATATACGGACTATCCATTGAACTTAATCTGTGTGGCTTCCAGCCCTCCCTTTACCAAAAGGGTCAATGGACCTTTCTTTGCAC
TGTGTGACTTAATCAACTATAAAAGCTTACAATTAGTCTTCACAGTTATGGGATTGTTATACTAACCGTGTGATTGGAACTCCAAAGACT
TTTTCTTTAGCTTAATTTTGTGTGTGCACTAACATTCCCTGGTTTTTGTGTGATCATTCCGAGTGTTGCTGCAAGATTACAGTGGACGTG
ATCTTTTAGCATGTGCTTTTATAAAAAGTGGTAGCTACAGATGATATAGCAATCTACCTTATATAGAGCCTTCAGAAACTGTGAGTGGAA
ATGAATGCGCAGCGTATGACTGTTGGTGATAAGTGTATCTGTGTGAGTGTGTGCAACTACTTGTGTGAGGGCATGGTAGCTAACGTGTGT
ATGAGATCCTATATACCAGCATGTACCAAGAATGTGTGTGTAGTTTTAATTATGCTGCAATGTATAATCTGGTGTGTTATTTAAACAGCA
CTAGTACTGTACACTGGTTTTTTTCCCTTGTGTTTGCTGTTGCACACTGATTGCTGAGGGTGCATCAATTACAAGCATTGAATACTCCAT
CCCCTTCCCTCCCAGTGAATGGAATGAGAAAAGCCTTCTTCCTTTGCTTCAGGCAGCTGTCACCTTCTCTTTATTGGTGGTCCTAAGTGG
GTCACTTAAGAAAAAAAAGTGTAACAAATTCTCGCTCCATGAACCTGGTTTTTTTTTATTCTGTTGTGGAAATTTTTAAATCTCCAACTT
GCTGTTTCCAAAAAGAAGGTGCAATATCATATATCATCAGTTAGCAATATTAGCATTTCAATCAGTGATTTGAATGTTGATACTTTTTTT
TCCTTTACATTTCCAGTAAGTTTCTTACAGAAAGTACCTGTGATTTTTTTTAATGTTTAGATTTGTAGTCTAGTCTATTCTGAAGATATT
TGATTAATATATTTCTAAGAAGACCACTAGTCCCATGAAGTCTCACCTTGTTGACTTCCACCAGAACAAAACCTGTTAATTCAGCTTGAC
TTCTCATATGTGTTCTGTGTTCAAGCTCCTGTGGGCAACTCAATTGTTTTAAGAAAACTCTATTTCTGTTCATATTAATTCACTTGCCAG
ACTCCAATTCTGAAAGTTGTCTAGTTCTTCCTTCATCACACGTGCTTCTCATCGAAACCCTGGTTTCAGGATGGATCAAGTGCTGTTACA
GCTCATGTTCCTTAGACCTGATTTGTTTTGATATTTTACTGCCTTTCCTTTTAATTTTTGTTTGAATGAGAAAAGTTTAATACAACAGGT
GTCCAGAATACTTGCAGTATAAATGAAGATTTGGTTTTTGTATAAAAAAATAATGCTGTTAAACAGGAGTTGACCTTCATTTAGTTGATG
TAATACATAGCTGTATGGGGTTTTTTTTAGTAAGTTCTTTGAGCATAATTCACTTTAAAGTCATTTTTCCAGCAATGTTTAAATTACTTT
CTCATTCTTTTAGTGTATTCAACATTGTCTGCCTCTTCCTGCAGTTGATGTAATTGCTTTGTTTGCAATAGCACAAGCTGCATTATTCCA
GTCAGGACTGTGATAACTTGCTGCCAGCCCCACTCAACTTTCAGTTGGCTCTGTGTCAGTTTTCCATTCAGTGTTAACTACTTGTTACTG
CCATGCTGCTTGCCCTCCCTTGAAGTGTCTATAAGCTCATCACAGCCTAGAGTTAAGTAAAGTCAATTCACAGAAGCACAATTTTGCCCT
TTGCGAGACATTGTTGCCTCTATCTAGTCCTACAAGTAGGGTTTTGCATACTGTGTTTGCCCCTAGGGTTGTCAGTGCATCAGAAATACT
TCTAAATAGTGGTAAAAATGCACATGGTTAATGCACATGTTACTTTTAAATCATTAGGATATCCCTCACCTGTTCCTGATGAATAAAAAG
TGTGTTAAAGACCAAAATTCTTGGCATAATAATCAGCTACATACAAATCACATATAGTTTAATCTTTTTTAATGAAAAAAAATCATGTTT
AAAATGGCAAAAGCCCATCTTATACACTTTTATATAGCTGCAAAAAATTTATATCTGTACAGATCTAACACTACGACACTCAGTATTCAT
TTTATTGAAGCATGCAAGTAAAGCACTTTTTCTAATTTATATAGAGGTATCTAATTAACACAGCACATTGTACTAATGACTAGGAGTAGC
AGCTTTTTCTTCTCTCCCTCTATGAATTCTTATAATGTCCCTTTTTCTGTAAGTTTTTGAGAGGCAATTGGCAATTTAGGAGGCAGCAGG
GTCTGTTTTGGTCAAATCTTGAATTTCGTTGTTGCACTCTAGTGACTGATCTTTGGGAATGTCTTGTCTTTGCATGGGGCTCATAGAGAT
GTGTGCAGACTTGCTTATTGTGGTTAGTGTGTATCAGGAACACACACACAGGTGTTCTGACCAGCTCAGGCTTGCCACAGTGAGCAACTC
TGTGGCTAGCAAAAGAGAAGTTTATTTGTGCCCAGCCATTGGTCACCTTGGGTGATGCACCAGATAGCAGGCAGATGTTGGTTCATTGGC
CTTCGTCCTCTTTCCTCCTAAAATAATATTGGCTTTACCATCTTAACTCAGCTGTGGGTTTTTTGTGGGTTCTTGTTTGTTTTTTGGCAT
GAATTGTCATCTTTGGTGTTTTTTTAACCCCCAGCCCCTCAAAAAAATAAGGCCTCCAGGTATCAAGATCTCATATTAGGATTTTCTGTC
CTTAATTTTTTGAGCAAAATCTGGAAAATGTGAAAGCATATTTAGATTTTATATACTATCTGAAATGTGATTTGTTAAGATTCTTAAATT
TGGGCCTCTTAGAATAATTTTGAATGAGATCTACCGACTCACTTGTGAGAATATTTTTCACAGATTATCTTTGGGCCTTTTCATTAGAAA
GCTGTTTGTTTGTCCCCCTGTTGGTACATTTGGTTACCTCATTTTGCCGTTTCAGATTGTGAAAGCTCACAGGGGTGTTTTTTGGAATCA
TTTGCTGAGTCATTTTCTCAAATCATATTCCATTGTATCAGTTAACATATAGTTTTAAATGTATGTATTATAAATATCTGTAACCAAATC
ATTTGAAGGCTTGATAAATTTTTAACAAAGTTTGTACATTTTTTATGAAAGTTACTAGTAATGCTTTACTAAGTAGTGCAATGAATTTTT

>In-frame_ROCK1_ENST00000399799_chr18_18690779_-_RNF38_ENST00000259605_chr9_36376124_-_5776nt
GCTGGTTCCCCTTCCGAGCGTCCGCGCCCCGCATGCGCAGTCTGCCCCGGCGGTCTCCGTTTGTTTGAACAGGAAGGCGGACATATTAGT
CCCTCTCAGCCCCCCTCGCCCCACCCCCCAGGCATTCGCCGCCGCGACTCGCCCTTTCCCCGGCTGGGACCGCAGCCCCTCCCAGAAGCT
CCCCCATCAGCAGCCGCCGGGACCCAACTATCGTCTTCCTCTTCGCCCGCTCTCCAGCCTTTCCTCTGCTAAGTCTCCATCGGGCATCGA
CCTCGCCCTGCCCCACCGGACACCGTAGCAGCAGCCCCAGCAGCGACGGGACAAAATGGGAGAGTGAGGCTGTCCTGCGTGGACCAGCTC
GTGGCCGAGACTGATCGGTGCGTCGGGCCGGGCCGAGTAGAGCCGGGGACGCGGGGCTAGACCGTCTACAGCGCCTCTGAGCGGAGCGGG
CCCGGCCCGTGGCCCGAGCGGCGGCCGCAGCTGGCACAGCTCCTCACCCGCCCTTTGCTTTCGCCTTTCCTCTTCTCCCTCCCTTGTTGC
CCGGAGGGAGTCTCCACCCTGCTTCTCTTTCTCTACCCGCTCCTGCCCATCTCGGGACGGGGACCCCTCCATGGCGACGGCGGCCGGGGC
CCGCTAGACTGAAGCACCTCGCCGGAGCGACGAGGCTGGTGGCGACGGCGCTGTCGGCTGTCGTGAGGGGCTGCCGGGTGGGATGCGACT
TTGGGCGTCCGAGCGGCTGTGGGTCGCTGTTGCCCCCGGCCCGGGGTCTGGAGAGCGGAGGTCCCCTCAGTGAGGGGAAGACGGGGGAAC
CGGGCGCACCTGGTGACCCTGAGGTTCCGGCTCCTCCGCCCCGCGGCTGCGAACCCACCGCGGAGGAAGTTGGTTGAAATTGCTTTCCGC
TGCTGGTGCTGGTAAGAGGGCATTGTCACAGCAGCAGCAACATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACC
TGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTGCTGAGTGAAGATAGTCCAAGTCCTAAGAGACAGCGCCTCTCTCATTCAG
TCTTTGATTATACATCAGCATCACCAGCTCCCTCACCACCAATGCGACCATGGGAGATGACATCAAATAGGCAGCCCCCTTCAGTTCGAC
CAAGCCAACATCACTTCTCAGGGGAACGATGCAACACACCTGCACGCAACAGAAGAAGTCCTCCTGTCAGGCGCCAGAGAGGAAGAAGGG
ATCGTCTGTCTCGACATAATTCCATTAGTCAAGATGAAAACTATCACCATCTCCCTTACGCACAGCAGCAAGCAATAGAGGAGCCTCGAG
CCTTCCACCCTCCGAATGTATCTCCCCGTCTGCTACATCCTGCTGCTCATCCACCCCAGCAGAATGCAGTCATGGTTGACATACATGATC
AGCTCCATCAAGGAACAGTCCCTGTTTCTTACACAGTAACAACAGTGGCACCACATGGGATTCCACTCTGCACAGGCCAGCACATCCCTG
CTTGTAGTACACAGCAGGTCCCAGGATGCTCTGTGGTTTTCAGTGGACAGCACCTCCCTGTCTGTAGTGTGCCTCCTCCAATGCTTCAGG
CATGTTCAGTTCAGCACTTACCAGTACCATATGCTGCATTCCCACCCCTTATTTCTAGTGATCCATTTCTTATACATCCTCCTCACCTTT
CTCCCCATCATCCTCCTCATTTGCCACCACCAGGCCAGTTTGTCCCTTTCCAAACACAGCAATCACGATCGCCTCTGCAAAGGATAGAAA
ATGAAGTGGAACTCTTAGGAGAACATCTTCCAGTAGGAGGTTTTACTTACCCTCCATCAGCCCACCCCCCAACATTACCTCCATCAGCTC
CCTTGCAGTTCTTAACACATGATCCTTTGCATCAGGAGGTGTCCTTTGGAGTACCTTATCCTCCATTTATGCCTCGGAGGCTTACAGGAC
GTAGTAGATACCGATCCCAGCAGCCAATACCACCTCCCCCTTATCATCCCAGCTTACTGCCATATGTGTTATCAATGCTTCCAGTGCCAC
CTGCAGTGGGCCCAACTTTCAGCTTTGAATTAGATGTAGAAGATGGAGAAGTAGAAAATTACGAGGCCCTGTTAAACCTGGCAGAGCGAC
TGGGAGAGGCAAAGCCTCGTGGACTGACTAAAGCAGATATTGAACAACTTCCTTCTTATCGGTTCAATCCTAACAACCACCAGTCAGAAC
AGACTTTGTGTGTAGTATGCATGTGTGATTTTGAGTCAAGGCAGCTACTTAGAGTCTTACCCTGTAACCACGAGTTCCATGCCAAGTGTG
TTGACAAATGGCTTAAGGCAAATCGTACTTGCCCAATTTGCCGAGCTGATGCTTCAGAAGTGCATCGGGATTCAGAATGACCAACCTAAG
AAGCACAAATTTAGTTTGGGTGTTCCTCATCACATGTATATACGGACTATCCATTGAACTTAATCTGTGTGGCTTCCAGCCCTCCCTTTA
CCAAAAGGGTCAATGGACCTTTCTTTGCACTGTGTGACTTAATCAACTATAAAAGCTTACAATTAGTCTTCACAGTTATGGGATTGTTAT
ACTAACCGTGTGATTGGAACTCCAAAGACTTTTTCTTTAGCTTAATTTTGTGTGTGCACTAACATTCCCTGGTTTTTGTGTGATCATTCC
GAGTGTTGCTGCAAGATTACAGTGGACGTGATCTTTTAGCATGTGCTTTTATAAAAAGTGGTAGCTACAGATGATATAGCAATCTACCTT
ATATAGAGCCTTCAGAAACTGTGAGTGGAAATGAATGCGCAGCGTATGACTGTTGGTGATAAGTGTATCTGTGTGAGTGTGTGCAACTAC
TTGTGTGAGGGCATGGTAGCTAACGTGTGTATGAGATCCTATATACCAGCATGTACCAAGAATGTGTGTGTAGTTTTAATTATGCTGCAA
TGTATAATCTGGTGTGTTATTTAAACAGCACTAGTACTGTACACTGGTTTTTTTCCCTTGTGTTTGCTGTTGCACACTGATTGCTGAGGG
TGCATCAATTACAAGCATTGAATACTCCATCCCCTTCCCTCCCAGTGAATGGAATGAGAAAAGCCTTCTTCCTTTGCTTCAGGCAGCTGT
CACCTTCTCTTTATTGGTGGTCCTAAGTGGGTCACTTAAGAAAAAAAAGTGTAACAAATTCTCGCTCCATGAACCTGGTTTTTTTTTATT
CTGTTGTGGAAATTTTTAAATCTCCAACTTGCTGTTTCCAAAAAGAAGGTGCAATATCATATATCATCAGTTAGCAATATTAGCATTTCA
ATCAGTGATTTGAATGTTGATACTTTTTTTTCCTTTACATTTCCAGTAAGTTTCTTACAGAAAGTACCTGTGATTTTTTTTAATGTTTAG
ATTTGTAGTCTAGTCTATTCTGAAGATATTTGATTAATATATTTCTAAGAAGACCACTAGTCCCATGAAGTCTCACCTTGTTGACTTCCA
CCAGAACAAAACCTGTTAATTCAGCTTGACTTCTCATATGTGTTCTGTGTTCAAGCTCCTGTGGGCAACTCAATTGTTTTAAGAAAACTC
TATTTCTGTTCATATTAATTCACTTGCCAGACTCCAATTCTGAAAGTTGTCTAGTTCTTCCTTCATCACACGTGCTTCTCATCGAAACCC
TGGTTTCAGGATGGATCAAGTGCTGTTACAGCTCATGTTCCTTAGACCTGATTTGTTTTGATATTTTACTGCCTTTCCTTTTAATTTTTG
TTTGAATGAGAAAAGTTTAATACAACAGGTGTCCAGAATACTTGCAGTATAAATGAAGATTTGGTTTTTGTATAAAAAAATAATGCTGTT
AAACAGGAGTTGACCTTCATTTAGTTGATGTAATACATAGCTGTATGGGGTTTTTTTTAGTAAGTTCTTTGAGCATAATTCACTTTAAAG
TCATTTTTCCAGCAATGTTTAAATTACTTTCTCATTCTTTTAGTGTATTCAACATTGTCTGCCTCTTCCTGCAGTTGATGTAATTGCTTT
GTTTGCAATAGCACAAGCTGCATTATTCCAGTCAGGACTGTGATAACTTGCTGCCAGCCCCACTCAACTTTCAGTTGGCTCTGTGTCAGT
TTTCCATTCAGTGTTAACTACTTGTTACTGCCATGCTGCTTGCCCTCCCTTGAAGTGTCTATAAGCTCATCACAGCCTAGAGTTAAGTAA
AGTCAATTCACAGAAGCACAATTTTGCCCTTTGCGAGACATTGTTGCCTCTATCTAGTCCTACAAGTAGGGTTTTGCATACTGTGTTTGC
CCCTAGGGTTGTCAGTGCATCAGAAATACTTCTAAATAGTGGTAAAAATGCACATGGTTAATGCACATGTTACTTTTAAATCATTAGGAT
ATCCCTCACCTGTTCCTGATGAATAAAAAGTGTGTTAAAGACCAAAATTCTTGGCATAATAATCAGCTACATACAAATCACATATAGTTT
AATCTTTTTTAATGAAAAAAAATCATGTTTAAAATGGCAAAAGCCCATCTTATACACTTTTATATAGCTGCAAAAAATTTATATCTGTAC
AGATCTAACACTACGACACTCAGTATTCATTTTATTGAAGCATGCAAGTAAAGCACTTTTTCTAATTTATATAGAGGTATCTAATTAACA
CAGCACATTGTACTAATGACTAGGAGTAGCAGCTTTTTCTTCTCTCCCTCTATGAATTCTTATAATGTCCCTTTTTCTGTAAGTTTTTGA
GAGGCAATTGGCAATTTAGGAGGCAGCAGGGTCTGTTTTGGTCAAATCTTGAATTTCGTTGTTGCACTCTAGTGACTGATCTTTGGGAAT
GTCTTGTCTTTGCATGGGGCTCATAGAGATGTGTGCAGACTTGCTTATTGTGGTTAGTGTGTATCAGGAACACACACACAGGTGTTCTGA
CCAGCTCAGGCTTGCCACAGTGAGCAACTCTGTGGCTAGCAAAAGAGAAGTTTATTTGTGCCCAGCCATTGGTCACCTTGGGTGATGCAC
CAGATAGCAGGCAGATGTTGGTTCATTGGCCTTCGTCCTCTTTCCTCCTAAAATAATATTGGCTTTACCATCTTAACTCAGCTGTGGGTT
TTTTGTGGGTTCTTGTTTGTTTTTTGGCATGAATTGTCATCTTTGGTGTTTTTTTAACCCCCAGCCCCTCAAAAAAATAAGGCCTCCAGG
TATCAAGATCTCATATTAGGATTTTCTGTCCTTAATTTTTTGAGCAAAATCTGGAAAATGTGAAAGCATATTTAGATTTTATATACTATC
TGAAATGTGATTTGTTAAGATTCTTAAATTTGGGCCTCTTAGAATAATTTTGAATGAGATCTACCGACTCACTTGTGAGAATATTTTTCA
CAGATTATCTTTGGGCCTTTTCATTAGAAAGCTGTTTGTTTGTCCCCCTGTTGGTACATTTGGTTACCTCATTTTGCCGTTTCAGATTGT
GAAAGCTCACAGGGGTGTTTTTTGGAATCATTTGCTGAGTCATTTTCTCAAATCATATTCCATTGTATCAGTTAACATATAGTTTTAAAT
GTATGTATTATAAATATCTGTAACCAAATCATTTGAAGGCTTGATAAATTTTTAACAAAGTTTGTACATTTTTTATGAAAGTTACTAGTA
ATGCTTTACTAAGTAGTGCAATGAATTTTTATTTTTAATCCCTGTGCCCAATTTTGGAGTTGAGAGGGTTGTTGGTAATAAATGTATGAT

>In-frame_ROCK1_ENST00000399799_chr18_18690779_-_RNF38_ENST00000353739_chr9_36376124_-_5776nt
GCTGGTTCCCCTTCCGAGCGTCCGCGCCCCGCATGCGCAGTCTGCCCCGGCGGTCTCCGTTTGTTTGAACAGGAAGGCGGACATATTAGT
CCCTCTCAGCCCCCCTCGCCCCACCCCCCAGGCATTCGCCGCCGCGACTCGCCCTTTCCCCGGCTGGGACCGCAGCCCCTCCCAGAAGCT
CCCCCATCAGCAGCCGCCGGGACCCAACTATCGTCTTCCTCTTCGCCCGCTCTCCAGCCTTTCCTCTGCTAAGTCTCCATCGGGCATCGA
CCTCGCCCTGCCCCACCGGACACCGTAGCAGCAGCCCCAGCAGCGACGGGACAAAATGGGAGAGTGAGGCTGTCCTGCGTGGACCAGCTC
GTGGCCGAGACTGATCGGTGCGTCGGGCCGGGCCGAGTAGAGCCGGGGACGCGGGGCTAGACCGTCTACAGCGCCTCTGAGCGGAGCGGG
CCCGGCCCGTGGCCCGAGCGGCGGCCGCAGCTGGCACAGCTCCTCACCCGCCCTTTGCTTTCGCCTTTCCTCTTCTCCCTCCCTTGTTGC
CCGGAGGGAGTCTCCACCCTGCTTCTCTTTCTCTACCCGCTCCTGCCCATCTCGGGACGGGGACCCCTCCATGGCGACGGCGGCCGGGGC
CCGCTAGACTGAAGCACCTCGCCGGAGCGACGAGGCTGGTGGCGACGGCGCTGTCGGCTGTCGTGAGGGGCTGCCGGGTGGGATGCGACT
TTGGGCGTCCGAGCGGCTGTGGGTCGCTGTTGCCCCCGGCCCGGGGTCTGGAGAGCGGAGGTCCCCTCAGTGAGGGGAAGACGGGGGAAC
CGGGCGCACCTGGTGACCCTGAGGTTCCGGCTCCTCCGCCCCGCGGCTGCGAACCCACCGCGGAGGAAGTTGGTTGAAATTGCTTTCCGC
TGCTGGTGCTGGTAAGAGGGCATTGTCACAGCAGCAGCAACATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACC
TGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTGCTGAGTGAAGATAGTCCAAGTCCTAAGAGACAGCGCCTCTCTCATTCAG
TCTTTGATTATACATCAGCATCACCAGCTCCCTCACCACCAATGCGACCATGGGAGATGACATCAAATAGGCAGCCCCCTTCAGTTCGAC
CAAGCCAACATCACTTCTCAGGGGAACGATGCAACACACCTGCACGCAACAGAAGAAGTCCTCCTGTCAGGCGCCAGAGAGGAAGAAGGG
ATCGTCTGTCTCGACATAATTCCATTAGTCAAGATGAAAACTATCACCATCTCCCTTACGCACAGCAGCAAGCAATAGAGGAGCCTCGAG
CCTTCCACCCTCCGAATGTATCTCCCCGTCTGCTACATCCTGCTGCTCATCCACCCCAGCAGAATGCAGTCATGGTTGACATACATGATC
AGCTCCATCAAGGAACAGTCCCTGTTTCTTACACAGTAACAACAGTGGCACCACATGGGATTCCACTCTGCACAGGCCAGCACATCCCTG
CTTGTAGTACACAGCAGGTCCCAGGATGCTCTGTGGTTTTCAGTGGACAGCACCTCCCTGTCTGTAGTGTGCCTCCTCCAATGCTTCAGG
CATGTTCAGTTCAGCACTTACCAGTACCATATGCTGCATTCCCACCCCTTATTTCTAGTGATCCATTTCTTATACATCCTCCTCACCTTT
CTCCCCATCATCCTCCTCATTTGCCACCACCAGGCCAGTTTGTCCCTTTCCAAACACAGCAATCACGATCGCCTCTGCAAAGGATAGAAA
ATGAAGTGGAACTCTTAGGAGAACATCTTCCAGTAGGAGGTTTTACTTACCCTCCATCAGCCCACCCCCCAACATTACCTCCATCAGCTC
CCTTGCAGTTCTTAACACATGATCCTTTGCATCAGGAGGTGTCCTTTGGAGTACCTTATCCTCCATTTATGCCTCGGAGGCTTACAGGAC
GTAGTAGATACCGATCCCAGCAGCCAATACCACCTCCCCCTTATCATCCCAGCTTACTGCCATATGTGTTATCAATGCTTCCAGTGCCAC
CTGCAGTGGGCCCAACTTTCAGCTTTGAATTAGATGTAGAAGATGGAGAAGTAGAAAATTACGAGGCCCTGTTAAACCTGGCAGAGCGAC
TGGGAGAGGCAAAGCCTCGTGGACTGACTAAAGCAGATATTGAACAACTTCCTTCTTATCGGTTCAATCCTAACAACCACCAGTCAGAAC
AGACTTTGTGTGTAGTATGCATGTGTGATTTTGAGTCAAGGCAGCTACTTAGAGTCTTACCCTGTAACCACGAGTTCCATGCCAAGTGTG
TTGACAAATGGCTTAAGGCAAATCGTACTTGCCCAATTTGCCGAGCTGATGCTTCAGAAGTGCATCGGGATTCAGAATGACCAACCTAAG
AAGCACAAATTTAGTTTGGGTGTTCCTCATCACATGTATATACGGACTATCCATTGAACTTAATCTGTGTGGCTTCCAGCCCTCCCTTTA
CCAAAAGGGTCAATGGACCTTTCTTTGCACTGTGTGACTTAATCAACTATAAAAGCTTACAATTAGTCTTCACAGTTATGGGATTGTTAT
ACTAACCGTGTGATTGGAACTCCAAAGACTTTTTCTTTAGCTTAATTTTGTGTGTGCACTAACATTCCCTGGTTTTTGTGTGATCATTCC
GAGTGTTGCTGCAAGATTACAGTGGACGTGATCTTTTAGCATGTGCTTTTATAAAAAGTGGTAGCTACAGATGATATAGCAATCTACCTT
ATATAGAGCCTTCAGAAACTGTGAGTGGAAATGAATGCGCAGCGTATGACTGTTGGTGATAAGTGTATCTGTGTGAGTGTGTGCAACTAC
TTGTGTGAGGGCATGGTAGCTAACGTGTGTATGAGATCCTATATACCAGCATGTACCAAGAATGTGTGTGTAGTTTTAATTATGCTGCAA
TGTATAATCTGGTGTGTTATTTAAACAGCACTAGTACTGTACACTGGTTTTTTTCCCTTGTGTTTGCTGTTGCACACTGATTGCTGAGGG
TGCATCAATTACAAGCATTGAATACTCCATCCCCTTCCCTCCCAGTGAATGGAATGAGAAAAGCCTTCTTCCTTTGCTTCAGGCAGCTGT
CACCTTCTCTTTATTGGTGGTCCTAAGTGGGTCACTTAAGAAAAAAAAGTGTAACAAATTCTCGCTCCATGAACCTGGTTTTTTTTTATT
CTGTTGTGGAAATTTTTAAATCTCCAACTTGCTGTTTCCAAAAAGAAGGTGCAATATCATATATCATCAGTTAGCAATATTAGCATTTCA
ATCAGTGATTTGAATGTTGATACTTTTTTTTCCTTTACATTTCCAGTAAGTTTCTTACAGAAAGTACCTGTGATTTTTTTTAATGTTTAG
ATTTGTAGTCTAGTCTATTCTGAAGATATTTGATTAATATATTTCTAAGAAGACCACTAGTCCCATGAAGTCTCACCTTGTTGACTTCCA
CCAGAACAAAACCTGTTAATTCAGCTTGACTTCTCATATGTGTTCTGTGTTCAAGCTCCTGTGGGCAACTCAATTGTTTTAAGAAAACTC
TATTTCTGTTCATATTAATTCACTTGCCAGACTCCAATTCTGAAAGTTGTCTAGTTCTTCCTTCATCACACGTGCTTCTCATCGAAACCC
TGGTTTCAGGATGGATCAAGTGCTGTTACAGCTCATGTTCCTTAGACCTGATTTGTTTTGATATTTTACTGCCTTTCCTTTTAATTTTTG
TTTGAATGAGAAAAGTTTAATACAACAGGTGTCCAGAATACTTGCAGTATAAATGAAGATTTGGTTTTTGTATAAAAAAATAATGCTGTT
AAACAGGAGTTGACCTTCATTTAGTTGATGTAATACATAGCTGTATGGGGTTTTTTTTAGTAAGTTCTTTGAGCATAATTCACTTTAAAG
TCATTTTTCCAGCAATGTTTAAATTACTTTCTCATTCTTTTAGTGTATTCAACATTGTCTGCCTCTTCCTGCAGTTGATGTAATTGCTTT
GTTTGCAATAGCACAAGCTGCATTATTCCAGTCAGGACTGTGATAACTTGCTGCCAGCCCCACTCAACTTTCAGTTGGCTCTGTGTCAGT
TTTCCATTCAGTGTTAACTACTTGTTACTGCCATGCTGCTTGCCCTCCCTTGAAGTGTCTATAAGCTCATCACAGCCTAGAGTTAAGTAA
AGTCAATTCACAGAAGCACAATTTTGCCCTTTGCGAGACATTGTTGCCTCTATCTAGTCCTACAAGTAGGGTTTTGCATACTGTGTTTGC
CCCTAGGGTTGTCAGTGCATCAGAAATACTTCTAAATAGTGGTAAAAATGCACATGGTTAATGCACATGTTACTTTTAAATCATTAGGAT
ATCCCTCACCTGTTCCTGATGAATAAAAAGTGTGTTAAAGACCAAAATTCTTGGCATAATAATCAGCTACATACAAATCACATATAGTTT
AATCTTTTTTAATGAAAAAAAATCATGTTTAAAATGGCAAAAGCCCATCTTATACACTTTTATATAGCTGCAAAAAATTTATATCTGTAC
AGATCTAACACTACGACACTCAGTATTCATTTTATTGAAGCATGCAAGTAAAGCACTTTTTCTAATTTATATAGAGGTATCTAATTAACA
CAGCACATTGTACTAATGACTAGGAGTAGCAGCTTTTTCTTCTCTCCCTCTATGAATTCTTATAATGTCCCTTTTTCTGTAAGTTTTTGA
GAGGCAATTGGCAATTTAGGAGGCAGCAGGGTCTGTTTTGGTCAAATCTTGAATTTCGTTGTTGCACTCTAGTGACTGATCTTTGGGAAT
GTCTTGTCTTTGCATGGGGCTCATAGAGATGTGTGCAGACTTGCTTATTGTGGTTAGTGTGTATCAGGAACACACACACAGGTGTTCTGA
CCAGCTCAGGCTTGCCACAGTGAGCAACTCTGTGGCTAGCAAAAGAGAAGTTTATTTGTGCCCAGCCATTGGTCACCTTGGGTGATGCAC
CAGATAGCAGGCAGATGTTGGTTCATTGGCCTTCGTCCTCTTTCCTCCTAAAATAATATTGGCTTTACCATCTTAACTCAGCTGTGGGTT
TTTTGTGGGTTCTTGTTTGTTTTTTGGCATGAATTGTCATCTTTGGTGTTTTTTTAACCCCCAGCCCCTCAAAAAAATAAGGCCTCCAGG
TATCAAGATCTCATATTAGGATTTTCTGTCCTTAATTTTTTGAGCAAAATCTGGAAAATGTGAAAGCATATTTAGATTTTATATACTATC
TGAAATGTGATTTGTTAAGATTCTTAAATTTGGGCCTCTTAGAATAATTTTGAATGAGATCTACCGACTCACTTGTGAGAATATTTTTCA
CAGATTATCTTTGGGCCTTTTCATTAGAAAGCTGTTTGTTTGTCCCCCTGTTGGTACATTTGGTTACCTCATTTTGCCGTTTCAGATTGT
GAAAGCTCACAGGGGTGTTTTTTGGAATCATTTGCTGAGTCATTTTCTCAAATCATATTCCATTGTATCAGTTAACATATAGTTTTAAAT
GTATGTATTATAAATATCTGTAACCAAATCATTTGAAGGCTTGATAAATTTTTAACAAAGTTTGTACATTTTTTATGAAAGTTACTAGTA
ATGCTTTACTAAGTAGTGCAATGAATTTTTATTTTTAATCCCTGTGCCCAATTTTGGAGTTGAGAGGGTTGTTGGTAATAAATGTATGAT


Top

FusionGenePPI for ROCK1_RNF38


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ROCK1CDC25A, PFN2, RHOA, RND3, GAB1, CFL1, LIMK2, HNRNPA1, ITSN2, ARRB1, TSG101, NOTCH1, SMURF1, SMAD2, CASP3, CASP7, CDK15, ANKFY1, MON2, FAM21A, KIAA1033, IKBKB, LMO2, MAGEB4, POLR3C, C6orf165, FAM124A, NXF1, NTRK1, MED23, XRCC5, NEIL3, TRIM15, HGS, SLC9A1, UBE2T, CDKN3, TENC1, ROCK2, ADD2, IL20RA, CYLDRNF38TP53, TP63, TP73, UBE2D1, UBE2D2, UBE2D3, UBE2D4, UBE2H, ELAVL1, LDB1, RNF114, DZIP3, DTX3, RNF38, ZDHHC17, UBC, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneROCK1chr18:18690779chr9:36376124ENST00000399799-133368_727311355FHOD1
HgeneROCK1chr18:18690779chr9:36390613ENST00000399799-133368_727311355FHOD1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ROCK1_RNF38


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ROCK1_RNF38


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource