FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31686

FusionGeneSummary for ROCK1_LAMA3

check button Fusion gene summary
Fusion gene informationFusion gene name: ROCK1_LAMA3
Fusion gene ID: 31686
HgeneTgene
Gene symbol

ROCK1

LAMA3

Gene ID

6093

3910

Gene nameRho associated coiled-coil containing protein kinase 1laminin subunit alpha 4
SynonymsP160ROCK|ROCK-ICMD1JJ|LAMA3|LAMA4*-1
Cytomap

18q11.1

6q21

Type of geneprotein-codingprotein-coding
Descriptionrho-associated protein kinase 1p160 ROCK-1renal carcinoma antigen NY-REN-35laminin subunit alpha-4laminin alpha 4 chainlaminin, alpha 4
Modification date2018052720180522
UniProtAcc

Q13464

Q16787

Ensembl transtripts involved in fusion geneENST00000399799, ENST00000313654, 
ENST00000399516, ENST00000269217, 
ENST00000587184, ENST00000588770, 
Fusion gene scores* DoF score21 X 11 X 11=25416 X 7 X 4=168
# samples 2310
** MAII scorelog2(23/2541*10)=-3.46569060910898
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/168*10)=-0.748461233004036
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ROCK1 [Title/Abstract] AND LAMA3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneROCK1

GO:0007159

leukocyte cell-cell adhesion

12082081

HgeneROCK1

GO:0022614

membrane to membrane docking

12082081

HgeneROCK1

GO:0032091

negative regulation of protein binding

18573880

HgeneROCK1

GO:0032956

regulation of actin cytoskeleton organization

25911094

HgeneROCK1

GO:0050900

leukocyte migration

12082081

HgeneROCK1

GO:0050901

leukocyte tethering or rolling

12082081


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-CG-4301-01AROCK1chr18

18546878

-LAMA3chr18

21393021

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000399799ENST00000313654ROCK1chr18

18546878

-LAMA3chr18

21393021

+
In-frameENST00000399799ENST00000399516ROCK1chr18

18546878

-LAMA3chr18

21393021

+
5CDS-intronENST00000399799ENST00000269217ROCK1chr18

18546878

-LAMA3chr18

21393021

+
5CDS-intronENST00000399799ENST00000587184ROCK1chr18

18546878

-LAMA3chr18

21393021

+
5CDS-intronENST00000399799ENST00000588770ROCK1chr18

18546878

-LAMA3chr18

21393021

+

Top

FusionProtFeatures for ROCK1_LAMA3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ROCK1

Q13464

LAMA3

Q16787

Protein kinase which is a key regulator of actincytoskeleton and cell polarity. Involved in regulation of smoothmuscle contraction, actin cytoskeleton organization, stress fiberand focal adhesion formation, neurite retraction, cell adhesionand motility via phosphorylation of DAPK3, GFAP, LIMK1, LIMK2,MYL9/MLC2, PFN1 and PPP1R12A. Phosphorylates FHOD1 and actssynergistically with it to promote SRC-dependent non-apoptoticplasma membrane blebbing. Phosphorylates JIP3 and regulates therecruitment of JNK to JIP3 upon UVB-induced stress. Acts as asuppressor of inflammatory cell migration by regulating PTENphosphorylation and stability. Acts as a negative regulator ofVEGF-induced angiogenic endothelial cell activation. Required forcentrosome positioning and centrosome-dependent exit from mitosis.Plays a role in terminal erythroid differentiation. May regulateclosure of the eyelids and ventral body wall by inducing theassembly of actomyosin bundles. Promotes keratinocyte terminaldifferentiation. Involved in osteoblast compaction through thefibronectin fibrillogenesis cell-mediated matrix assembly process,essential for osteoblast mineralization.{ECO:0000269|PubMed:10436159, ECO:0000269|PubMed:10652353,ECO:0000269|PubMed:11018042, ECO:0000269|PubMed:11283607,ECO:0000269|PubMed:17158456, ECO:0000269|PubMed:18573880,ECO:0000269|PubMed:18694941, ECO:0000269|PubMed:19036714,ECO:0000269|PubMed:19131646, ECO:0000269|PubMed:19181962,ECO:0000269|PubMed:19997641, ECO:0000269|PubMed:21072057,ECO:0000269|PubMed:8617235, ECO:0000269|PubMed:9722579}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneROCK1chr18:18546878chr18:21393021ENST00000399799-27331011_110211171355Coiled coilOntology_term=ECO:0000255
HgeneROCK1chr18:18546878chr18:21393021ENST00000399799-2733422_69211171355Coiled coilOntology_term=ECO:0000255
HgeneROCK1chr18:18546878chr18:21393021ENST00000399799-2733636_98011171355Compositional biasNote=Glu-rich
HgeneROCK1chr18:18546878chr18:21393021ENST00000399799-2733341_40911171355DomainNote=AGC-kinase C-terminal
HgeneROCK1chr18:18546878chr18:21393021ENST00000399799-2733479_55611171355DomainREM-1
HgeneROCK1chr18:18546878chr18:21393021ENST00000399799-273376_33811171355DomainProtein kinase
HgeneROCK1chr18:18546878chr18:21393021ENST00000399799-2733949_101511171355DomainRhoBD
HgeneROCK1chr18:18546878chr18:21393021ENST00000399799-273382_9011171355Nucleotide bindingATP
HgeneROCK1chr18:18546878chr18:21393021ENST00000399799-2733998_101011171355RegionNote=RHOA binding
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12751852_19415803334Coiled coilOntology_term=ECO:0000255
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12751987_21695803334Coiled coilOntology_term=ECO:0000255
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12752322_23885803334Coiled coilOntology_term=ECO:0000255
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12741852_19415803278Coiled coilOntology_term=ECO:0000255
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12741987_21695803278Coiled coilOntology_term=ECO:0000255
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12742322_23885803278Coiled coilOntology_term=ECO:0000255
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0371852_194101669Coiled coilOntology_term=ECO:0000255
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0371987_216901669Coiled coilOntology_term=ECO:0000255
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0372322_238801669Coiled coilOntology_term=ECO:0000255
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12751266_13115803334DomainLaminin EGF-like 9
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12751312_13555803334DomainLaminin EGF-like 10
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12751356_14045803334DomainLaminin EGF-like 11
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12751405_14555803334DomainLaminin EGF-like 12
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12751476_16535803334DomainLaminin IV type A
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12751687_17335803334DomainLaminin EGF-like 13
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12751734_17865803334DomainLaminin EGF-like 14
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12751787_18215803334DomainLaminin EGF-like 15%3B truncated
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12752390_25915803334DomainLaminin G-like 1
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12752598_27605803334DomainLaminin G-like 2
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12752767_29275803334DomainLaminin G-like 3
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12752986_31505803334DomainLaminin G-like 4
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12753157_33305803334DomainLaminin G-like 5
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+1275590_6305803334DomainLaminin EGF-like 6
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+1275631_6835803334DomainLaminin EGF-like 7
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+1275684_7285803334DomainLaminin EGF-like 8
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12741266_13115803278DomainLaminin EGF-like 9
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12741312_13555803278DomainLaminin EGF-like 10
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12741356_14045803278DomainLaminin EGF-like 11
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12741405_14555803278DomainLaminin EGF-like 12
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12741476_16535803278DomainLaminin IV type A
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12741687_17335803278DomainLaminin EGF-like 13
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12741734_17865803278DomainLaminin EGF-like 14
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12741787_18215803278DomainLaminin EGF-like 15%3B truncated
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12742390_25915803278DomainLaminin G-like 1
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12742598_27605803278DomainLaminin G-like 2
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12742767_29275803278DomainLaminin G-like 3
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12742986_31505803278DomainLaminin G-like 4
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12743157_33305803278DomainLaminin G-like 5
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+1274590_6305803278DomainLaminin EGF-like 6
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+1274631_6835803278DomainLaminin EGF-like 7
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+1274684_7285803278DomainLaminin EGF-like 8
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0371266_131101669DomainLaminin EGF-like 9
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0371312_135501669DomainLaminin EGF-like 10
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0371356_140401669DomainLaminin EGF-like 11
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0371405_145501669DomainLaminin EGF-like 12
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0371476_165301669DomainLaminin IV type A
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0371687_173301669DomainLaminin EGF-like 13
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0371734_178601669DomainLaminin EGF-like 14
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0371787_182101669DomainLaminin EGF-like 15%3B truncated
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0372390_259101669DomainLaminin G-like 1
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0372598_276001669DomainLaminin G-like 2
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0372767_292701669DomainLaminin G-like 3
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0372986_315001669DomainLaminin G-like 4
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+037299_35501669DomainLaminin EGF-like 1
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0373157_333001669DomainLaminin G-like 5
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+037356_42501669DomainLaminin EGF-like 2
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+037426_46901669DomainLaminin EGF-like 3
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+03743_29801669DomainLaminin N-terminal
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+037491_53501669DomainLaminin EGF-like 4
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+037536_58801669DomainLaminin EGF-like 5
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+037590_63001669DomainLaminin EGF-like 6
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+037631_68301669DomainLaminin EGF-like 7
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+037684_72801669DomainLaminin EGF-like 8
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12752278_22805803334MotifCell attachment site
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12742278_22805803278MotifCell attachment site
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0372278_228001669MotifCell attachment site
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12751266_14655803334RegionNote=Domain III B
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12751654_18215803334RegionNote=Domain III A
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+12751822_23895803334RegionNote=Domain II and I
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+1275796_12655803334RegionNote=Domain IV 1 (domain IV B)
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12741266_14655803278RegionNote=Domain III B
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12741654_18215803278RegionNote=Domain III A
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+12741822_23895803278RegionNote=Domain II and I
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+1274796_12655803278RegionNote=Domain IV 1 (domain IV B)
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0371266_146501669RegionNote=Domain III B
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0371654_182101669RegionNote=Domain III A
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+0371822_238901669RegionNote=Domain II and I
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+037298_72801669RegionNote=Domain V
TgeneLAMA3chr18:18546878chr18:21393021ENST00000587184+037796_126501669RegionNote=Domain IV 1 (domain IV B)

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneROCK1chr18:18546878chr18:21393021ENST00000399799-27331118_131711171355DomainPH
HgeneROCK1chr18:18546878chr18:21393021ENST00000399799-27331115_135411171355RegionNote=Auto-inhibitory
HgeneROCK1chr18:18546878chr18:21393021ENST00000399799-27331228_128111171355Zinc fingerPhorbol-ester/DAG-type
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+1275299_3555803334DomainLaminin EGF-like 1
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+1275356_4255803334DomainLaminin EGF-like 2
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+1275426_4695803334DomainLaminin EGF-like 3
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+127543_2985803334DomainLaminin N-terminal
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+1275491_5355803334DomainLaminin EGF-like 4
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+1275536_5885803334DomainLaminin EGF-like 5
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+1274299_3555803278DomainLaminin EGF-like 1
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+1274356_4255803278DomainLaminin EGF-like 2
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+1274426_4695803278DomainLaminin EGF-like 3
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+127443_2985803278DomainLaminin N-terminal
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+1274491_5355803278DomainLaminin EGF-like 4
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+1274536_5885803278DomainLaminin EGF-like 5
TgeneLAMA3chr18:18546878chr18:21393021ENST00000313654+1275298_7285803334RegionNote=Domain V
TgeneLAMA3chr18:18546878chr18:21393021ENST00000399516+1274298_7285803278RegionNote=Domain V


Top

FusionGeneSequence for ROCK1_LAMA3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ROCK1_ENST00000399799_chr18_18546878_-_LAMA3_ENST00000313654_chr18_21393021_+_3871aa
MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVTDLDFPALRKNKNIDNFLSRTKDTINKIRDLRMKAEDTEVVKVIGRGAFGEV
QLVRHKSTRKVTAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFTAFQDDRTLYMVMEYMPGGDLVNLMSNTDVPEKWARFTTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDTISPEVLKSQGGDGTTGRECDWWSVGVFLYE
MLVGDTPFTADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTTTSNRRYLSSANPNDNRTSSNADKSLQESLQKTITKLEEQLHNEMQLKDEME
QKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTDKDTYQLQAILEAERRDRGHDSEMIGDLQAR
ITSLQEEVKHLKHNLEKVEGERKEAQDMLNHSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTGNKERMEDEVKNLTLQLEQESNKRLLLQNELKTQAFEADNLKGLEKQMKQE
INTLLEAKRLLEFELAQLTKQTRGNEGQMRELQDQLEAEQTFSTLTKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQTFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENEELTEKMKKAEEETKLEKEEEISNLKAAFEK
NINTERTLKTQAVNKLAEIMNRKDFKIDRKKANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECAHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPGSSSACDPAGTINSNLGTCQCKLHVEGPTCSRCKLLTWNLDKENPSGCSECKC
HKAGTVSGTGECRQGDGDCHCKSHVGGDSCDTCEDGTFALEKSNYFGCQGCQCDIGGALSSMCSGPSGVCQCREHVVGKVCQRPENNYTF
PDLHHMKTEIEDGSTPNGRDLRFGFDPLAFPEFSWRGTAQMTSVQNDVRITLNVGKSSGSLFRVILRYVNPGTEAVSGHITITPSWGAAQ
SKEIIFLPSKEPAFVTVPGNGFADPFSITPGIWVACIKAEGVLLDYLVLLPRDYTEASVLQLPVTEPCAYAGPPQENCLLYQHLPVTRFP
CTLACEARHFLLDGEPRPVAVRQPTPAHPVMVDLSGREVELHLRLRIPQVGHYVVVVETSTEAAQLFVVDVNVKSSGSVLAGQVNIYSCN
YSVLCRSAVIDHMSRIAMTELLADADIQLKGHMARFLLHQVCIIPIEEFSAETVRPQVHCIASTGRFVNQSATCVSLAHETPPTALILDV
LSGRPFPHLPQQSSPSVDVLPGVTLKAPQNQVTLRGRVPHLGRYVFVIHFYQAAHPTFPAQVSVDGGWPRAGSFHASFCPHVLGCRDQVI
AEGQIEFDISEPEVAATVKVPEGKSLVLVRVLVVPAENTDYQILHKKSMDKSLEFITNCGKNSFYLDPQTASRFCKNSARSLVAFYHKGA
LPCECHPTGATGPHCSPEGGQCPCQPNVIGRQCTRCATGHYGFPRCKPCSCGRRLCEEMTGQCRCPPRTVRPQCEVCETHSFSFHPMAGC
EGCNCSRRGTIEAAMPECDRDSGQCRCKPRITGRQCDRCASGFYRFPECVPCNCNRDGTEPGVCDPGTGACLCKENVEGTECNVCREGSF
HLDPANLKGCTSCFCFGVNNQCHSSHKRRTKFVDMLGWHLETADRVDIPVSFNPGSNSMVADLQELPATIHSASWVAPTSYLGDKVSSTG
GYLTYQAKSFGLPGDMVLLEKKPDVQLTGQHMSIITEETNTPRPDRLHHGRVHVVEGNFRHASSRAPVSREELMTVLSRLADVRIQGLYF
TETQRLTLSEVGLEEASDTGSGRIALAVEICACPPAYAGDSCQGCSPGYTRDHKGLTTGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGE
HCERCQEGYTGNAVHGSCRACPCPHTNSFATGCVVNGGDVRCSCKAGYTGTQCERCAPGTFGNPQKFGGSCQPCSCNSNGQLGSCHPLTG
DCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQGLSASAGLLEQMRHMETQAKDLRNQLLNYRSAISNHGSKIEGLER
ELTDLNQEFETLQEKAQVNSRKAQTLNNNVNRATQSAKELDVKIKNVIRNVHILLKQISGTDGEGNNVPSGDFSREWAEAQRMMRELRNR
NFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEI
NSLQSDFTKTLTTADSSLLQTNIALQLMEKSQKETEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHARSLQELAKQLEEIKRNA
SGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIKEDLPRKAKTLSSNSDKLLNEAKMTQKKLKQEVSPALNNLQQTLN
IVTVQKEVIDTNLTTLRDGLHGIQRGDIDAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTTGRTQNEDFKKALTDADNSVNKLT
NKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAVPMRFNGKSGVEVRLPNDLEDLKGTTSLSLFLQRPNSRENGGTEN
MFVMYLGNKDASRDYIGMAVVDGQLTCVYNLGDREAELQVDQILTKSETKEAVMDRVKFQRITQFARLNYTKGATSSKPETPGVTDMDGR
NSNTLLNLDPENVVFTVGGYPPDFKLPSRLSFPPYKGCIELDDLNENVLSLYNFKKTFNLNTTEVEPCRRRKEESDKNTFEGTGTARVPT
QPHAPIPTFGQTIQTTVDRGLLFFAENGDRFISLNIEDGKLMVRYKLNSELPKERGVGDAINNGRDHSIQIKIGKLQKRMWINVDVQNTI
IDGEVFDFSTTTLGGIPIAIRERFNISTPAFRGCMKNLKKTSGVVRLNDTVGVTKKCSEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQA
SFGFQTFQPSGILLDHQTWTRNLQVTLEDGYIELSTSDSGSPIFKSPQTTMDGLLHTVSVISDNSGLRLLIDDQLLRNSKRLKHISSSRQ
SLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSLGGCSLNKPPFLMLLKGSTRFNKTKTFRINQLLQDTPVASPRSVKVWQDA
CSPLPKTQANHGALQFGDIPTSHLLFKLPQELLKPRSQFAVDMQTTSSRGLVFHTGTKNSFMALTLSKGRLVFALGTDGKKLRIKSKEKC
NDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTISIRAPVYLGSPPSGKPKSLPTNSFVGCLKNFQLDSKPLTTPSSSFGVSSCLGG
PLEKGITFSEEGGHVVLAHSVLLGPEFKLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAGGTSTSVTPKQSLCDGQWHS
VAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLTTLRIPVWKSFFGCLRNIHVNHIPVPVTEALEVQGPVSLNGCPDQ

>In-frame_ROCK1_ENST00000399799_chr18_18546878_-_LAMA3_ENST00000399516_chr18_21393021_+_3815aa
MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVTDLDFPALRKNKNIDNFLSRTKDTINKIRDLRMKAEDTEVVKVIGRGAFGEV
QLVRHKSTRKVTAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFTAFQDDRTLYMVMEYMPGGDLVNLMSNTDVPEKWARFTTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDTISPEVLKSQGGDGTTGRECDWWSVGVFLYE
MLVGDTPFTADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTTTSNRRYLSSANPNDNRTSSNADKSLQESLQKTITKLEEQLHNEMQLKDEME
QKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTDKDTYQLQAILEAERRDRGHDSEMIGDLQAR
ITSLQEEVKHLKHNLEKVEGERKEAQDMLNHSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTGNKERMEDEVKNLTLQLEQESNKRLLLQNELKTQAFEADNLKGLEKQMKQE
INTLLEAKRLLEFELAQLTKQTRGNEGQMRELQDQLEAEQTFSTLTKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQTFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENEELTEKMKKAEEETKLEKEEEISNLKAAFEK
NINTERTLKTQAVNKLAEIMNRKDFKIDRKKANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECAHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPGSSSACDPAGTINSNLGTCQCKLHVEGPTCSRCKLLTWNLDKENPSGCSECKC
HKAGTVSGTGECRQGDGDCHCKSHVGGDSCDTCEDGTFALEKSNYFGCQGCQCDIGGALSSMCSGPSGVCQCREHVVGKVCQRPENNYTF
PDLHHMKTEIEDGSTPNGRDLRFGFDPLAFPEFSWRGTAQMTSVQNDVRITLNVGKSSGSLFRVILRYVNPGTEAVSGHITITPSWGAAQ
SKEIIFLPSKEPAFVTVPGNGFADPFSITPGIWVACIKAEGVLLDYLVLLPRDYTEASVLQLPVTEPCAYAGPPQENCLLYQHLPVTRFP
CTLACEARHFLLDGEPRPVAVRQPTPAHPVMVDLSGREVELHLRLRIPQVGHYVVVVETSTEAAQLFVVDVNVKSSGSVLAGQVNIYSCN
YSVLCRSAVIDHMSRIAMTELLADADIQLKGHMARFLLHQVCIIPIEEFSAETVRPQVHCIASTGRFVNQSATCVSLAHETPPTALILDV
LSGRPFPHLPQQSSPSVDVLPGVTLKAPQNQVTLRGRVPHLGRYVFVIHFYQAAHPTFPAQVSVDGGWPRAGSFHASFCPHVLGCRDQVI
AEGQIEFDISEPEVAATVKVPEGKSLVLVRVLVVPAENTDYQILHKKSMDKSLEFITNCGKNSFYLDPQTASRFCKNSARSLVAFYHKGA
LPCECHPTGATGPHCSPEGGQCPCQPNVIGRQCTRCATGHYGFPRCKPCSCGRRLCEEMTGQCRCPPRTVRPQCEVCETHSFSFHPMAGC
EGCNCSRRGTIEAAMPECDRDSGQCRCKPRITGRQCDRCASGFYRFPECVPCNCNRDGTEPGVCDPGTGACLCKENVEGTECNVCREGSF
HLDPANLKGCTSCFCFGVNNQCHSSHKRRTKFVDMLGWHLETADRVDIPVSFNPGSNSMVADLQELPATIHSASWVAPTSYLGDKVSSTG
GYLTYQAKSFGLPGDMVLLEKKPDVQLTGQHMSIITEETNTPRPDRLHHGRVHVVEGNFRHASSRAPVSREELMTVLSRLADVRIQGLYF
TETQRLTLSEVGLEEASDTGSGRIALAVEICACPPAYAGDSCQGCSPGYTRDHKGLTTGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGE
HCERCQEGYTGNAVHGSCRACPCPHTNSFATGCVVNGGDVRCSCKAGYTGTQCERCAPGTFGNPQKFGGSCQPCSCNSNGQLGSCHPLTG
DCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQGLSASAGLLEQMRHMETQAKDLRNQLLNYRSAISNHGSKIEGLER
ELTDLNQEFETLQEKAQVNSRKAQTLNNNVNRATQSAKELDVKIKNVIRNVHMLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLR
ARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKTLTTADSSLLQTNIALQLMEKSQKETEKLAASLNEARQELSDKVREL
SRSAGKTSLVEEAEKHARSLQELAKQLEEIKRNASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIKEDLPRKAKTL
SSNSDKLLNEAKMTQKKLKQEVSPALNNLQQTLNIVTVQKEVIDTNLTTLRDGLHGIQRGDIDAMISSAKSMVRKANDITDEVLDGLNPI
QTDVERIKDTTGRTQNEDFKKALTDADNSVNKLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAVPMRFNGKSGV
EVRLPNDLEDLKGTTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYIGMAVVDGQLTCVYNLGDREAELQVDQILTKSETKEAVMDR
VKFQRITQFARLNYTKGATSSKPETPGVTDMDGRNSNTLLNLDPENVVFTVGGYPPDFKLPSRLSFPPYKGCIELDDLNENVLSLYNFKK
TFNLNTTEVEPCRRRKEESDKNTFEGTGTARVPTQPHAPIPTFGQTIQTTVDRGLLFFAENGDRFISLNIEDGKLMVRYKLNSELPKERG
VGDAINNGRDHSIQIKIGKLQKRMWINVDVQNTIIDGEVFDFSTTTLGGIPIAIRERFNISTPAFRGCMKNLKKTSGVVRLNDTVGVTKK
CSEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQASFGFQTFQPSGILLDHQTWTRNLQVTLEDGYIELSTSDSGSPIFKSPQTTMDGLLH
TVSVISDNSGLRLLIDDQLLRNSKRLKHISSSRQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSLGGCSLNKPPFLMLLK
GSTRFNKTKTFRINQLLQDTPVASPRSVKVWQDACSPLPKTQANHGALQFGDIPTSHLLFKLPQELLKPRSQFAVDMQTTSSRGLVFHTG
TKNSFMALTLSKGRLVFALGTDGKKLRIKSKEKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTISIRAPVYLGSPPSGKPKSL
PTNSFVGCLKNFQLDSKPLTTPSSSFGVSSCLGGPLEKGITFSEEGGHVVLAHSVLLGPEFKLVFSIRPRSLTGILIHIGSQPGKHLCVY
LEAGKVTASMDSGAGGTSTSVTPKQSLCDGQWHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLTTLRIPVWKSF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ROCK1_ENST00000399799_chr18_18546878_-_LAMA3_ENST00000313654_chr18_21393021_+_11613nt
ATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACCTGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTG
CTGGATGGATTGGATGCTTTGGTATATGATTTGGATTTTCCTGCCTTAAGAAAAAACAAAAATATTGACAACTTTTTAAGCAGATATAAA
GACACAATAAATAAAATCAGAGATTTACGAATGAAAGCTGAAGATTATGAAGTAGTGAAGGTGATTGGTAGAGGTGCATTTGGAGAAGTT
CAATTGGTAAGGCATAAATCCACCAGGAAGGTATATGCTATGAAGCTTCTCAGCAAATTTGAAATGATAAAGAGATCTGATTCTGCTTTT
TTCTGGGAAGAAAGGGACATCATGGCTTTTGCCAACAGTCCTTGGGTTGTTCAGCTTTTTTATGCATTCCAAGATGATCGTTATCTCTAC
ATGGTGATGGAATACATGCCTGGTGGAGATCTTGTAAACTTAATGAGCAACTATGATGTGCCTGAAAAATGGGCACGATTCTATACTGCA
GAAGTAGTTCTTGCATTGGATGCAATCCATTCCATGGGTTTTATTCACAGAGATGTGAAGCCTGATAACATGCTGCTGGATAAATCTGGA
CATTTGAAGTTAGCAGATTTTGGTACTTGTATGAAGATGAATAAGGAAGGCATGGTACGATGTGATACAGCGGTTGGAACACCTGATTAT
ATTTCCCCTGAAGTATTAAAATCCCAAGGTGGTGATGGTTATTATGGAAGAGAATGTGACTGGTGGTCGGTTGGGGTATTTTTATACGAA
ATGCTTGTAGGTGATACACCTTTTTATGCAGATTCTTTGGTTGGAACTTACAGTAAAATTATGAACCATAAAAATTCACTTACCTTTCCT
GATGATAATGACATATCAAAAGAAGCAAAAAACCTTATTTGTGCCTTCCTTACTGACAGGGAAGTGAGGTTAGGGCGAAATGGTGTAGAA
GAAATCAAACGACATCTCTTCTTCAAAAATGACCAGTGGGCTTGGGAAACGCTCCGAGACACTGTAGCACCAGTTGTACCCGATTTAAGT
AGTGACATTGATACTAGTAATTTTGATGACTTGGAAGAAGATAAAGGAGAGGAAGAAACATTCCCTATTCCTAAAGCTTTCGTTGGCAAT
CAACTACCTTTTGTAGGATTTACATATTATAGCAATCGTAGATACTTATCTTCAGCAAATCCTAATGATAACAGAACTAGCTCCAATGCA
GATAAAAGCTTGCAGGAAAGTTTGCAAAAAACAATCTATAAGCTGGAAGAACAGCTGCATAATGAAATGCAGTTAAAAGATGAAATGGAG
CAGAAGTGCAGAACCTCAAACATAAAACTAGACAAGATAATGAAAGAATTGGATGAAGAGGGAAATCAAAGAAGAAATCTAGAATCTACA
GTGTCTCAGATTGAGAAGGAGAAAATGTTGCTACAGCATAGAATTAATGAGTACCAAAGAAAAGCTGAACAGGAAAATGAGAAGAGAAGA
AATGTAGAAAATGAAGTTTCTACATTAAAGGATCAGTTGGAAGACTTAAAGAAAGTCAGTCAGAATTCACAGCTTGCTAATGAGAAGCTG
TCCCAGTTACAAAAGCAGCTAGAAGAAGCCAATGACTTACTTAGGACAGAATCGGACACAGCTGTAAGATTGAGGAAGAGTCACACAGAG
ATGAGCAAGTCAATTAGTCAGTTAGAGTCCCTGAACAGAGAGTTGCAAGAGAGAAATCGAATTTTAGAGAATTCTAAGTCACAAACAGAC
AAAGATTATTACCAGCTGCAAGCTATATTAGAAGCTGAACGAAGAGACAGAGGTCATGATTCTGAGATGATTGGAGACCTTCAAGCTCGA
ATTACATCTTTACAAGAGGAGGTGAAGCATCTCAAACATAATCTCGAAAAAGTGGAAGGAGAAAGAAAAGAGGCTCAAGACATGCTTAAT
CACTCAGAAAAGGAAAAGAATAATTTAGAGATAGATTTAAACTACAAACTTAAATCATTACAACAACGGTTAGAACAAGAGGTAAATGAA
CACAAAGTAACCAAAGCTCGTTTAACTGACAAACATCAATCTATTGAAGAGGCAAAGTCTGTGGCAATGTGTGAGATGGAAAAAAAGCTG
AAAGAAGAAAGAGAAGCTCGAGAGAAGGCTGAAAATCGGGTTGTTCAGATTGAGAAACAGTGTTCCATGCTAGACGTTGATCTGAAGCAA
TCTCAGCAGAAACTAGAACATTTGACTGGAAATAAAGAAAGGATGGAGGATGAAGTTAAGAATCTAACCCTGCAACTGGAGCAGGAATCA
AATAAGCGGCTGTTGTTACAAAATGAATTGAAGACTCAAGCATTTGAGGCAGACAATTTAAAAGGTTTAGAAAAGCAGATGAAACAGGAA
ATAAATACTTTATTGGAAGCAAAGAGATTATTAGAATTTGAGTTAGCTCAGCTTACGAAACAGTATAGAGGAAATGAAGGACAGATGCGG
GAGCTACAAGATCAGCTTGAAGCTGAGCAATATTTCTCGACACTTTATAAAACCCAGGTAAAGGAACTTAAAGAAGAAATTGAAGAAAAA
AACAGAGAAAATTTAAAGAAAATACAGGAACTACAAAATGAAAAAGAAACTCTTGCTACTCAGTTGGATCTAGCAGAAACAAAAGCTGAG
TCTGAGCAGTTGGCGCGAGGCCTTCTGGAAGAACAGTATTTTGAATTGACGCAAGAAAGCAAGAAAGCTGCTTCAAGAAATAGACAAGAG
ATTACAGATAAAGATCACACTGTTAGTCGGCTTGAAGAAGCAAACAGCATGCTAACCAAAGATATTGAAATATTAAGAAGAGAGAATGAA
GAGCTAACAGAGAAAATGAAGAAGGCAGAGGAAGAATATAAACTGGAGAAGGAGGAGGAGATCAGTAATCTTAAGGCTGCCTTTGAAAAG
AATATCAACACTGAACGAACCCTTAAAACACAGGCTGTTAACAAATTGGCAGAAATAATGAATCGAAAAGATTTTAAAATTGATAGAAAG
AAAGCTAATACACAAGATTTGAGAAAGAAAGAAAAGGAAAATCGAAAGCTGCAACTGGAACTCAACCAAGAAAGAGAGAAATTCAACCAG
ATGGTAGTGAAACATCAGAAGGAACTGAATGACATGCAAGCGCAATTGGTAGAAGAATGTGCACATAGGAATGAGCTTCAGATGCAGTTG
GCCAGCAAAGAGAGTGATATTGAGCAATTGCGTGCTAAACTTTTGGACCTCTCGGATTCTACAAGTGTTGCTAGTTTTCCTAGTGCTGAT
GAAACTGATGGTAACCTCCCAGGTTCCAGCAGTGCTTGTGACCCAGCTGGTACCATCAACTCCAATTTGGGGTATTGCCAATGCAAGCTT
CATGTTGAAGGTCCTACTTGTAGCCGCTGCAAACTGTTATATTGGAATCTGGACAAAGAAAACCCCAGTGGATGTTCAGAATGCAAGTGC
CATAAGGCGGGAACAGTGAGTGGAACTGGAGAGTGTAGGCAGGGAGATGGTGACTGTCACTGCAAGTCCCATGTGGGTGGCGATTCCTGC
GACACCTGTGAAGATGGATATTTTGCTTTGGAAAAGAGCAATTACTTTGGGTGTCAAGGGTGTCAGTGTGACATTGGTGGGGCATTGTCC
TCCATGTGCAGTGGGCCCTCGGGAGTGTGCCAGTGCCGAGAGCATGTCGTGGGAAAGGTGTGCCAGCGGCCTGAAAACAACTACTATTTC
CCAGATTTGCATCATATGAAGTATGAGATTGAAGACGGCAGCACACCTAATGGGAGAGACCTTCGATTTGGATTTGATCCGCTGGCATTT
CCTGAGTTTAGCTGGAGAGGATATGCCCAAATGACCTCAGTACAGAATGATGTAAGAATAACATTGAATGTAGGGAAGTCAAGTGGCTCC
TTGTTTCGTGTTATTCTGAGATACGTTAACCCTGGAACTGAAGCAGTATCTGGCCATATAACTATTTATCCATCCTGGGGTGCTGCTCAA
AGCAAAGAGATCATCTTCCTGCCGAGTAAGGAGCCAGCCTTTGTCACTGTCCCTGGAAATGGTTTTGCAGACCCATTTTCAATCACACCA
GGAATATGGGTTGCTTGTATTAAGGCAGAAGGAGTCCTTCTGGATTACCTGGTGCTGCTCCCCAGGGACTACTATGAAGCCTCTGTACTG
CAGCTGCCAGTCACAGAACCATGTGCCTACGCAGGACCTCCCCAAGAAAATTGCTTACTCTACCAGCATTTGCCAGTGACCAGATTCCCC
TGTACCCTGGCTTGTGAGGCCAGACACTTCCTGCTTGATGGGGAGCCAAGACCCGTGGCAGTGAGGCAGCCCACACCTGCACACCCTGTC
ATGGTGGACCTCAGCGGGAGAGAGGTGGAATTGCATCTGCGGCTGCGCATCCCACAGGTTGGCCACTACGTGGTTGTGGTCGAGTATTCC
ACGGAGGCAGCTCAGCTGTTTGTGGTTGATGTGAATGTGAAGAGCTCCGGGTCTGTTCTGGCAGGCCAGGTGAACATTTACAGCTGCAAC
TACAGTGTTCTCTGCCGGAGTGCTGTGATTGATCACATGAGCCGCATCGCCATGTATGAGCTATTGGCAGATGCAGACATTCAGCTCAAG
GGACACATGGCCCGATTCCTTCTGCATCAAGTTTGTATCATACCTATTGAAGAATTCTCAGCTGAGTATGTGAGACCACAAGTCCACTGC
ATTGCCAGTTATGGGCGATTTGTCAATCAAAGTGCCACCTGTGTCTCCTTGGCCCATGAAACTCCTCCAACAGCATTAATTTTGGATGTT
CTAAGTGGCAGGCCTTTCCCTCACCTGCCCCAGCAGTCGTCACCTTCTGTTGATGTTCTTCCTGGGGTCACCTTGAAGGCACCGCAGAAT
CAAGTGACCCTGAGAGGACGTGTACCACACCTGGGCCGATACGTCTTTGTCATCCATTTTTACCAAGCAGCGCACCCGACGTTTCCCGCG
CAGGTGTCGGTGGATGGCGGGTGGCCACGGGCAGGCTCCTTCCATGCCTCTTTTTGCCCCCATGTGCTTGGCTGCCGGGATCAAGTGATT
GCCGAAGGCCAGATTGAGTTTGACATCTCAGAGCCTGAAGTGGCCGCAACTGTGAAGGTTCCAGAAGGAAAGTCCTTGGTTTTGGTCCGT
GTTCTAGTGGTGCCTGCAGAAAACTATGACTACCAAATACTTCACAAAAAATCCATGGACAAGTCACTCGAGTTTATCACCAATTGTGGA
AAAAACAGCTTTTACCTTGACCCCCAGACAGCCTCCAGATTCTGTAAGAATTCCGCCAGGTCCCTGGTGGCCTTTTACCACAAGGGCGCC
CTGCCTTGTGAGTGCCACCCCACTGGGGCCACCGGCCCTCACTGCAGCCCTGAGGGTGGGCAGTGCCCATGCCAGCCCAACGTCATCGGG
CGGCAGTGCACCCGCTGTGCAACAGGCCACTACGGATTCCCACGCTGCAAGCCGTGCAGCTGTGGTCGGCGCCTTTGTGAAGAGATGACG
GGGCAGTGCCGCTGCCCTCCCCGCACGGTCAGGCCCCAGTGTGAGGTGTGTGAGACACACTCATTCAGCTTCCACCCCATGGCCGGCTGC
GAAGGCTGCAACTGTTCCAGGAGGGGCACCATCGAGGCTGCCATGCCGGAGTGTGACCGGGACAGCGGGCAGTGCAGATGCAAGCCCAGA
ATCACAGGGCGGCAGTGTGACCGATGTGCTTCCGGGTTTTACCGCTTTCCTGAGTGTGTTCCCTGCAATTGCAACAGAGATGGGACTGAG
CCAGGAGTGTGTGACCCAGGGACCGGGGCTTGCCTCTGCAAGGAAAATGTAGAAGGCACAGAGTGTAATGTGTGTCGAGAAGGCTCATTC
CATTTGGACCCAGCCAATCTCAAGGGTTGTACCAGCTGTTTCTGTTTTGGAGTAAATAATCAATGTCACAGCTCACATAAGCGAAGGACT
AAGTTTGTGGATATGCTGGGCTGGCACCTGGAGACAGCAGACAGAGTGGACATCCCTGTCTCTTTCAACCCAGGCAGCAACAGTATGGTG
GCGGATCTCCAGGAGCTGCCCGCAACCATCCACAGCGCGTCCTGGGTCGCACCCACCTCCTACCTGGGGGACAAGGTTTCTTCATATGGT
GGTTACCTCACTTACCAAGCCAAGTCCTTTGGCTTGCCTGGCGACATGGTTCTTCTGGAAAAGAAGCCGGATGTACAGCTCACTGGTCAG
CACATGTCCATCATCTATGAGGAGACAAACACCCCACGGCCAGACCGGCTGCATCATGGACGAGTGCACGTGGTCGAGGGAAACTTCAGA
CATGCCAGCAGCCGTGCCCCAGTGTCTAGGGAGGAGCTGATGACAGTGCTGTCTAGACTGGCAGATGTGCGCATCCAAGGCCTCTACTTC
ACAGAGACTCAAAGGCTCACCCTGAGCGAGGTGGGGCTAGAGGAAGCCTCTGACACAGGAAGTGGGCGCATAGCACTTGCTGTGGAAATC
TGTGCCTGCCCCCCTGCCTACGCTGGTGACTCTTGTCAGGGTTGTAGCCCTGGATACTATCGGGATCATAAAGGCTTGTATACCGGACGG
TGTGTTCCCTGCAATTGCAACGGACATTCAAATCAATGCCAGGATGGCTCAGGCATATGTGTTAACTGTCAGCACAACACCGCGGGAGAG
CACTGTGAACGCTGCCAGGAGGGCTACTATGGCAACGCCGTCCACGGATCCTGCAGGGCCTGCCCATGTCCTCACACTAACAGCTTTGCC
ACTGGCTGTGTGGTGAATGGGGGAGACGTGCGGTGCTCCTGCAAAGCTGGGTACACAGGAACACAGTGTGAAAGGTGTGCACCGGGATAT
TTCGGGAATCCCCAGAAATTCGGAGGTAGCTGCCAACCATGCAGTTGTAACAGCAATGGCCAGCTGGGCAGCTGTCATCCCCTGACTGGA
GACTGCATAAACCAAGAACCCAAAGATAGCAGCCCTGCAGAAGAATGTGATGATTGCGACAGCTGTGTGATGACCCTCCTGAACGACCTG
GCCACCATGGGCGAGCAGCTCCGCCTGGTCAAGTCTCAGCTGCAGGGCCTGAGTGCCAGCGCAGGGCTTCTGGAGCAGATGAGGCACATG
GAGACCCAGGCCAAGGACCTGAGGAATCAGTTGCTCAACTACCGTTCTGCCATTTCAAATCATGGATCAAAAATAGAAGGCCTGGAAAGA
GAACTGACTGATTTGAATCAAGAATTTGAGACTTTGCAAGAAAAGGCTCAAGTAAATTCCAGAAAAGCACAAACATTAAACAACAATGTT
AATCGGGCAACACAAAGCGCAAAAGAACTGGATGTGAAGATTAAAAATGTCATCCGGAATGTGCACATTCTTTTAAAGCAGATCTCTGGG
ACAGATGGAGAGGGAAACAACGTGCCTTCAGGTGACTTTTCCAGAGAGTGGGCTGAAGCCCAGCGCATGATGAGGGAACTGCGGAACAGG
AACTTTGGAAAGCACCTCAGAGAAGCAGAAGCTGATAAAAGGGAGTCGCAGCTCTTGCTGAACCGGATAAGGACCTGGCAGAAAACCCAC
CAGGGGGAGAACAATGGGCTTGCTAACAGTATCCGGGATTCTTTAAATGAATACGAAGCCAAACTCAGTGACCTTCGTGCTCGGCTGCAG
GAGGCAGCTGCCCAAGCCAAGCAGGCAAATGGCTTGAACCAAGAAAACGAGAGAGCTTTGGGAGCCATTCAGAGACAAGTGAAAGAAATA
AATTCCCTGCAGAGTGATTTCACCAAGTATCTAACCACTGCAGACTCATCTTTGTTGCAAACCAACATTGCGCTGCAGCTGATGGAGAAA
AGCCAGAAGGAATATGAAAAATTAGCTGCCAGTTTAAATGAAGCAAGACAAGAACTAAGTGACAAAGTAAGAGAACTTTCCAGATCTGCT
GGCAAAACATCCCTTGTGGAGGAGGCAGAAAAGCACGCGCGGTCCTTACAAGAGCTGGCAAAGCAGCTGGAAGAGATCAAGAGAAACGCC
AGCGGGGATGAGCTGGTGCGCTGTGCTGTGGATGCCGCCACCGCCTACGAGAACATCCTCAATGCCATCAAAGCGGCCGAGGACGCAGCC
AACAGGGCTGCCAGTGCATCTGAATCTGCCCTCCAGACAGTGATAAAGGAAGATCTGCCAAGAAAAGCTAAAACCCTGAGTTCCAACAGT
GATAAACTGTTAAATGAAGCCAAGATGACACAAAAGAAGCTAAAGCAAGAAGTCAGTCCAGCTCTCAACAACCTACAGCAAACCCTGAAT
ATTGTGACAGTTCAGAAAGAAGTGATAGACACCAATCTCACAACTCTCCGAGATGGTCTTCATGGGATACAGAGAGGTGATATTGATGCT
ATGATCAGTAGTGCAAAGAGCATGGTCAGAAAGGCCAACGACATCACAGATGAGGTTCTGGATGGGCTCAACCCCATCCAGACAGATGTG
GAAAGAATTAAGGACACCTATGGGAGGACACAGAACGAAGACTTCAAAAAGGCTCTGACTGATGCAGATAACTCGGTGAATAAGTTAACC
AACAAACTACCTGATCTTTGGCGCAAGATTGAAAGTATCAACCAACAGCTGTTGCCCTTGGGAAACATCTCTGACAACATGGACAGAATA
CGAGAACTAATTCAGCAGGCCAGAGATGCTGCCAGTAAGGTTGCTGTCCCCATGAGGTTCAATGGTAAATCTGGAGTCGAAGTCCGACTG
CCAAATGACCTGGAAGATTTGAAAGGATATACATCTCTGTCCTTGTTTCTCCAAAGGCCCAACTCAAGAGAAAATGGGGGTACTGAGAAT
ATGTTTGTGATGTACCTTGGAAATAAAGATGCCTCCCGGGACTACATCGGCATGGCAGTTGTGGATGGCCAGCTCACCTGTGTCTACAAC
CTGGGGGACCGTGAGGCTGAACTCCAAGTGGACCAGATCTTGACCAAGAGTGAGACTAAGGAGGCAGTTATGGATCGGGTGAAATTTCAG
AGAATTTATCAGTTTGCAAGGCTTAATTACACCAAAGGAGCCACATCCAGTAAACCAGAAACACCCGGAGTCTATGACATGGATGGTAGA
AATAGCAATACACTCCTTAATTTGGATCCTGAAAATGTTGTATTTTATGTTGGAGGTTACCCACCTGATTTTAAACTTCCCAGTCGACTA
AGTTTCCCTCCATACAAAGGTTGTATTGAATTAGATGACCTCAATGAAAATGTTCTGAGCTTGTACAACTTCAAAAAAACATTCAATCTC
AACACAACTGAAGTGGAGCCTTGTAGAAGGAGGAAGGAAGAGTCAGACAAAAATTATTTTGAAGGTACGGGCTATGCTCGAGTTCCAACT
CAACCACATGCTCCCATCCCAACCTTTGGACAGACAATTCAGACCACCGTGGATAGAGGCTTGCTGTTCTTTGCAGAAAACGGGGATCGC
TTCATATCTCTAAATATAGAAGATGGCAAGCTCATGGTGAGATACAAACTGAATTCAGAGCTACCAAAAGAGAGAGGAGTTGGAGACGCC
ATAAACAACGGCAGAGACCATTCGATTCAGATCAAAATTGGAAAACTCCAAAAGCGTATGTGGATAAATGTGGACGTTCAAAACACTATA
ATTGATGGTGAAGTATTTGATTTCAGCACATATTATCTGGGAGGAATTCCAATTGCAATCAGGGAAAGATTTAACATTTCTACGCCTGCT
TTCCGAGGCTGCATGAAAAATTTGAAGAAAACCAGTGGTGTCGTTAGATTGAATGATACTGTGGGAGTAACCAAAAAGTGCTCGGAAGAC
TGGAAGCTTGTGCGATCTGCCTCATTCTCCAGAGGAGGACAATTGAGTTTCACTGATTTGGGCTTACCACCTACTGACCACCTCCAGGCC
TCATTTGGATTTCAGACCTTTCAACCCAGTGGCATATTATTAGATCATCAGACATGGACAAGGAACCTGCAGGTCACTCTGGAAGATGGT
TACATTGAATTGAGCACCAGCGATAGCGGCAGCCCAATTTTTAAATCTCCACAGACGTATATGGATGGTTTACTGCATTATGTATCTGTA
ATAAGCGACAACTCTGGACTACGGCTTCTCATCGATGACCAGCTTCTGAGAAATAGCAAAAGGCTAAAACACATTTCAAGTTCCCGGCAG
TCTCTGCGTCTGGGCGGGAGCAATTTTGAGGGTTGTATTAGCAATGTTTTTGTCCAGAGGTTATCACTGAGTCCTGAAGTCCTAGATTTG
ACCAGTAACTCTCTCAAGAGAGATGTGTCCCTGGGAGGCTGCAGTTTAAACAAACCACCTTTTCTAATGTTGCTTAAAGGTTCTACCAGG
TTTAACAAGACCAAGACTTTTCGTATCAACCAGCTGTTGCAGGACACACCAGTGGCCTCCCCAAGGAGCGTGAAGGTGTGGCAAGATGCT
TGCTCACCACTTCCCAAGACCCAGGCCAATCATGGAGCCCTCCAGTTTGGGGACATTCCCACCAGCCACTTGCTATTCAAGCTTCCTCAG
GAGCTGCTGAAACCCAGGTCACAGTTTGCTGTGGACATGCAGACAACATCCTCCAGAGGACTGGTGTTTCACACGGGCACTAAGAACTCC
TTTATGGCTCTTTATCTTTCAAAAGGACGTCTGGTCTTTGCACTGGGGACAGATGGGAAAAAATTGAGGATCAAAAGCAAGGAGAAATGC
AATGATGGGAAATGGCACACGGTGGTGTTTGGCCATGATGGGGAAAAGGGGCGCTTGGTTGTGGATGGACTGAGGGCCCGGGAGGGAAGT
TTGCCTGGAAACTCCACCATCAGCATCAGAGCGCCAGTTTACCTGGGATCACCTCCATCAGGGAAACCAAAGAGCCTCCCCACAAACAGC
TTTGTGGGATGCCTGAAGAACTTTCAGCTGGATTCAAAACCCTTGTATACCCCTTCTTCAAGCTTCGGGGTGTCTTCCTGCTTGGGTGGT
CCTTTGGAGAAAGGCATTTATTTCTCTGAAGAAGGAGGTCATGTCGTCTTGGCTCACTCTGTATTGTTGGGGCCAGAATTTAAGCTTGTT
TTCAGCATCCGCCCAAGAAGTCTCACTGGGATCCTAATACACATCGGAAGTCAGCCCGGGAAGCACTTATGTGTTTACCTGGAGGCAGGA
AAGGTCACGGCCTCTATGGACAGTGGGGCAGGTGGGACCTCAACGTCGGTCACACCAAAGCAGTCTCTGTGTGATGGACAGTGGCACTCG
GTGGCAGTCACCATAAAACAACACATCCTGCACCTGGAACTGGACACAGACAGTAGCTACACAGCTGGACAGATCCCCTTCCCACCTGCC
AGCACTCAAGAGCCACTACACCTTGGAGGTGCTCCAGCCAATTTGACGACACTGAGGATCCCTGTGTGGAAATCATTCTTTGGCTGTCTG
AGGAATATTCATGTCAATCACATCCCTGTCCCTGTCACTGAAGCCTTGGAAGTCCAGGGGCCTGTCAGTCTGAATGGTTGTCCTGACCAG

>In-frame_ROCK1_ENST00000399799_chr18_18546878_-_LAMA3_ENST00000399516_chr18_21393021_+_11445nt
ATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACCTGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTG
CTGGATGGATTGGATGCTTTGGTATATGATTTGGATTTTCCTGCCTTAAGAAAAAACAAAAATATTGACAACTTTTTAAGCAGATATAAA
GACACAATAAATAAAATCAGAGATTTACGAATGAAAGCTGAAGATTATGAAGTAGTGAAGGTGATTGGTAGAGGTGCATTTGGAGAAGTT
CAATTGGTAAGGCATAAATCCACCAGGAAGGTATATGCTATGAAGCTTCTCAGCAAATTTGAAATGATAAAGAGATCTGATTCTGCTTTT
TTCTGGGAAGAAAGGGACATCATGGCTTTTGCCAACAGTCCTTGGGTTGTTCAGCTTTTTTATGCATTCCAAGATGATCGTTATCTCTAC
ATGGTGATGGAATACATGCCTGGTGGAGATCTTGTAAACTTAATGAGCAACTATGATGTGCCTGAAAAATGGGCACGATTCTATACTGCA
GAAGTAGTTCTTGCATTGGATGCAATCCATTCCATGGGTTTTATTCACAGAGATGTGAAGCCTGATAACATGCTGCTGGATAAATCTGGA
CATTTGAAGTTAGCAGATTTTGGTACTTGTATGAAGATGAATAAGGAAGGCATGGTACGATGTGATACAGCGGTTGGAACACCTGATTAT
ATTTCCCCTGAAGTATTAAAATCCCAAGGTGGTGATGGTTATTATGGAAGAGAATGTGACTGGTGGTCGGTTGGGGTATTTTTATACGAA
ATGCTTGTAGGTGATACACCTTTTTATGCAGATTCTTTGGTTGGAACTTACAGTAAAATTATGAACCATAAAAATTCACTTACCTTTCCT
GATGATAATGACATATCAAAAGAAGCAAAAAACCTTATTTGTGCCTTCCTTACTGACAGGGAAGTGAGGTTAGGGCGAAATGGTGTAGAA
GAAATCAAACGACATCTCTTCTTCAAAAATGACCAGTGGGCTTGGGAAACGCTCCGAGACACTGTAGCACCAGTTGTACCCGATTTAAGT
AGTGACATTGATACTAGTAATTTTGATGACTTGGAAGAAGATAAAGGAGAGGAAGAAACATTCCCTATTCCTAAAGCTTTCGTTGGCAAT
CAACTACCTTTTGTAGGATTTACATATTATAGCAATCGTAGATACTTATCTTCAGCAAATCCTAATGATAACAGAACTAGCTCCAATGCA
GATAAAAGCTTGCAGGAAAGTTTGCAAAAAACAATCTATAAGCTGGAAGAACAGCTGCATAATGAAATGCAGTTAAAAGATGAAATGGAG
CAGAAGTGCAGAACCTCAAACATAAAACTAGACAAGATAATGAAAGAATTGGATGAAGAGGGAAATCAAAGAAGAAATCTAGAATCTACA
GTGTCTCAGATTGAGAAGGAGAAAATGTTGCTACAGCATAGAATTAATGAGTACCAAAGAAAAGCTGAACAGGAAAATGAGAAGAGAAGA
AATGTAGAAAATGAAGTTTCTACATTAAAGGATCAGTTGGAAGACTTAAAGAAAGTCAGTCAGAATTCACAGCTTGCTAATGAGAAGCTG
TCCCAGTTACAAAAGCAGCTAGAAGAAGCCAATGACTTACTTAGGACAGAATCGGACACAGCTGTAAGATTGAGGAAGAGTCACACAGAG
ATGAGCAAGTCAATTAGTCAGTTAGAGTCCCTGAACAGAGAGTTGCAAGAGAGAAATCGAATTTTAGAGAATTCTAAGTCACAAACAGAC
AAAGATTATTACCAGCTGCAAGCTATATTAGAAGCTGAACGAAGAGACAGAGGTCATGATTCTGAGATGATTGGAGACCTTCAAGCTCGA
ATTACATCTTTACAAGAGGAGGTGAAGCATCTCAAACATAATCTCGAAAAAGTGGAAGGAGAAAGAAAAGAGGCTCAAGACATGCTTAAT
CACTCAGAAAAGGAAAAGAATAATTTAGAGATAGATTTAAACTACAAACTTAAATCATTACAACAACGGTTAGAACAAGAGGTAAATGAA
CACAAAGTAACCAAAGCTCGTTTAACTGACAAACATCAATCTATTGAAGAGGCAAAGTCTGTGGCAATGTGTGAGATGGAAAAAAAGCTG
AAAGAAGAAAGAGAAGCTCGAGAGAAGGCTGAAAATCGGGTTGTTCAGATTGAGAAACAGTGTTCCATGCTAGACGTTGATCTGAAGCAA
TCTCAGCAGAAACTAGAACATTTGACTGGAAATAAAGAAAGGATGGAGGATGAAGTTAAGAATCTAACCCTGCAACTGGAGCAGGAATCA
AATAAGCGGCTGTTGTTACAAAATGAATTGAAGACTCAAGCATTTGAGGCAGACAATTTAAAAGGTTTAGAAAAGCAGATGAAACAGGAA
ATAAATACTTTATTGGAAGCAAAGAGATTATTAGAATTTGAGTTAGCTCAGCTTACGAAACAGTATAGAGGAAATGAAGGACAGATGCGG
GAGCTACAAGATCAGCTTGAAGCTGAGCAATATTTCTCGACACTTTATAAAACCCAGGTAAAGGAACTTAAAGAAGAAATTGAAGAAAAA
AACAGAGAAAATTTAAAGAAAATACAGGAACTACAAAATGAAAAAGAAACTCTTGCTACTCAGTTGGATCTAGCAGAAACAAAAGCTGAG
TCTGAGCAGTTGGCGCGAGGCCTTCTGGAAGAACAGTATTTTGAATTGACGCAAGAAAGCAAGAAAGCTGCTTCAAGAAATAGACAAGAG
ATTACAGATAAAGATCACACTGTTAGTCGGCTTGAAGAAGCAAACAGCATGCTAACCAAAGATATTGAAATATTAAGAAGAGAGAATGAA
GAGCTAACAGAGAAAATGAAGAAGGCAGAGGAAGAATATAAACTGGAGAAGGAGGAGGAGATCAGTAATCTTAAGGCTGCCTTTGAAAAG
AATATCAACACTGAACGAACCCTTAAAACACAGGCTGTTAACAAATTGGCAGAAATAATGAATCGAAAAGATTTTAAAATTGATAGAAAG
AAAGCTAATACACAAGATTTGAGAAAGAAAGAAAAGGAAAATCGAAAGCTGCAACTGGAACTCAACCAAGAAAGAGAGAAATTCAACCAG
ATGGTAGTGAAACATCAGAAGGAACTGAATGACATGCAAGCGCAATTGGTAGAAGAATGTGCACATAGGAATGAGCTTCAGATGCAGTTG
GCCAGCAAAGAGAGTGATATTGAGCAATTGCGTGCTAAACTTTTGGACCTCTCGGATTCTACAAGTGTTGCTAGTTTTCCTAGTGCTGAT
GAAACTGATGGTAACCTCCCAGGTTCCAGCAGTGCTTGTGACCCAGCTGGTACCATCAACTCCAATTTGGGGTATTGCCAATGCAAGCTT
CATGTTGAAGGTCCTACTTGTAGCCGCTGCAAACTGTTATATTGGAATCTGGACAAAGAAAACCCCAGTGGATGTTCAGAATGCAAGTGC
CATAAGGCGGGAACAGTGAGTGGAACTGGAGAGTGTAGGCAGGGAGATGGTGACTGTCACTGCAAGTCCCATGTGGGTGGCGATTCCTGC
GACACCTGTGAAGATGGATATTTTGCTTTGGAAAAGAGCAATTACTTTGGGTGTCAAGGGTGTCAGTGTGACATTGGTGGGGCATTGTCC
TCCATGTGCAGTGGGCCCTCGGGAGTGTGCCAGTGCCGAGAGCATGTCGTGGGAAAGGTGTGCCAGCGGCCTGAAAACAACTACTATTTC
CCAGATTTGCATCATATGAAGTATGAGATTGAAGACGGCAGCACACCTAATGGGAGAGACCTTCGATTTGGATTTGATCCGCTGGCATTT
CCTGAGTTTAGCTGGAGAGGATATGCCCAAATGACCTCAGTACAGAATGATGTAAGAATAACATTGAATGTAGGGAAGTCAAGTGGCTCC
TTGTTTCGTGTTATTCTGAGATACGTTAACCCTGGAACTGAAGCAGTATCTGGCCATATAACTATTTATCCATCCTGGGGTGCTGCTCAA
AGCAAAGAGATCATCTTCCTGCCGAGTAAGGAGCCAGCCTTTGTCACTGTCCCTGGAAATGGTTTTGCAGACCCATTTTCAATCACACCA
GGAATATGGGTTGCTTGTATTAAGGCAGAAGGAGTCCTTCTGGATTACCTGGTGCTGCTCCCCAGGGACTACTATGAAGCCTCTGTACTG
CAGCTGCCAGTCACAGAACCATGTGCCTACGCAGGACCTCCCCAAGAAAATTGCTTACTCTACCAGCATTTGCCAGTGACCAGATTCCCC
TGTACCCTGGCTTGTGAGGCCAGACACTTCCTGCTTGATGGGGAGCCAAGACCCGTGGCAGTGAGGCAGCCCACACCTGCACACCCTGTC
ATGGTGGACCTCAGCGGGAGAGAGGTGGAATTGCATCTGCGGCTGCGCATCCCACAGGTTGGCCACTACGTGGTTGTGGTCGAGTATTCC
ACGGAGGCAGCTCAGCTGTTTGTGGTTGATGTGAATGTGAAGAGCTCCGGGTCTGTTCTGGCAGGCCAGGTGAACATTTACAGCTGCAAC
TACAGTGTTCTCTGCCGGAGTGCTGTGATTGATCACATGAGCCGCATCGCCATGTATGAGCTATTGGCAGATGCAGACATTCAGCTCAAG
GGACACATGGCCCGATTCCTTCTGCATCAAGTTTGTATCATACCTATTGAAGAATTCTCAGCTGAGTATGTGAGACCACAAGTCCACTGC
ATTGCCAGTTATGGGCGATTTGTCAATCAAAGTGCCACCTGTGTCTCCTTGGCCCATGAAACTCCTCCAACAGCATTAATTTTGGATGTT
CTAAGTGGCAGGCCTTTCCCTCACCTGCCCCAGCAGTCGTCACCTTCTGTTGATGTTCTTCCTGGGGTCACCTTGAAGGCACCGCAGAAT
CAAGTGACCCTGAGAGGACGTGTACCACACCTGGGCCGATACGTCTTTGTCATCCATTTTTACCAAGCAGCGCACCCGACGTTTCCCGCG
CAGGTGTCGGTGGATGGCGGGTGGCCACGGGCAGGCTCCTTCCATGCCTCTTTTTGCCCCCATGTGCTTGGCTGCCGGGATCAAGTGATT
GCCGAAGGCCAGATTGAGTTTGACATCTCAGAGCCTGAAGTGGCCGCAACTGTGAAGGTTCCAGAAGGAAAGTCCTTGGTTTTGGTCCGT
GTTCTAGTGGTGCCTGCAGAAAACTATGACTACCAAATACTTCACAAAAAATCCATGGACAAGTCACTCGAGTTTATCACCAATTGTGGA
AAAAACAGCTTTTACCTTGACCCCCAGACAGCCTCCAGATTCTGTAAGAATTCCGCCAGGTCCCTGGTGGCCTTTTACCACAAGGGCGCC
CTGCCTTGTGAGTGCCACCCCACTGGGGCCACCGGCCCTCACTGCAGCCCTGAGGGTGGGCAGTGCCCATGCCAGCCCAACGTCATCGGG
CGGCAGTGCACCCGCTGTGCAACAGGCCACTACGGATTCCCACGCTGCAAGCCGTGCAGCTGTGGTCGGCGCCTTTGTGAAGAGATGACG
GGGCAGTGCCGCTGCCCTCCCCGCACGGTCAGGCCCCAGTGTGAGGTGTGTGAGACACACTCATTCAGCTTCCACCCCATGGCCGGCTGC
GAAGGCTGCAACTGTTCCAGGAGGGGCACCATCGAGGCTGCCATGCCGGAGTGTGACCGGGACAGCGGGCAGTGCAGATGCAAGCCCAGA
ATCACAGGGCGGCAGTGTGACCGATGTGCTTCCGGGTTTTACCGCTTTCCTGAGTGTGTTCCCTGCAATTGCAACAGAGATGGGACTGAG
CCAGGAGTGTGTGACCCAGGGACCGGGGCTTGCCTCTGCAAGGAAAATGTAGAAGGCACAGAGTGTAATGTGTGTCGAGAAGGCTCATTC
CATTTGGACCCAGCCAATCTCAAGGGTTGTACCAGCTGTTTCTGTTTTGGAGTAAATAATCAATGTCACAGCTCACATAAGCGAAGGACT
AAGTTTGTGGATATGCTGGGCTGGCACCTGGAGACAGCAGACAGAGTGGACATCCCTGTCTCTTTCAACCCAGGCAGCAACAGTATGGTG
GCGGATCTCCAGGAGCTGCCCGCAACCATCCACAGCGCGTCCTGGGTCGCACCCACCTCCTACCTGGGGGACAAGGTTTCTTCATATGGT
GGTTACCTCACTTACCAAGCCAAGTCCTTTGGCTTGCCTGGCGACATGGTTCTTCTGGAAAAGAAGCCGGATGTACAGCTCACTGGTCAG
CACATGTCCATCATCTATGAGGAGACAAACACCCCACGGCCAGACCGGCTGCATCATGGACGAGTGCACGTGGTCGAGGGAAACTTCAGA
CATGCCAGCAGCCGTGCCCCAGTGTCTAGGGAGGAGCTGATGACAGTGCTGTCTAGACTGGCAGATGTGCGCATCCAAGGCCTCTACTTC
ACAGAGACTCAAAGGCTCACCCTGAGCGAGGTGGGGCTAGAGGAAGCCTCTGACACAGGAAGTGGGCGCATAGCACTTGCTGTGGAAATC
TGTGCCTGCCCCCCTGCCTACGCTGGTGACTCTTGTCAGGGTTGTAGCCCTGGATACTATCGGGATCATAAAGGCTTGTATACCGGACGG
TGTGTTCCCTGCAATTGCAACGGACATTCAAATCAATGCCAGGATGGCTCAGGCATATGTGTTAACTGTCAGCACAACACCGCGGGAGAG
CACTGTGAACGCTGCCAGGAGGGCTACTATGGCAACGCCGTCCACGGATCCTGCAGGGCCTGCCCATGTCCTCACACTAACAGCTTTGCC
ACTGGCTGTGTGGTGAATGGGGGAGACGTGCGGTGCTCCTGCAAAGCTGGGTACACAGGAACACAGTGTGAAAGGTGTGCACCGGGATAT
TTCGGGAATCCCCAGAAATTCGGAGGTAGCTGCCAACCATGCAGTTGTAACAGCAATGGCCAGCTGGGCAGCTGTCATCCCCTGACTGGA
GACTGCATAAACCAAGAACCCAAAGATAGCAGCCCTGCAGAAGAATGTGATGATTGCGACAGCTGTGTGATGACCCTCCTGAACGACCTG
GCCACCATGGGCGAGCAGCTCCGCCTGGTCAAGTCTCAGCTGCAGGGCCTGAGTGCCAGCGCAGGGCTTCTGGAGCAGATGAGGCACATG
GAGACCCAGGCCAAGGACCTGAGGAATCAGTTGCTCAACTACCGTTCTGCCATTTCAAATCATGGATCAAAAATAGAAGGCCTGGAAAGA
GAACTGACTGATTTGAATCAAGAATTTGAGACTTTGCAAGAAAAGGCTCAAGTAAATTCCAGAAAAGCACAAACATTAAACAACAATGTT
AATCGGGCAACACAAAGCGCAAAAGAACTGGATGTGAAGATTAAAAATGTCATCCGGAATGTGCACATGCTGAACCGGATAAGGACCTGG
CAGAAAACCCACCAGGGGGAGAACAATGGGCTTGCTAACAGTATCCGGGATTCTTTAAATGAATACGAAGCCAAACTCAGTGACCTTCGT
GCTCGGCTGCAGGAGGCAGCTGCCCAAGCCAAGCAGGCAAATGGCTTGAACCAAGAAAACGAGAGAGCTTTGGGAGCCATTCAGAGACAA
GTGAAAGAAATAAATTCCCTGCAGAGTGATTTCACCAAGTATCTAACCACTGCAGACTCATCTTTGTTGCAAACCAACATTGCGCTGCAG
CTGATGGAGAAAAGCCAGAAGGAATATGAAAAATTAGCTGCCAGTTTAAATGAAGCAAGACAAGAACTAAGTGACAAAGTAAGAGAACTT
TCCAGATCTGCTGGCAAAACATCCCTTGTGGAGGAGGCAGAAAAGCACGCGCGGTCCTTACAAGAGCTGGCAAAGCAGCTGGAAGAGATC
AAGAGAAACGCCAGCGGGGATGAGCTGGTGCGCTGTGCTGTGGATGCCGCCACCGCCTACGAGAACATCCTCAATGCCATCAAAGCGGCC
GAGGACGCAGCCAACAGGGCTGCCAGTGCATCTGAATCTGCCCTCCAGACAGTGATAAAGGAAGATCTGCCAAGAAAAGCTAAAACCCTG
AGTTCCAACAGTGATAAACTGTTAAATGAAGCCAAGATGACACAAAAGAAGCTAAAGCAAGAAGTCAGTCCAGCTCTCAACAACCTACAG
CAAACCCTGAATATTGTGACAGTTCAGAAAGAAGTGATAGACACCAATCTCACAACTCTCCGAGATGGTCTTCATGGGATACAGAGAGGT
GATATTGATGCTATGATCAGTAGTGCAAAGAGCATGGTCAGAAAGGCCAACGACATCACAGATGAGGTTCTGGATGGGCTCAACCCCATC
CAGACAGATGTGGAAAGAATTAAGGACACCTATGGGAGGACACAGAACGAAGACTTCAAAAAGGCTCTGACTGATGCAGATAACTCGGTG
AATAAGTTAACCAACAAACTACCTGATCTTTGGCGCAAGATTGAAAGTATCAACCAACAGCTGTTGCCCTTGGGAAACATCTCTGACAAC
ATGGACAGAATACGAGAACTAATTCAGCAGGCCAGAGATGCTGCCAGTAAGGTTGCTGTCCCCATGAGGTTCAATGGTAAATCTGGAGTC
GAAGTCCGACTGCCAAATGACCTGGAAGATTTGAAAGGATATACATCTCTGTCCTTGTTTCTCCAAAGGCCCAACTCAAGAGAAAATGGG
GGTACTGAGAATATGTTTGTGATGTACCTTGGAAATAAAGATGCCTCCCGGGACTACATCGGCATGGCAGTTGTGGATGGCCAGCTCACC
TGTGTCTACAACCTGGGGGACCGTGAGGCTGAACTCCAAGTGGACCAGATCTTGACCAAGAGTGAGACTAAGGAGGCAGTTATGGATCGG
GTGAAATTTCAGAGAATTTATCAGTTTGCAAGGCTTAATTACACCAAAGGAGCCACATCCAGTAAACCAGAAACACCCGGAGTCTATGAC
ATGGATGGTAGAAATAGCAATACACTCCTTAATTTGGATCCTGAAAATGTTGTATTTTATGTTGGAGGTTACCCACCTGATTTTAAACTT
CCCAGTCGACTAAGTTTCCCTCCATACAAAGGTTGTATTGAATTAGATGACCTCAATGAAAATGTTCTGAGCTTGTACAACTTCAAAAAA
ACATTCAATCTCAACACAACTGAAGTGGAGCCTTGTAGAAGGAGGAAGGAAGAGTCAGACAAAAATTATTTTGAAGGTACGGGCTATGCT
CGAGTTCCAACTCAACCACATGCTCCCATCCCAACCTTTGGACAGACAATTCAGACCACCGTGGATAGAGGCTTGCTGTTCTTTGCAGAA
AACGGGGATCGCTTCATATCTCTAAATATAGAAGATGGCAAGCTCATGGTGAGATACAAACTGAATTCAGAGCTACCAAAAGAGAGAGGA
GTTGGAGACGCCATAAACAACGGCAGAGACCATTCGATTCAGATCAAAATTGGAAAACTCCAAAAGCGTATGTGGATAAATGTGGACGTT
CAAAACACTATAATTGATGGTGAAGTATTTGATTTCAGCACATATTATCTGGGAGGAATTCCAATTGCAATCAGGGAAAGATTTAACATT
TCTACGCCTGCTTTCCGAGGCTGCATGAAAAATTTGAAGAAAACCAGTGGTGTCGTTAGATTGAATGATACTGTGGGAGTAACCAAAAAG
TGCTCGGAAGACTGGAAGCTTGTGCGATCTGCCTCATTCTCCAGAGGAGGACAATTGAGTTTCACTGATTTGGGCTTACCACCTACTGAC
CACCTCCAGGCCTCATTTGGATTTCAGACCTTTCAACCCAGTGGCATATTATTAGATCATCAGACATGGACAAGGAACCTGCAGGTCACT
CTGGAAGATGGTTACATTGAATTGAGCACCAGCGATAGCGGCAGCCCAATTTTTAAATCTCCACAGACGTATATGGATGGTTTACTGCAT
TATGTATCTGTAATAAGCGACAACTCTGGACTACGGCTTCTCATCGATGACCAGCTTCTGAGAAATAGCAAAAGGCTAAAACACATTTCA
AGTTCCCGGCAGTCTCTGCGTCTGGGCGGGAGCAATTTTGAGGGTTGTATTAGCAATGTTTTTGTCCAGAGGTTATCACTGAGTCCTGAA
GTCCTAGATTTGACCAGTAACTCTCTCAAGAGAGATGTGTCCCTGGGAGGCTGCAGTTTAAACAAACCACCTTTTCTAATGTTGCTTAAA
GGTTCTACCAGGTTTAACAAGACCAAGACTTTTCGTATCAACCAGCTGTTGCAGGACACACCAGTGGCCTCCCCAAGGAGCGTGAAGGTG
TGGCAAGATGCTTGCTCACCACTTCCCAAGACCCAGGCCAATCATGGAGCCCTCCAGTTTGGGGACATTCCCACCAGCCACTTGCTATTC
AAGCTTCCTCAGGAGCTGCTGAAACCCAGGTCACAGTTTGCTGTGGACATGCAGACAACATCCTCCAGAGGACTGGTGTTTCACACGGGC
ACTAAGAACTCCTTTATGGCTCTTTATCTTTCAAAAGGACGTCTGGTCTTTGCACTGGGGACAGATGGGAAAAAATTGAGGATCAAAAGC
AAGGAGAAATGCAATGATGGGAAATGGCACACGGTGGTGTTTGGCCATGATGGGGAAAAGGGGCGCTTGGTTGTGGATGGACTGAGGGCC
CGGGAGGGAAGTTTGCCTGGAAACTCCACCATCAGCATCAGAGCGCCAGTTTACCTGGGATCACCTCCATCAGGGAAACCAAAGAGCCTC
CCCACAAACAGCTTTGTGGGATGCCTGAAGAACTTTCAGCTGGATTCAAAACCCTTGTATACCCCTTCTTCAAGCTTCGGGGTGTCTTCC
TGCTTGGGTGGTCCTTTGGAGAAAGGCATTTATTTCTCTGAAGAAGGAGGTCATGTCGTCTTGGCTCACTCTGTATTGTTGGGGCCAGAA
TTTAAGCTTGTTTTCAGCATCCGCCCAAGAAGTCTCACTGGGATCCTAATACACATCGGAAGTCAGCCCGGGAAGCACTTATGTGTTTAC
CTGGAGGCAGGAAAGGTCACGGCCTCTATGGACAGTGGGGCAGGTGGGACCTCAACGTCGGTCACACCAAAGCAGTCTCTGTGTGATGGA
CAGTGGCACTCGGTGGCAGTCACCATAAAACAACACATCCTGCACCTGGAACTGGACACAGACAGTAGCTACACAGCTGGACAGATCCCC
TTCCCACCTGCCAGCACTCAAGAGCCACTACACCTTGGAGGTGCTCCAGCCAATTTGACGACACTGAGGATCCCTGTGTGGAAATCATTC
TTTGGCTGTCTGAGGAATATTCATGTCAATCACATCCCTGTCCCTGTCACTGAAGCCTTGGAAGTCCAGGGGCCTGTCAGTCTGAATGGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ROCK1_ENST00000399799_chr18_18546878_-_LAMA3_ENST00000313654_chr18_21393021_+_12972nt
GCTGGTTCCCCTTCCGAGCGTCCGCGCCCCGCATGCGCAGTCTGCCCCGGCGGTCTCCGTTTGTTTGAACAGGAAGGCGGACATATTAGT
CCCTCTCAGCCCCCCTCGCCCCACCCCCCAGGCATTCGCCGCCGCGACTCGCCCTTTCCCCGGCTGGGACCGCAGCCCCTCCCAGAAGCT
CCCCCATCAGCAGCCGCCGGGACCCAACTATCGTCTTCCTCTTCGCCCGCTCTCCAGCCTTTCCTCTGCTAAGTCTCCATCGGGCATCGA
CCTCGCCCTGCCCCACCGGACACCGTAGCAGCAGCCCCAGCAGCGACGGGACAAAATGGGAGAGTGAGGCTGTCCTGCGTGGACCAGCTC
GTGGCCGAGACTGATCGGTGCGTCGGGCCGGGCCGAGTAGAGCCGGGGACGCGGGGCTAGACCGTCTACAGCGCCTCTGAGCGGAGCGGG
CCCGGCCCGTGGCCCGAGCGGCGGCCGCAGCTGGCACAGCTCCTCACCCGCCCTTTGCTTTCGCCTTTCCTCTTCTCCCTCCCTTGTTGC
CCGGAGGGAGTCTCCACCCTGCTTCTCTTTCTCTACCCGCTCCTGCCCATCTCGGGACGGGGACCCCTCCATGGCGACGGCGGCCGGGGC
CCGCTAGACTGAAGCACCTCGCCGGAGCGACGAGGCTGGTGGCGACGGCGCTGTCGGCTGTCGTGAGGGGCTGCCGGGTGGGATGCGACT
TTGGGCGTCCGAGCGGCTGTGGGTCGCTGTTGCCCCCGGCCCGGGGTCTGGAGAGCGGAGGTCCCCTCAGTGAGGGGAAGACGGGGGAAC
CGGGCGCACCTGGTGACCCTGAGGTTCCGGCTCCTCCGCCCCGCGGCTGCGAACCCACCGCGGAGGAAGTTGGTTGAAATTGCTTTCCGC
TGCTGGTGCTGGTAAGAGGGCATTGTCACAGCAGCAGCAACATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACC
TGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTGCTGGATGGATTGGATGCTTTGGTATATGATTTGGATTTTCCTGCCTTAA
GAAAAAACAAAAATATTGACAACTTTTTAAGCAGATATAAAGACACAATAAATAAAATCAGAGATTTACGAATGAAAGCTGAAGATTATG
AAGTAGTGAAGGTGATTGGTAGAGGTGCATTTGGAGAAGTTCAATTGGTAAGGCATAAATCCACCAGGAAGGTATATGCTATGAAGCTTC
TCAGCAAATTTGAAATGATAAAGAGATCTGATTCTGCTTTTTTCTGGGAAGAAAGGGACATCATGGCTTTTGCCAACAGTCCTTGGGTTG
TTCAGCTTTTTTATGCATTCCAAGATGATCGTTATCTCTACATGGTGATGGAATACATGCCTGGTGGAGATCTTGTAAACTTAATGAGCA
ACTATGATGTGCCTGAAAAATGGGCACGATTCTATACTGCAGAAGTAGTTCTTGCATTGGATGCAATCCATTCCATGGGTTTTATTCACA
GAGATGTGAAGCCTGATAACATGCTGCTGGATAAATCTGGACATTTGAAGTTAGCAGATTTTGGTACTTGTATGAAGATGAATAAGGAAG
GCATGGTACGATGTGATACAGCGGTTGGAACACCTGATTATATTTCCCCTGAAGTATTAAAATCCCAAGGTGGTGATGGTTATTATGGAA
GAGAATGTGACTGGTGGTCGGTTGGGGTATTTTTATACGAAATGCTTGTAGGTGATACACCTTTTTATGCAGATTCTTTGGTTGGAACTT
ACAGTAAAATTATGAACCATAAAAATTCACTTACCTTTCCTGATGATAATGACATATCAAAAGAAGCAAAAAACCTTATTTGTGCCTTCC
TTACTGACAGGGAAGTGAGGTTAGGGCGAAATGGTGTAGAAGAAATCAAACGACATCTCTTCTTCAAAAATGACCAGTGGGCTTGGGAAA
CGCTCCGAGACACTGTAGCACCAGTTGTACCCGATTTAAGTAGTGACATTGATACTAGTAATTTTGATGACTTGGAAGAAGATAAAGGAG
AGGAAGAAACATTCCCTATTCCTAAAGCTTTCGTTGGCAATCAACTACCTTTTGTAGGATTTACATATTATAGCAATCGTAGATACTTAT
CTTCAGCAAATCCTAATGATAACAGAACTAGCTCCAATGCAGATAAAAGCTTGCAGGAAAGTTTGCAAAAAACAATCTATAAGCTGGAAG
AACAGCTGCATAATGAAATGCAGTTAAAAGATGAAATGGAGCAGAAGTGCAGAACCTCAAACATAAAACTAGACAAGATAATGAAAGAAT
TGGATGAAGAGGGAAATCAAAGAAGAAATCTAGAATCTACAGTGTCTCAGATTGAGAAGGAGAAAATGTTGCTACAGCATAGAATTAATG
AGTACCAAAGAAAAGCTGAACAGGAAAATGAGAAGAGAAGAAATGTAGAAAATGAAGTTTCTACATTAAAGGATCAGTTGGAAGACTTAA
AGAAAGTCAGTCAGAATTCACAGCTTGCTAATGAGAAGCTGTCCCAGTTACAAAAGCAGCTAGAAGAAGCCAATGACTTACTTAGGACAG
AATCGGACACAGCTGTAAGATTGAGGAAGAGTCACACAGAGATGAGCAAGTCAATTAGTCAGTTAGAGTCCCTGAACAGAGAGTTGCAAG
AGAGAAATCGAATTTTAGAGAATTCTAAGTCACAAACAGACAAAGATTATTACCAGCTGCAAGCTATATTAGAAGCTGAACGAAGAGACA
GAGGTCATGATTCTGAGATGATTGGAGACCTTCAAGCTCGAATTACATCTTTACAAGAGGAGGTGAAGCATCTCAAACATAATCTCGAAA
AAGTGGAAGGAGAAAGAAAAGAGGCTCAAGACATGCTTAATCACTCAGAAAAGGAAAAGAATAATTTAGAGATAGATTTAAACTACAAAC
TTAAATCATTACAACAACGGTTAGAACAAGAGGTAAATGAACACAAAGTAACCAAAGCTCGTTTAACTGACAAACATCAATCTATTGAAG
AGGCAAAGTCTGTGGCAATGTGTGAGATGGAAAAAAAGCTGAAAGAAGAAAGAGAAGCTCGAGAGAAGGCTGAAAATCGGGTTGTTCAGA
TTGAGAAACAGTGTTCCATGCTAGACGTTGATCTGAAGCAATCTCAGCAGAAACTAGAACATTTGACTGGAAATAAAGAAAGGATGGAGG
ATGAAGTTAAGAATCTAACCCTGCAACTGGAGCAGGAATCAAATAAGCGGCTGTTGTTACAAAATGAATTGAAGACTCAAGCATTTGAGG
CAGACAATTTAAAAGGTTTAGAAAAGCAGATGAAACAGGAAATAAATACTTTATTGGAAGCAAAGAGATTATTAGAATTTGAGTTAGCTC
AGCTTACGAAACAGTATAGAGGAAATGAAGGACAGATGCGGGAGCTACAAGATCAGCTTGAAGCTGAGCAATATTTCTCGACACTTTATA
AAACCCAGGTAAAGGAACTTAAAGAAGAAATTGAAGAAAAAAACAGAGAAAATTTAAAGAAAATACAGGAACTACAAAATGAAAAAGAAA
CTCTTGCTACTCAGTTGGATCTAGCAGAAACAAAAGCTGAGTCTGAGCAGTTGGCGCGAGGCCTTCTGGAAGAACAGTATTTTGAATTGA
CGCAAGAAAGCAAGAAAGCTGCTTCAAGAAATAGACAAGAGATTACAGATAAAGATCACACTGTTAGTCGGCTTGAAGAAGCAAACAGCA
TGCTAACCAAAGATATTGAAATATTAAGAAGAGAGAATGAAGAGCTAACAGAGAAAATGAAGAAGGCAGAGGAAGAATATAAACTGGAGA
AGGAGGAGGAGATCAGTAATCTTAAGGCTGCCTTTGAAAAGAATATCAACACTGAACGAACCCTTAAAACACAGGCTGTTAACAAATTGG
CAGAAATAATGAATCGAAAAGATTTTAAAATTGATAGAAAGAAAGCTAATACACAAGATTTGAGAAAGAAAGAAAAGGAAAATCGAAAGC
TGCAACTGGAACTCAACCAAGAAAGAGAGAAATTCAACCAGATGGTAGTGAAACATCAGAAGGAACTGAATGACATGCAAGCGCAATTGG
TAGAAGAATGTGCACATAGGAATGAGCTTCAGATGCAGTTGGCCAGCAAAGAGAGTGATATTGAGCAATTGCGTGCTAAACTTTTGGACC
TCTCGGATTCTACAAGTGTTGCTAGTTTTCCTAGTGCTGATGAAACTGATGGTAACCTCCCAGGTTCCAGCAGTGCTTGTGACCCAGCTG
GTACCATCAACTCCAATTTGGGGTATTGCCAATGCAAGCTTCATGTTGAAGGTCCTACTTGTAGCCGCTGCAAACTGTTATATTGGAATC
TGGACAAAGAAAACCCCAGTGGATGTTCAGAATGCAAGTGCCATAAGGCGGGAACAGTGAGTGGAACTGGAGAGTGTAGGCAGGGAGATG
GTGACTGTCACTGCAAGTCCCATGTGGGTGGCGATTCCTGCGACACCTGTGAAGATGGATATTTTGCTTTGGAAAAGAGCAATTACTTTG
GGTGTCAAGGGTGTCAGTGTGACATTGGTGGGGCATTGTCCTCCATGTGCAGTGGGCCCTCGGGAGTGTGCCAGTGCCGAGAGCATGTCG
TGGGAAAGGTGTGCCAGCGGCCTGAAAACAACTACTATTTCCCAGATTTGCATCATATGAAGTATGAGATTGAAGACGGCAGCACACCTA
ATGGGAGAGACCTTCGATTTGGATTTGATCCGCTGGCATTTCCTGAGTTTAGCTGGAGAGGATATGCCCAAATGACCTCAGTACAGAATG
ATGTAAGAATAACATTGAATGTAGGGAAGTCAAGTGGCTCCTTGTTTCGTGTTATTCTGAGATACGTTAACCCTGGAACTGAAGCAGTAT
CTGGCCATATAACTATTTATCCATCCTGGGGTGCTGCTCAAAGCAAAGAGATCATCTTCCTGCCGAGTAAGGAGCCAGCCTTTGTCACTG
TCCCTGGAAATGGTTTTGCAGACCCATTTTCAATCACACCAGGAATATGGGTTGCTTGTATTAAGGCAGAAGGAGTCCTTCTGGATTACC
TGGTGCTGCTCCCCAGGGACTACTATGAAGCCTCTGTACTGCAGCTGCCAGTCACAGAACCATGTGCCTACGCAGGACCTCCCCAAGAAA
ATTGCTTACTCTACCAGCATTTGCCAGTGACCAGATTCCCCTGTACCCTGGCTTGTGAGGCCAGACACTTCCTGCTTGATGGGGAGCCAA
GACCCGTGGCAGTGAGGCAGCCCACACCTGCACACCCTGTCATGGTGGACCTCAGCGGGAGAGAGGTGGAATTGCATCTGCGGCTGCGCA
TCCCACAGGTTGGCCACTACGTGGTTGTGGTCGAGTATTCCACGGAGGCAGCTCAGCTGTTTGTGGTTGATGTGAATGTGAAGAGCTCCG
GGTCTGTTCTGGCAGGCCAGGTGAACATTTACAGCTGCAACTACAGTGTTCTCTGCCGGAGTGCTGTGATTGATCACATGAGCCGCATCG
CCATGTATGAGCTATTGGCAGATGCAGACATTCAGCTCAAGGGACACATGGCCCGATTCCTTCTGCATCAAGTTTGTATCATACCTATTG
AAGAATTCTCAGCTGAGTATGTGAGACCACAAGTCCACTGCATTGCCAGTTATGGGCGATTTGTCAATCAAAGTGCCACCTGTGTCTCCT
TGGCCCATGAAACTCCTCCAACAGCATTAATTTTGGATGTTCTAAGTGGCAGGCCTTTCCCTCACCTGCCCCAGCAGTCGTCACCTTCTG
TTGATGTTCTTCCTGGGGTCACCTTGAAGGCACCGCAGAATCAAGTGACCCTGAGAGGACGTGTACCACACCTGGGCCGATACGTCTTTG
TCATCCATTTTTACCAAGCAGCGCACCCGACGTTTCCCGCGCAGGTGTCGGTGGATGGCGGGTGGCCACGGGCAGGCTCCTTCCATGCCT
CTTTTTGCCCCCATGTGCTTGGCTGCCGGGATCAAGTGATTGCCGAAGGCCAGATTGAGTTTGACATCTCAGAGCCTGAAGTGGCCGCAA
CTGTGAAGGTTCCAGAAGGAAAGTCCTTGGTTTTGGTCCGTGTTCTAGTGGTGCCTGCAGAAAACTATGACTACCAAATACTTCACAAAA
AATCCATGGACAAGTCACTCGAGTTTATCACCAATTGTGGAAAAAACAGCTTTTACCTTGACCCCCAGACAGCCTCCAGATTCTGTAAGA
ATTCCGCCAGGTCCCTGGTGGCCTTTTACCACAAGGGCGCCCTGCCTTGTGAGTGCCACCCCACTGGGGCCACCGGCCCTCACTGCAGCC
CTGAGGGTGGGCAGTGCCCATGCCAGCCCAACGTCATCGGGCGGCAGTGCACCCGCTGTGCAACAGGCCACTACGGATTCCCACGCTGCA
AGCCGTGCAGCTGTGGTCGGCGCCTTTGTGAAGAGATGACGGGGCAGTGCCGCTGCCCTCCCCGCACGGTCAGGCCCCAGTGTGAGGTGT
GTGAGACACACTCATTCAGCTTCCACCCCATGGCCGGCTGCGAAGGCTGCAACTGTTCCAGGAGGGGCACCATCGAGGCTGCCATGCCGG
AGTGTGACCGGGACAGCGGGCAGTGCAGATGCAAGCCCAGAATCACAGGGCGGCAGTGTGACCGATGTGCTTCCGGGTTTTACCGCTTTC
CTGAGTGTGTTCCCTGCAATTGCAACAGAGATGGGACTGAGCCAGGAGTGTGTGACCCAGGGACCGGGGCTTGCCTCTGCAAGGAAAATG
TAGAAGGCACAGAGTGTAATGTGTGTCGAGAAGGCTCATTCCATTTGGACCCAGCCAATCTCAAGGGTTGTACCAGCTGTTTCTGTTTTG
GAGTAAATAATCAATGTCACAGCTCACATAAGCGAAGGACTAAGTTTGTGGATATGCTGGGCTGGCACCTGGAGACAGCAGACAGAGTGG
ACATCCCTGTCTCTTTCAACCCAGGCAGCAACAGTATGGTGGCGGATCTCCAGGAGCTGCCCGCAACCATCCACAGCGCGTCCTGGGTCG
CACCCACCTCCTACCTGGGGGACAAGGTTTCTTCATATGGTGGTTACCTCACTTACCAAGCCAAGTCCTTTGGCTTGCCTGGCGACATGG
TTCTTCTGGAAAAGAAGCCGGATGTACAGCTCACTGGTCAGCACATGTCCATCATCTATGAGGAGACAAACACCCCACGGCCAGACCGGC
TGCATCATGGACGAGTGCACGTGGTCGAGGGAAACTTCAGACATGCCAGCAGCCGTGCCCCAGTGTCTAGGGAGGAGCTGATGACAGTGC
TGTCTAGACTGGCAGATGTGCGCATCCAAGGCCTCTACTTCACAGAGACTCAAAGGCTCACCCTGAGCGAGGTGGGGCTAGAGGAAGCCT
CTGACACAGGAAGTGGGCGCATAGCACTTGCTGTGGAAATCTGTGCCTGCCCCCCTGCCTACGCTGGTGACTCTTGTCAGGGTTGTAGCC
CTGGATACTATCGGGATCATAAAGGCTTGTATACCGGACGGTGTGTTCCCTGCAATTGCAACGGACATTCAAATCAATGCCAGGATGGCT
CAGGCATATGTGTTAACTGTCAGCACAACACCGCGGGAGAGCACTGTGAACGCTGCCAGGAGGGCTACTATGGCAACGCCGTCCACGGAT
CCTGCAGGGCCTGCCCATGTCCTCACACTAACAGCTTTGCCACTGGCTGTGTGGTGAATGGGGGAGACGTGCGGTGCTCCTGCAAAGCTG
GGTACACAGGAACACAGTGTGAAAGGTGTGCACCGGGATATTTCGGGAATCCCCAGAAATTCGGAGGTAGCTGCCAACCATGCAGTTGTA
ACAGCAATGGCCAGCTGGGCAGCTGTCATCCCCTGACTGGAGACTGCATAAACCAAGAACCCAAAGATAGCAGCCCTGCAGAAGAATGTG
ATGATTGCGACAGCTGTGTGATGACCCTCCTGAACGACCTGGCCACCATGGGCGAGCAGCTCCGCCTGGTCAAGTCTCAGCTGCAGGGCC
TGAGTGCCAGCGCAGGGCTTCTGGAGCAGATGAGGCACATGGAGACCCAGGCCAAGGACCTGAGGAATCAGTTGCTCAACTACCGTTCTG
CCATTTCAAATCATGGATCAAAAATAGAAGGCCTGGAAAGAGAACTGACTGATTTGAATCAAGAATTTGAGACTTTGCAAGAAAAGGCTC
AAGTAAATTCCAGAAAAGCACAAACATTAAACAACAATGTTAATCGGGCAACACAAAGCGCAAAAGAACTGGATGTGAAGATTAAAAATG
TCATCCGGAATGTGCACATTCTTTTAAAGCAGATCTCTGGGACAGATGGAGAGGGAAACAACGTGCCTTCAGGTGACTTTTCCAGAGAGT
GGGCTGAAGCCCAGCGCATGATGAGGGAACTGCGGAACAGGAACTTTGGAAAGCACCTCAGAGAAGCAGAAGCTGATAAAAGGGAGTCGC
AGCTCTTGCTGAACCGGATAAGGACCTGGCAGAAAACCCACCAGGGGGAGAACAATGGGCTTGCTAACAGTATCCGGGATTCTTTAAATG
AATACGAAGCCAAACTCAGTGACCTTCGTGCTCGGCTGCAGGAGGCAGCTGCCCAAGCCAAGCAGGCAAATGGCTTGAACCAAGAAAACG
AGAGAGCTTTGGGAGCCATTCAGAGACAAGTGAAAGAAATAAATTCCCTGCAGAGTGATTTCACCAAGTATCTAACCACTGCAGACTCAT
CTTTGTTGCAAACCAACATTGCGCTGCAGCTGATGGAGAAAAGCCAGAAGGAATATGAAAAATTAGCTGCCAGTTTAAATGAAGCAAGAC
AAGAACTAAGTGACAAAGTAAGAGAACTTTCCAGATCTGCTGGCAAAACATCCCTTGTGGAGGAGGCAGAAAAGCACGCGCGGTCCTTAC
AAGAGCTGGCAAAGCAGCTGGAAGAGATCAAGAGAAACGCCAGCGGGGATGAGCTGGTGCGCTGTGCTGTGGATGCCGCCACCGCCTACG
AGAACATCCTCAATGCCATCAAAGCGGCCGAGGACGCAGCCAACAGGGCTGCCAGTGCATCTGAATCTGCCCTCCAGACAGTGATAAAGG
AAGATCTGCCAAGAAAAGCTAAAACCCTGAGTTCCAACAGTGATAAACTGTTAAATGAAGCCAAGATGACACAAAAGAAGCTAAAGCAAG
AAGTCAGTCCAGCTCTCAACAACCTACAGCAAACCCTGAATATTGTGACAGTTCAGAAAGAAGTGATAGACACCAATCTCACAACTCTCC
GAGATGGTCTTCATGGGATACAGAGAGGTGATATTGATGCTATGATCAGTAGTGCAAAGAGCATGGTCAGAAAGGCCAACGACATCACAG
ATGAGGTTCTGGATGGGCTCAACCCCATCCAGACAGATGTGGAAAGAATTAAGGACACCTATGGGAGGACACAGAACGAAGACTTCAAAA
AGGCTCTGACTGATGCAGATAACTCGGTGAATAAGTTAACCAACAAACTACCTGATCTTTGGCGCAAGATTGAAAGTATCAACCAACAGC
TGTTGCCCTTGGGAAACATCTCTGACAACATGGACAGAATACGAGAACTAATTCAGCAGGCCAGAGATGCTGCCAGTAAGGTTGCTGTCC
CCATGAGGTTCAATGGTAAATCTGGAGTCGAAGTCCGACTGCCAAATGACCTGGAAGATTTGAAAGGATATACATCTCTGTCCTTGTTTC
TCCAAAGGCCCAACTCAAGAGAAAATGGGGGTACTGAGAATATGTTTGTGATGTACCTTGGAAATAAAGATGCCTCCCGGGACTACATCG
GCATGGCAGTTGTGGATGGCCAGCTCACCTGTGTCTACAACCTGGGGGACCGTGAGGCTGAACTCCAAGTGGACCAGATCTTGACCAAGA
GTGAGACTAAGGAGGCAGTTATGGATCGGGTGAAATTTCAGAGAATTTATCAGTTTGCAAGGCTTAATTACACCAAAGGAGCCACATCCA
GTAAACCAGAAACACCCGGAGTCTATGACATGGATGGTAGAAATAGCAATACACTCCTTAATTTGGATCCTGAAAATGTTGTATTTTATG
TTGGAGGTTACCCACCTGATTTTAAACTTCCCAGTCGACTAAGTTTCCCTCCATACAAAGGTTGTATTGAATTAGATGACCTCAATGAAA
ATGTTCTGAGCTTGTACAACTTCAAAAAAACATTCAATCTCAACACAACTGAAGTGGAGCCTTGTAGAAGGAGGAAGGAAGAGTCAGACA
AAAATTATTTTGAAGGTACGGGCTATGCTCGAGTTCCAACTCAACCACATGCTCCCATCCCAACCTTTGGACAGACAATTCAGACCACCG
TGGATAGAGGCTTGCTGTTCTTTGCAGAAAACGGGGATCGCTTCATATCTCTAAATATAGAAGATGGCAAGCTCATGGTGAGATACAAAC
TGAATTCAGAGCTACCAAAAGAGAGAGGAGTTGGAGACGCCATAAACAACGGCAGAGACCATTCGATTCAGATCAAAATTGGAAAACTCC
AAAAGCGTATGTGGATAAATGTGGACGTTCAAAACACTATAATTGATGGTGAAGTATTTGATTTCAGCACATATTATCTGGGAGGAATTC
CAATTGCAATCAGGGAAAGATTTAACATTTCTACGCCTGCTTTCCGAGGCTGCATGAAAAATTTGAAGAAAACCAGTGGTGTCGTTAGAT
TGAATGATACTGTGGGAGTAACCAAAAAGTGCTCGGAAGACTGGAAGCTTGTGCGATCTGCCTCATTCTCCAGAGGAGGACAATTGAGTT
TCACTGATTTGGGCTTACCACCTACTGACCACCTCCAGGCCTCATTTGGATTTCAGACCTTTCAACCCAGTGGCATATTATTAGATCATC
AGACATGGACAAGGAACCTGCAGGTCACTCTGGAAGATGGTTACATTGAATTGAGCACCAGCGATAGCGGCAGCCCAATTTTTAAATCTC
CACAGACGTATATGGATGGTTTACTGCATTATGTATCTGTAATAAGCGACAACTCTGGACTACGGCTTCTCATCGATGACCAGCTTCTGA
GAAATAGCAAAAGGCTAAAACACATTTCAAGTTCCCGGCAGTCTCTGCGTCTGGGCGGGAGCAATTTTGAGGGTTGTATTAGCAATGTTT
TTGTCCAGAGGTTATCACTGAGTCCTGAAGTCCTAGATTTGACCAGTAACTCTCTCAAGAGAGATGTGTCCCTGGGAGGCTGCAGTTTAA
ACAAACCACCTTTTCTAATGTTGCTTAAAGGTTCTACCAGGTTTAACAAGACCAAGACTTTTCGTATCAACCAGCTGTTGCAGGACACAC
CAGTGGCCTCCCCAAGGAGCGTGAAGGTGTGGCAAGATGCTTGCTCACCACTTCCCAAGACCCAGGCCAATCATGGAGCCCTCCAGTTTG
GGGACATTCCCACCAGCCACTTGCTATTCAAGCTTCCTCAGGAGCTGCTGAAACCCAGGTCACAGTTTGCTGTGGACATGCAGACAACAT
CCTCCAGAGGACTGGTGTTTCACACGGGCACTAAGAACTCCTTTATGGCTCTTTATCTTTCAAAAGGACGTCTGGTCTTTGCACTGGGGA
CAGATGGGAAAAAATTGAGGATCAAAAGCAAGGAGAAATGCAATGATGGGAAATGGCACACGGTGGTGTTTGGCCATGATGGGGAAAAGG
GGCGCTTGGTTGTGGATGGACTGAGGGCCCGGGAGGGAAGTTTGCCTGGAAACTCCACCATCAGCATCAGAGCGCCAGTTTACCTGGGAT
CACCTCCATCAGGGAAACCAAAGAGCCTCCCCACAAACAGCTTTGTGGGATGCCTGAAGAACTTTCAGCTGGATTCAAAACCCTTGTATA
CCCCTTCTTCAAGCTTCGGGGTGTCTTCCTGCTTGGGTGGTCCTTTGGAGAAAGGCATTTATTTCTCTGAAGAAGGAGGTCATGTCGTCT
TGGCTCACTCTGTATTGTTGGGGCCAGAATTTAAGCTTGTTTTCAGCATCCGCCCAAGAAGTCTCACTGGGATCCTAATACACATCGGAA
GTCAGCCCGGGAAGCACTTATGTGTTTACCTGGAGGCAGGAAAGGTCACGGCCTCTATGGACAGTGGGGCAGGTGGGACCTCAACGTCGG
TCACACCAAAGCAGTCTCTGTGTGATGGACAGTGGCACTCGGTGGCAGTCACCATAAAACAACACATCCTGCACCTGGAACTGGACACAG
ACAGTAGCTACACAGCTGGACAGATCCCCTTCCCACCTGCCAGCACTCAAGAGCCACTACACCTTGGAGGTGCTCCAGCCAATTTGACGA
CACTGAGGATCCCTGTGTGGAAATCATTCTTTGGCTGTCTGAGGAATATTCATGTCAATCACATCCCTGTCCCTGTCACTGAAGCCTTGG
AAGTCCAGGGGCCTGTCAGTCTGAATGGTTGTCCTGACCAGTAACCCAAGCCTATTTCACAGCAAGGAAATTCACCTTCAAAAGCACTGA
TTACCCAATGCACCTCCCTCCCCAGCTCGAGATCATTCTTCACTCAGGACACAAACCAGACAGGTTTAATAGCGAATCTAATTTTGAATT
CTGACCATGGATACCCATCACTTTGGCATTCAGTGCTACATGTGTATTTTATATAAAAATCCCATTTCTTGAAGATAAAAAAATTGTTAT
TCAAATTGTTATGCACAGAATGTTTTTGGTAATATTAATTTCCACTAAAAAATTAAATGTCTTTTAAGAAACATTCTTTTCCACTTGTTA
AAAAAATTAAATATATTTTAAAGCACTTTAAGAATATGAAACTTTCATATATGTTAAAGGATTATAATTTATGGAATTAAAAAATGCAGT

>In-frame_ROCK1_ENST00000399799_chr18_18546878_-_LAMA3_ENST00000399516_chr18_21393021_+_12386nt
GCTGGTTCCCCTTCCGAGCGTCCGCGCCCCGCATGCGCAGTCTGCCCCGGCGGTCTCCGTTTGTTTGAACAGGAAGGCGGACATATTAGT
CCCTCTCAGCCCCCCTCGCCCCACCCCCCAGGCATTCGCCGCCGCGACTCGCCCTTTCCCCGGCTGGGACCGCAGCCCCTCCCAGAAGCT
CCCCCATCAGCAGCCGCCGGGACCCAACTATCGTCTTCCTCTTCGCCCGCTCTCCAGCCTTTCCTCTGCTAAGTCTCCATCGGGCATCGA
CCTCGCCCTGCCCCACCGGACACCGTAGCAGCAGCCCCAGCAGCGACGGGACAAAATGGGAGAGTGAGGCTGTCCTGCGTGGACCAGCTC
GTGGCCGAGACTGATCGGTGCGTCGGGCCGGGCCGAGTAGAGCCGGGGACGCGGGGCTAGACCGTCTACAGCGCCTCTGAGCGGAGCGGG
CCCGGCCCGTGGCCCGAGCGGCGGCCGCAGCTGGCACAGCTCCTCACCCGCCCTTTGCTTTCGCCTTTCCTCTTCTCCCTCCCTTGTTGC
CCGGAGGGAGTCTCCACCCTGCTTCTCTTTCTCTACCCGCTCCTGCCCATCTCGGGACGGGGACCCCTCCATGGCGACGGCGGCCGGGGC
CCGCTAGACTGAAGCACCTCGCCGGAGCGACGAGGCTGGTGGCGACGGCGCTGTCGGCTGTCGTGAGGGGCTGCCGGGTGGGATGCGACT
TTGGGCGTCCGAGCGGCTGTGGGTCGCTGTTGCCCCCGGCCCGGGGTCTGGAGAGCGGAGGTCCCCTCAGTGAGGGGAAGACGGGGGAAC
CGGGCGCACCTGGTGACCCTGAGGTTCCGGCTCCTCCGCCCCGCGGCTGCGAACCCACCGCGGAGGAAGTTGGTTGAAATTGCTTTCCGC
TGCTGGTGCTGGTAAGAGGGCATTGTCACAGCAGCAGCAACATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACC
TGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTGCTGGATGGATTGGATGCTTTGGTATATGATTTGGATTTTCCTGCCTTAA
GAAAAAACAAAAATATTGACAACTTTTTAAGCAGATATAAAGACACAATAAATAAAATCAGAGATTTACGAATGAAAGCTGAAGATTATG
AAGTAGTGAAGGTGATTGGTAGAGGTGCATTTGGAGAAGTTCAATTGGTAAGGCATAAATCCACCAGGAAGGTATATGCTATGAAGCTTC
TCAGCAAATTTGAAATGATAAAGAGATCTGATTCTGCTTTTTTCTGGGAAGAAAGGGACATCATGGCTTTTGCCAACAGTCCTTGGGTTG
TTCAGCTTTTTTATGCATTCCAAGATGATCGTTATCTCTACATGGTGATGGAATACATGCCTGGTGGAGATCTTGTAAACTTAATGAGCA
ACTATGATGTGCCTGAAAAATGGGCACGATTCTATACTGCAGAAGTAGTTCTTGCATTGGATGCAATCCATTCCATGGGTTTTATTCACA
GAGATGTGAAGCCTGATAACATGCTGCTGGATAAATCTGGACATTTGAAGTTAGCAGATTTTGGTACTTGTATGAAGATGAATAAGGAAG
GCATGGTACGATGTGATACAGCGGTTGGAACACCTGATTATATTTCCCCTGAAGTATTAAAATCCCAAGGTGGTGATGGTTATTATGGAA
GAGAATGTGACTGGTGGTCGGTTGGGGTATTTTTATACGAAATGCTTGTAGGTGATACACCTTTTTATGCAGATTCTTTGGTTGGAACTT
ACAGTAAAATTATGAACCATAAAAATTCACTTACCTTTCCTGATGATAATGACATATCAAAAGAAGCAAAAAACCTTATTTGTGCCTTCC
TTACTGACAGGGAAGTGAGGTTAGGGCGAAATGGTGTAGAAGAAATCAAACGACATCTCTTCTTCAAAAATGACCAGTGGGCTTGGGAAA
CGCTCCGAGACACTGTAGCACCAGTTGTACCCGATTTAAGTAGTGACATTGATACTAGTAATTTTGATGACTTGGAAGAAGATAAAGGAG
AGGAAGAAACATTCCCTATTCCTAAAGCTTTCGTTGGCAATCAACTACCTTTTGTAGGATTTACATATTATAGCAATCGTAGATACTTAT
CTTCAGCAAATCCTAATGATAACAGAACTAGCTCCAATGCAGATAAAAGCTTGCAGGAAAGTTTGCAAAAAACAATCTATAAGCTGGAAG
AACAGCTGCATAATGAAATGCAGTTAAAAGATGAAATGGAGCAGAAGTGCAGAACCTCAAACATAAAACTAGACAAGATAATGAAAGAAT
TGGATGAAGAGGGAAATCAAAGAAGAAATCTAGAATCTACAGTGTCTCAGATTGAGAAGGAGAAAATGTTGCTACAGCATAGAATTAATG
AGTACCAAAGAAAAGCTGAACAGGAAAATGAGAAGAGAAGAAATGTAGAAAATGAAGTTTCTACATTAAAGGATCAGTTGGAAGACTTAA
AGAAAGTCAGTCAGAATTCACAGCTTGCTAATGAGAAGCTGTCCCAGTTACAAAAGCAGCTAGAAGAAGCCAATGACTTACTTAGGACAG
AATCGGACACAGCTGTAAGATTGAGGAAGAGTCACACAGAGATGAGCAAGTCAATTAGTCAGTTAGAGTCCCTGAACAGAGAGTTGCAAG
AGAGAAATCGAATTTTAGAGAATTCTAAGTCACAAACAGACAAAGATTATTACCAGCTGCAAGCTATATTAGAAGCTGAACGAAGAGACA
GAGGTCATGATTCTGAGATGATTGGAGACCTTCAAGCTCGAATTACATCTTTACAAGAGGAGGTGAAGCATCTCAAACATAATCTCGAAA
AAGTGGAAGGAGAAAGAAAAGAGGCTCAAGACATGCTTAATCACTCAGAAAAGGAAAAGAATAATTTAGAGATAGATTTAAACTACAAAC
TTAAATCATTACAACAACGGTTAGAACAAGAGGTAAATGAACACAAAGTAACCAAAGCTCGTTTAACTGACAAACATCAATCTATTGAAG
AGGCAAAGTCTGTGGCAATGTGTGAGATGGAAAAAAAGCTGAAAGAAGAAAGAGAAGCTCGAGAGAAGGCTGAAAATCGGGTTGTTCAGA
TTGAGAAACAGTGTTCCATGCTAGACGTTGATCTGAAGCAATCTCAGCAGAAACTAGAACATTTGACTGGAAATAAAGAAAGGATGGAGG
ATGAAGTTAAGAATCTAACCCTGCAACTGGAGCAGGAATCAAATAAGCGGCTGTTGTTACAAAATGAATTGAAGACTCAAGCATTTGAGG
CAGACAATTTAAAAGGTTTAGAAAAGCAGATGAAACAGGAAATAAATACTTTATTGGAAGCAAAGAGATTATTAGAATTTGAGTTAGCTC
AGCTTACGAAACAGTATAGAGGAAATGAAGGACAGATGCGGGAGCTACAAGATCAGCTTGAAGCTGAGCAATATTTCTCGACACTTTATA
AAACCCAGGTAAAGGAACTTAAAGAAGAAATTGAAGAAAAAAACAGAGAAAATTTAAAGAAAATACAGGAACTACAAAATGAAAAAGAAA
CTCTTGCTACTCAGTTGGATCTAGCAGAAACAAAAGCTGAGTCTGAGCAGTTGGCGCGAGGCCTTCTGGAAGAACAGTATTTTGAATTGA
CGCAAGAAAGCAAGAAAGCTGCTTCAAGAAATAGACAAGAGATTACAGATAAAGATCACACTGTTAGTCGGCTTGAAGAAGCAAACAGCA
TGCTAACCAAAGATATTGAAATATTAAGAAGAGAGAATGAAGAGCTAACAGAGAAAATGAAGAAGGCAGAGGAAGAATATAAACTGGAGA
AGGAGGAGGAGATCAGTAATCTTAAGGCTGCCTTTGAAAAGAATATCAACACTGAACGAACCCTTAAAACACAGGCTGTTAACAAATTGG
CAGAAATAATGAATCGAAAAGATTTTAAAATTGATAGAAAGAAAGCTAATACACAAGATTTGAGAAAGAAAGAAAAGGAAAATCGAAAGC
TGCAACTGGAACTCAACCAAGAAAGAGAGAAATTCAACCAGATGGTAGTGAAACATCAGAAGGAACTGAATGACATGCAAGCGCAATTGG
TAGAAGAATGTGCACATAGGAATGAGCTTCAGATGCAGTTGGCCAGCAAAGAGAGTGATATTGAGCAATTGCGTGCTAAACTTTTGGACC
TCTCGGATTCTACAAGTGTTGCTAGTTTTCCTAGTGCTGATGAAACTGATGGTAACCTCCCAGGTTCCAGCAGTGCTTGTGACCCAGCTG
GTACCATCAACTCCAATTTGGGGTATTGCCAATGCAAGCTTCATGTTGAAGGTCCTACTTGTAGCCGCTGCAAACTGTTATATTGGAATC
TGGACAAAGAAAACCCCAGTGGATGTTCAGAATGCAAGTGCCATAAGGCGGGAACAGTGAGTGGAACTGGAGAGTGTAGGCAGGGAGATG
GTGACTGTCACTGCAAGTCCCATGTGGGTGGCGATTCCTGCGACACCTGTGAAGATGGATATTTTGCTTTGGAAAAGAGCAATTACTTTG
GGTGTCAAGGGTGTCAGTGTGACATTGGTGGGGCATTGTCCTCCATGTGCAGTGGGCCCTCGGGAGTGTGCCAGTGCCGAGAGCATGTCG
TGGGAAAGGTGTGCCAGCGGCCTGAAAACAACTACTATTTCCCAGATTTGCATCATATGAAGTATGAGATTGAAGACGGCAGCACACCTA
ATGGGAGAGACCTTCGATTTGGATTTGATCCGCTGGCATTTCCTGAGTTTAGCTGGAGAGGATATGCCCAAATGACCTCAGTACAGAATG
ATGTAAGAATAACATTGAATGTAGGGAAGTCAAGTGGCTCCTTGTTTCGTGTTATTCTGAGATACGTTAACCCTGGAACTGAAGCAGTAT
CTGGCCATATAACTATTTATCCATCCTGGGGTGCTGCTCAAAGCAAAGAGATCATCTTCCTGCCGAGTAAGGAGCCAGCCTTTGTCACTG
TCCCTGGAAATGGTTTTGCAGACCCATTTTCAATCACACCAGGAATATGGGTTGCTTGTATTAAGGCAGAAGGAGTCCTTCTGGATTACC
TGGTGCTGCTCCCCAGGGACTACTATGAAGCCTCTGTACTGCAGCTGCCAGTCACAGAACCATGTGCCTACGCAGGACCTCCCCAAGAAA
ATTGCTTACTCTACCAGCATTTGCCAGTGACCAGATTCCCCTGTACCCTGGCTTGTGAGGCCAGACACTTCCTGCTTGATGGGGAGCCAA
GACCCGTGGCAGTGAGGCAGCCCACACCTGCACACCCTGTCATGGTGGACCTCAGCGGGAGAGAGGTGGAATTGCATCTGCGGCTGCGCA
TCCCACAGGTTGGCCACTACGTGGTTGTGGTCGAGTATTCCACGGAGGCAGCTCAGCTGTTTGTGGTTGATGTGAATGTGAAGAGCTCCG
GGTCTGTTCTGGCAGGCCAGGTGAACATTTACAGCTGCAACTACAGTGTTCTCTGCCGGAGTGCTGTGATTGATCACATGAGCCGCATCG
CCATGTATGAGCTATTGGCAGATGCAGACATTCAGCTCAAGGGACACATGGCCCGATTCCTTCTGCATCAAGTTTGTATCATACCTATTG
AAGAATTCTCAGCTGAGTATGTGAGACCACAAGTCCACTGCATTGCCAGTTATGGGCGATTTGTCAATCAAAGTGCCACCTGTGTCTCCT
TGGCCCATGAAACTCCTCCAACAGCATTAATTTTGGATGTTCTAAGTGGCAGGCCTTTCCCTCACCTGCCCCAGCAGTCGTCACCTTCTG
TTGATGTTCTTCCTGGGGTCACCTTGAAGGCACCGCAGAATCAAGTGACCCTGAGAGGACGTGTACCACACCTGGGCCGATACGTCTTTG
TCATCCATTTTTACCAAGCAGCGCACCCGACGTTTCCCGCGCAGGTGTCGGTGGATGGCGGGTGGCCACGGGCAGGCTCCTTCCATGCCT
CTTTTTGCCCCCATGTGCTTGGCTGCCGGGATCAAGTGATTGCCGAAGGCCAGATTGAGTTTGACATCTCAGAGCCTGAAGTGGCCGCAA
CTGTGAAGGTTCCAGAAGGAAAGTCCTTGGTTTTGGTCCGTGTTCTAGTGGTGCCTGCAGAAAACTATGACTACCAAATACTTCACAAAA
AATCCATGGACAAGTCACTCGAGTTTATCACCAATTGTGGAAAAAACAGCTTTTACCTTGACCCCCAGACAGCCTCCAGATTCTGTAAGA
ATTCCGCCAGGTCCCTGGTGGCCTTTTACCACAAGGGCGCCCTGCCTTGTGAGTGCCACCCCACTGGGGCCACCGGCCCTCACTGCAGCC
CTGAGGGTGGGCAGTGCCCATGCCAGCCCAACGTCATCGGGCGGCAGTGCACCCGCTGTGCAACAGGCCACTACGGATTCCCACGCTGCA
AGCCGTGCAGCTGTGGTCGGCGCCTTTGTGAAGAGATGACGGGGCAGTGCCGCTGCCCTCCCCGCACGGTCAGGCCCCAGTGTGAGGTGT
GTGAGACACACTCATTCAGCTTCCACCCCATGGCCGGCTGCGAAGGCTGCAACTGTTCCAGGAGGGGCACCATCGAGGCTGCCATGCCGG
AGTGTGACCGGGACAGCGGGCAGTGCAGATGCAAGCCCAGAATCACAGGGCGGCAGTGTGACCGATGTGCTTCCGGGTTTTACCGCTTTC
CTGAGTGTGTTCCCTGCAATTGCAACAGAGATGGGACTGAGCCAGGAGTGTGTGACCCAGGGACCGGGGCTTGCCTCTGCAAGGAAAATG
TAGAAGGCACAGAGTGTAATGTGTGTCGAGAAGGCTCATTCCATTTGGACCCAGCCAATCTCAAGGGTTGTACCAGCTGTTTCTGTTTTG
GAGTAAATAATCAATGTCACAGCTCACATAAGCGAAGGACTAAGTTTGTGGATATGCTGGGCTGGCACCTGGAGACAGCAGACAGAGTGG
ACATCCCTGTCTCTTTCAACCCAGGCAGCAACAGTATGGTGGCGGATCTCCAGGAGCTGCCCGCAACCATCCACAGCGCGTCCTGGGTCG
CACCCACCTCCTACCTGGGGGACAAGGTTTCTTCATATGGTGGTTACCTCACTTACCAAGCCAAGTCCTTTGGCTTGCCTGGCGACATGG
TTCTTCTGGAAAAGAAGCCGGATGTACAGCTCACTGGTCAGCACATGTCCATCATCTATGAGGAGACAAACACCCCACGGCCAGACCGGC
TGCATCATGGACGAGTGCACGTGGTCGAGGGAAACTTCAGACATGCCAGCAGCCGTGCCCCAGTGTCTAGGGAGGAGCTGATGACAGTGC
TGTCTAGACTGGCAGATGTGCGCATCCAAGGCCTCTACTTCACAGAGACTCAAAGGCTCACCCTGAGCGAGGTGGGGCTAGAGGAAGCCT
CTGACACAGGAAGTGGGCGCATAGCACTTGCTGTGGAAATCTGTGCCTGCCCCCCTGCCTACGCTGGTGACTCTTGTCAGGGTTGTAGCC
CTGGATACTATCGGGATCATAAAGGCTTGTATACCGGACGGTGTGTTCCCTGCAATTGCAACGGACATTCAAATCAATGCCAGGATGGCT
CAGGCATATGTGTTAACTGTCAGCACAACACCGCGGGAGAGCACTGTGAACGCTGCCAGGAGGGCTACTATGGCAACGCCGTCCACGGAT
CCTGCAGGGCCTGCCCATGTCCTCACACTAACAGCTTTGCCACTGGCTGTGTGGTGAATGGGGGAGACGTGCGGTGCTCCTGCAAAGCTG
GGTACACAGGAACACAGTGTGAAAGGTGTGCACCGGGATATTTCGGGAATCCCCAGAAATTCGGAGGTAGCTGCCAACCATGCAGTTGTA
ACAGCAATGGCCAGCTGGGCAGCTGTCATCCCCTGACTGGAGACTGCATAAACCAAGAACCCAAAGATAGCAGCCCTGCAGAAGAATGTG
ATGATTGCGACAGCTGTGTGATGACCCTCCTGAACGACCTGGCCACCATGGGCGAGCAGCTCCGCCTGGTCAAGTCTCAGCTGCAGGGCC
TGAGTGCCAGCGCAGGGCTTCTGGAGCAGATGAGGCACATGGAGACCCAGGCCAAGGACCTGAGGAATCAGTTGCTCAACTACCGTTCTG
CCATTTCAAATCATGGATCAAAAATAGAAGGCCTGGAAAGAGAACTGACTGATTTGAATCAAGAATTTGAGACTTTGCAAGAAAAGGCTC
AAGTAAATTCCAGAAAAGCACAAACATTAAACAACAATGTTAATCGGGCAACACAAAGCGCAAAAGAACTGGATGTGAAGATTAAAAATG
TCATCCGGAATGTGCACATGCTGAACCGGATAAGGACCTGGCAGAAAACCCACCAGGGGGAGAACAATGGGCTTGCTAACAGTATCCGGG
ATTCTTTAAATGAATACGAAGCCAAACTCAGTGACCTTCGTGCTCGGCTGCAGGAGGCAGCTGCCCAAGCCAAGCAGGCAAATGGCTTGA
ACCAAGAAAACGAGAGAGCTTTGGGAGCCATTCAGAGACAAGTGAAAGAAATAAATTCCCTGCAGAGTGATTTCACCAAGTATCTAACCA
CTGCAGACTCATCTTTGTTGCAAACCAACATTGCGCTGCAGCTGATGGAGAAAAGCCAGAAGGAATATGAAAAATTAGCTGCCAGTTTAA
ATGAAGCAAGACAAGAACTAAGTGACAAAGTAAGAGAACTTTCCAGATCTGCTGGCAAAACATCCCTTGTGGAGGAGGCAGAAAAGCACG
CGCGGTCCTTACAAGAGCTGGCAAAGCAGCTGGAAGAGATCAAGAGAAACGCCAGCGGGGATGAGCTGGTGCGCTGTGCTGTGGATGCCG
CCACCGCCTACGAGAACATCCTCAATGCCATCAAAGCGGCCGAGGACGCAGCCAACAGGGCTGCCAGTGCATCTGAATCTGCCCTCCAGA
CAGTGATAAAGGAAGATCTGCCAAGAAAAGCTAAAACCCTGAGTTCCAACAGTGATAAACTGTTAAATGAAGCCAAGATGACACAAAAGA
AGCTAAAGCAAGAAGTCAGTCCAGCTCTCAACAACCTACAGCAAACCCTGAATATTGTGACAGTTCAGAAAGAAGTGATAGACACCAATC
TCACAACTCTCCGAGATGGTCTTCATGGGATACAGAGAGGTGATATTGATGCTATGATCAGTAGTGCAAAGAGCATGGTCAGAAAGGCCA
ACGACATCACAGATGAGGTTCTGGATGGGCTCAACCCCATCCAGACAGATGTGGAAAGAATTAAGGACACCTATGGGAGGACACAGAACG
AAGACTTCAAAAAGGCTCTGACTGATGCAGATAACTCGGTGAATAAGTTAACCAACAAACTACCTGATCTTTGGCGCAAGATTGAAAGTA
TCAACCAACAGCTGTTGCCCTTGGGAAACATCTCTGACAACATGGACAGAATACGAGAACTAATTCAGCAGGCCAGAGATGCTGCCAGTA
AGGTTGCTGTCCCCATGAGGTTCAATGGTAAATCTGGAGTCGAAGTCCGACTGCCAAATGACCTGGAAGATTTGAAAGGATATACATCTC
TGTCCTTGTTTCTCCAAAGGCCCAACTCAAGAGAAAATGGGGGTACTGAGAATATGTTTGTGATGTACCTTGGAAATAAAGATGCCTCCC
GGGACTACATCGGCATGGCAGTTGTGGATGGCCAGCTCACCTGTGTCTACAACCTGGGGGACCGTGAGGCTGAACTCCAAGTGGACCAGA
TCTTGACCAAGAGTGAGACTAAGGAGGCAGTTATGGATCGGGTGAAATTTCAGAGAATTTATCAGTTTGCAAGGCTTAATTACACCAAAG
GAGCCACATCCAGTAAACCAGAAACACCCGGAGTCTATGACATGGATGGTAGAAATAGCAATACACTCCTTAATTTGGATCCTGAAAATG
TTGTATTTTATGTTGGAGGTTACCCACCTGATTTTAAACTTCCCAGTCGACTAAGTTTCCCTCCATACAAAGGTTGTATTGAATTAGATG
ACCTCAATGAAAATGTTCTGAGCTTGTACAACTTCAAAAAAACATTCAATCTCAACACAACTGAAGTGGAGCCTTGTAGAAGGAGGAAGG
AAGAGTCAGACAAAAATTATTTTGAAGGTACGGGCTATGCTCGAGTTCCAACTCAACCACATGCTCCCATCCCAACCTTTGGACAGACAA
TTCAGACCACCGTGGATAGAGGCTTGCTGTTCTTTGCAGAAAACGGGGATCGCTTCATATCTCTAAATATAGAAGATGGCAAGCTCATGG
TGAGATACAAACTGAATTCAGAGCTACCAAAAGAGAGAGGAGTTGGAGACGCCATAAACAACGGCAGAGACCATTCGATTCAGATCAAAA
TTGGAAAACTCCAAAAGCGTATGTGGATAAATGTGGACGTTCAAAACACTATAATTGATGGTGAAGTATTTGATTTCAGCACATATTATC
TGGGAGGAATTCCAATTGCAATCAGGGAAAGATTTAACATTTCTACGCCTGCTTTCCGAGGCTGCATGAAAAATTTGAAGAAAACCAGTG
GTGTCGTTAGATTGAATGATACTGTGGGAGTAACCAAAAAGTGCTCGGAAGACTGGAAGCTTGTGCGATCTGCCTCATTCTCCAGAGGAG
GACAATTGAGTTTCACTGATTTGGGCTTACCACCTACTGACCACCTCCAGGCCTCATTTGGATTTCAGACCTTTCAACCCAGTGGCATAT
TATTAGATCATCAGACATGGACAAGGAACCTGCAGGTCACTCTGGAAGATGGTTACATTGAATTGAGCACCAGCGATAGCGGCAGCCCAA
TTTTTAAATCTCCACAGACGTATATGGATGGTTTACTGCATTATGTATCTGTAATAAGCGACAACTCTGGACTACGGCTTCTCATCGATG
ACCAGCTTCTGAGAAATAGCAAAAGGCTAAAACACATTTCAAGTTCCCGGCAGTCTCTGCGTCTGGGCGGGAGCAATTTTGAGGGTTGTA
TTAGCAATGTTTTTGTCCAGAGGTTATCACTGAGTCCTGAAGTCCTAGATTTGACCAGTAACTCTCTCAAGAGAGATGTGTCCCTGGGAG
GCTGCAGTTTAAACAAACCACCTTTTCTAATGTTGCTTAAAGGTTCTACCAGGTTTAACAAGACCAAGACTTTTCGTATCAACCAGCTGT
TGCAGGACACACCAGTGGCCTCCCCAAGGAGCGTGAAGGTGTGGCAAGATGCTTGCTCACCACTTCCCAAGACCCAGGCCAATCATGGAG
CCCTCCAGTTTGGGGACATTCCCACCAGCCACTTGCTATTCAAGCTTCCTCAGGAGCTGCTGAAACCCAGGTCACAGTTTGCTGTGGACA
TGCAGACAACATCCTCCAGAGGACTGGTGTTTCACACGGGCACTAAGAACTCCTTTATGGCTCTTTATCTTTCAAAAGGACGTCTGGTCT
TTGCACTGGGGACAGATGGGAAAAAATTGAGGATCAAAAGCAAGGAGAAATGCAATGATGGGAAATGGCACACGGTGGTGTTTGGCCATG
ATGGGGAAAAGGGGCGCTTGGTTGTGGATGGACTGAGGGCCCGGGAGGGAAGTTTGCCTGGAAACTCCACCATCAGCATCAGAGCGCCAG
TTTACCTGGGATCACCTCCATCAGGGAAACCAAAGAGCCTCCCCACAAACAGCTTTGTGGGATGCCTGAAGAACTTTCAGCTGGATTCAA
AACCCTTGTATACCCCTTCTTCAAGCTTCGGGGTGTCTTCCTGCTTGGGTGGTCCTTTGGAGAAAGGCATTTATTTCTCTGAAGAAGGAG
GTCATGTCGTCTTGGCTCACTCTGTATTGTTGGGGCCAGAATTTAAGCTTGTTTTCAGCATCCGCCCAAGAAGTCTCACTGGGATCCTAA
TACACATCGGAAGTCAGCCCGGGAAGCACTTATGTGTTTACCTGGAGGCAGGAAAGGTCACGGCCTCTATGGACAGTGGGGCAGGTGGGA
CCTCAACGTCGGTCACACCAAAGCAGTCTCTGTGTGATGGACAGTGGCACTCGGTGGCAGTCACCATAAAACAACACATCCTGCACCTGG
AACTGGACACAGACAGTAGCTACACAGCTGGACAGATCCCCTTCCCACCTGCCAGCACTCAAGAGCCACTACACCTTGGAGGTGCTCCAG
CCAATTTGACGACACTGAGGATCCCTGTGTGGAAATCATTCTTTGGCTGTCTGAGGAATATTCATGTCAATCACATCCCTGTCCCTGTCA


Top

FusionGenePPI for ROCK1_LAMA3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ROCK1CDC25A, PFN2, RHOA, RND3, GAB1, CFL1, LIMK2, HNRNPA1, ITSN2, ARRB1, TSG101, NOTCH1, SMURF1, SMAD2, CASP3, CASP7, CDK15, ANKFY1, MON2, FAM21A, KIAA1033, IKBKB, LMO2, MAGEB4, POLR3C, C6orf165, FAM124A, NXF1, NTRK1, MED23, XRCC5, NEIL3, TRIM15, HGS, SLC9A1, UBE2T, CDKN3, TENC1, ROCK2, ADD2, IL20RA, CYLDLAMA3SDC2, APC, SIRT1, TUBG1, TSHR, TAZ, PTPRK, PLG, PLAT, SPINK4, CD44, DEFA1, SCGB2A2, GML, SCGB1D4, SLAMF1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneROCK1chr18:18546878chr18:21393021ENST00000399799-2733368_72711171355FHOD1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ROCK1_LAMA3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ROCK1_LAMA3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneLAMA3C0027339Nail Diseases1CTD_human
TgeneLAMA3C0037299Skin Ulcer1CTD_human;HPO
TgeneLAMA3C0079301Junctional Epidermolysis Bullosa1CTD_human
TgeneLAMA3C1328355Laryngoonychocutaneous syndrome1CTD_human;ORPHANET