FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31682

FusionGeneSummary for ROCK1_DCC

check button Fusion gene summary
Fusion gene informationFusion gene name: ROCK1_DCC
Fusion gene ID: 31682
HgeneTgene
Gene symbol

ROCK1

DCC

Gene ID

6093

1630

Gene nameRho associated coiled-coil containing protein kinase 1DCC netrin 1 receptor
SynonymsP160ROCK|ROCK-ICRC18|CRCR1|HGPPS2|IGDCC1|MRMV1|NTN1R1
Cytomap

18q11.1

18q21.2

Type of geneprotein-codingprotein-coding
Descriptionrho-associated protein kinase 1p160 ROCK-1renal carcinoma antigen NY-REN-35netrin receptor DCCcolorectal cancer suppressordeleted in colorectal carcinomaimmunoglobulin superfamily DCC subclass member 1putative colorectal tumor suppressortumor suppressor protein DCC
Modification date2018052720180519
UniProtAcc

Q13464

P43146

Ensembl transtripts involved in fusion geneENST00000399799, ENST00000442544, 
ENST00000412726, ENST00000581580, 
ENST00000580146, 
Fusion gene scores* DoF score21 X 11 X 11=25417 X 7 X 6=294
# samples 238
** MAII scorelog2(23/2541*10)=-3.46569060910898
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/294*10)=-1.877744249949
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ROCK1 [Title/Abstract] AND DCC [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneROCK1

GO:0007159

leukocyte cell-cell adhesion

12082081

HgeneROCK1

GO:0022614

membrane to membrane docking

12082081

HgeneROCK1

GO:0032091

negative regulation of protein binding

18573880

HgeneROCK1

GO:0032956

regulation of actin cytoskeleton organization

25911094

HgeneROCK1

GO:0050900

leukocyte migration

12082081

HgeneROCK1

GO:0050901

leukocyte tethering or rolling

12082081


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-CV-5434-01AROCK1chr18

18586312

-DCCchr18

50912413

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000399799ENST00000442544ROCK1chr18

18586312

-DCCchr18

50912413

+
In-frameENST00000399799ENST00000412726ROCK1chr18

18586312

-DCCchr18

50912413

+
In-frameENST00000399799ENST00000581580ROCK1chr18

18586312

-DCCchr18

50912413

+
5CDS-intronENST00000399799ENST00000580146ROCK1chr18

18586312

-DCCchr18

50912413

+

Top

FusionProtFeatures for ROCK1_DCC


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ROCK1

Q13464

DCC

P43146

Protein kinase which is a key regulator of actincytoskeleton and cell polarity. Involved in regulation of smoothmuscle contraction, actin cytoskeleton organization, stress fiberand focal adhesion formation, neurite retraction, cell adhesionand motility via phosphorylation of DAPK3, GFAP, LIMK1, LIMK2,MYL9/MLC2, PFN1 and PPP1R12A. Phosphorylates FHOD1 and actssynergistically with it to promote SRC-dependent non-apoptoticplasma membrane blebbing. Phosphorylates JIP3 and regulates therecruitment of JNK to JIP3 upon UVB-induced stress. Acts as asuppressor of inflammatory cell migration by regulating PTENphosphorylation and stability. Acts as a negative regulator ofVEGF-induced angiogenic endothelial cell activation. Required forcentrosome positioning and centrosome-dependent exit from mitosis.Plays a role in terminal erythroid differentiation. May regulateclosure of the eyelids and ventral body wall by inducing theassembly of actomyosin bundles. Promotes keratinocyte terminaldifferentiation. Involved in osteoblast compaction through thefibronectin fibrillogenesis cell-mediated matrix assembly process,essential for osteoblast mineralization.{ECO:0000269|PubMed:10436159, ECO:0000269|PubMed:10652353,ECO:0000269|PubMed:11018042, ECO:0000269|PubMed:11283607,ECO:0000269|PubMed:17158456, ECO:0000269|PubMed:18573880,ECO:0000269|PubMed:18694941, ECO:0000269|PubMed:19036714,ECO:0000269|PubMed:19131646, ECO:0000269|PubMed:19181962,ECO:0000269|PubMed:19997641, ECO:0000269|PubMed:21072057,ECO:0000269|PubMed:8617235, ECO:0000269|PubMed:9722579}. Receptor for netrin required for axon guidance. Mediatesaxon attraction of neuronal growth cones in the developing nervoussystem upon ligand binding. Its association with UNC5 proteins maytrigger signaling for axon repulsion. It also acts as a dependencereceptor required for apoptosis induction when not associated withnetrin ligand. Implicated as a tumor suppressor gene.{ECO:0000269|PubMed:8187090, ECO:0000269|PubMed:8861902}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneROCK1chr18:18586312chr18:50912413ENST00000399799-1633341_4096281355DomainNote=AGC-kinase C-terminal
HgeneROCK1chr18:18586312chr18:50912413ENST00000399799-1633479_5566281355DomainREM-1
HgeneROCK1chr18:18586312chr18:50912413ENST00000399799-163376_3386281355DomainProtein kinase
HgeneROCK1chr18:18586312chr18:50912413ENST00000399799-163382_906281355Nucleotide bindingATP
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+1429846_9427861448DomainFibronectin type-III 5
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+1429947_10447861448DomainFibronectin type-III 6
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+14291123_14477861448Topological domainCytoplasmic
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+14291098_11227861448TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneROCK1chr18:18586312chr18:50912413ENST00000399799-16331011_11026281355Coiled coilOntology_term=ECO:0000255
HgeneROCK1chr18:18586312chr18:50912413ENST00000399799-1633422_6926281355Coiled coilOntology_term=ECO:0000255
HgeneROCK1chr18:18586312chr18:50912413ENST00000399799-1633636_9806281355Compositional biasNote=Glu-rich
HgeneROCK1chr18:18586312chr18:50912413ENST00000399799-16331118_13176281355DomainPH
HgeneROCK1chr18:18586312chr18:50912413ENST00000399799-1633949_10156281355DomainRhoBD
HgeneROCK1chr18:18586312chr18:50912413ENST00000399799-16331115_13546281355RegionNote=Auto-inhibitory
HgeneROCK1chr18:18586312chr18:50912413ENST00000399799-1633998_10106281355RegionNote=RHOA binding
HgeneROCK1chr18:18586312chr18:50912413ENST00000399799-16331228_12816281355Zinc fingerPhorbol-ester/DAG-type
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+1429139_2297861448DomainNote=Ig-like C2-type 2
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+1429234_3267861448DomainNote=Ig-like C2-type 3
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+142926_1357861448DomainNote=Ig-like C2-type 1
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+1429331_4167861448DomainNote=Ig-like C2-type 4
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+1429431_5247861448DomainFibronectin type-III 1
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+1429530_6207861448DomainFibronectin type-III 2
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+1429625_7187861448DomainFibronectin type-III 3
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+1429728_8217861448DomainFibronectin type-III 4
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+142926_10977861448Topological domainExtracellular


Top

FusionGeneSequence for ROCK1_DCC


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ROCK1_ENST00000399799_chr18_18586312_-_DCC_ENST00000442544_chr18_50912413_+_1290aa
MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVTDLDFPALRKNKNIDNFLSRTKDTINKIRDLRMKAEDTEVVKVIGRGAFGEV
QLVRHKSTRKVTAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFTAFQDDRTLYMVMEYMPGGDLVNLMSNTDVPEKWARFTTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDTISPEVLKSQGGDGTTGRECDWWSVGVFLYE
MLVGDTPFTADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTTTSNRRYLSSANPNDNRTSSNADKSLQESLQKTITKLEEQLHNEMQLKDEME
QKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTDKDTYQLQAILEAERRDRGHDSEMIGDLQES
SSHTVISLKAFNNAGEGVPLTESATTRSITDPTDPVDTTPLLDDFPTSVPDLSTPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEV
RLYTVRWRTSFSASAKYKSEDTTSLSYTATGLKPNTMTEFSVMVTKNRRSSTWSMTAHATTTEAAPTSAPKDLTVITREGKPRAVIVSWQ
PPLEANGKITAYILFTTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMTYFRIQARNSKGVGPLSDPILFRTLKVEHPDKMANDQGRHG
DGGTWPVDTNLIDRSTLNEPPIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQQRKKRATHSAGKRKGSQKDL
RPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVSHSQSETQLGSKSTSHSGQDTEEAGSSMSTLERSLAARRAPRAKLMIPM
DAQSNNPAVVSAIPVPTLESAQYPGILPSPTCGTPHPQFTLRPVPFPTLSVDRGFGAGRSQSVSEGPTTQQPPMLPPSQPEHSSSEEAPS
RTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSAN

>In-frame_ROCK1_ENST00000399799_chr18_18586312_-_DCC_ENST00000412726_chr18_50912413_+_892aa
MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVTDLDFPALRKNKNIDNFLSRTKDTINKIRDLRMKAEDTEVVKVIGRGAFGEV
QLVRHKSTRKVTAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFTAFQDDRTLYMVMEYMPGGDLVNLMSNTDVPEKWARFTTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDTISPEVLKSQGGDGTTGRECDWWSVGVFLYE
MLVGDTPFTADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTTTSNRRYLSSANPNDNRTSSNADKSLQESLQKTITKLEEQLHNEMQLKDEME
QKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTDKDTYQLQAILEAERRDRGHDSEMIGDLQES
SSHTVISLKAFNNAGEGVPLTESATTRSITDLSTPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSASAKYKSE
DTTSLSYTATGLKPNTMTEFSVMVTKNRRSSTWSMTAHATTTEAAPTSAPKDLTVITREGKPRAVIVSWQPPLEANGKITAYILFTTLDK

>In-frame_ROCK1_ENST00000399799_chr18_18586312_-_DCC_ENST00000581580_chr18_50912413_+_1264aa
MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVTDLDFPALRKNKNIDNFLSRTKDTINKIRDLRMKAEDTEVVKVIGRGAFGEV
QLVRHKSTRKVTAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFTAFQDDRTLYMVMEYMPGGDLVNLMSNTDVPEKWARFTTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDTISPEVLKSQGGDGTTGRECDWWSVGVFLYE
MLVGDTPFTADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTTTSNRRYLSSANPNDNRTSSNADKSLQESLQKTITKLEEQLHNEMQLKDEME
QKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTDKDTYQLQAILEAERRDRGHDSEMIGDLQES
SSHTVISLKAFNNAGEGVPLTESATTRSITDLSTPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSASAKYKSE
DTTSLSYTATGLKPNTMTEFSVMVTKNRRSSTWSMTAHATTTEAAPTSAPKDLTVITREGKPRAVIVSWQPPLEANGKITAYILFTTLDK
NIPIDDWIMETISGDRLTHQIMDLNLDTMTYFRIQARNSKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGTWPVDTNLIDRSTLNEP
PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQQRKKRATHSAGKRKGSQKDLRPPDLWIHHEEMEMKNIEKP
SGTDPAGRDSPIQSCQDLTPVSHSQSETQLGSKSTSHSGQDTEEAGSSMSTLERSLAARRAPRAKLMIPMDAQSNNPAVVSAIPVPTLES
AQYPGILPSPTCGTPHPQFTLRPVPFPTLSVDRGFGAGRTVSEGPTTQQPPMLPPSQPEHSSSEEAPSRTIPTACVRPTHPLRSFANPLL
PPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVEMEWVKQTAISTTPLLLPASS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ROCK1_ENST00000399799_chr18_18586312_-_DCC_ENST00000442544_chr18_50912413_+_3870nt
ATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACCTGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTG
CTGGATGGATTGGATGCTTTGGTATATGATTTGGATTTTCCTGCCTTAAGAAAAAACAAAAATATTGACAACTTTTTAAGCAGATATAAA
GACACAATAAATAAAATCAGAGATTTACGAATGAAAGCTGAAGATTATGAAGTAGTGAAGGTGATTGGTAGAGGTGCATTTGGAGAAGTT
CAATTGGTAAGGCATAAATCCACCAGGAAGGTATATGCTATGAAGCTTCTCAGCAAATTTGAAATGATAAAGAGATCTGATTCTGCTTTT
TTCTGGGAAGAAAGGGACATCATGGCTTTTGCCAACAGTCCTTGGGTTGTTCAGCTTTTTTATGCATTCCAAGATGATCGTTATCTCTAC
ATGGTGATGGAATACATGCCTGGTGGAGATCTTGTAAACTTAATGAGCAACTATGATGTGCCTGAAAAATGGGCACGATTCTATACTGCA
GAAGTAGTTCTTGCATTGGATGCAATCCATTCCATGGGTTTTATTCACAGAGATGTGAAGCCTGATAACATGCTGCTGGATAAATCTGGA
CATTTGAAGTTAGCAGATTTTGGTACTTGTATGAAGATGAATAAGGAAGGCATGGTACGATGTGATACAGCGGTTGGAACACCTGATTAT
ATTTCCCCTGAAGTATTAAAATCCCAAGGTGGTGATGGTTATTATGGAAGAGAATGTGACTGGTGGTCGGTTGGGGTATTTTTATACGAA
ATGCTTGTAGGTGATACACCTTTTTATGCAGATTCTTTGGTTGGAACTTACAGTAAAATTATGAACCATAAAAATTCACTTACCTTTCCT
GATGATAATGACATATCAAAAGAAGCAAAAAACCTTATTTGTGCCTTCCTTACTGACAGGGAAGTGAGGTTAGGGCGAAATGGTGTAGAA
GAAATCAAACGACATCTCTTCTTCAAAAATGACCAGTGGGCTTGGGAAACGCTCCGAGACACTGTAGCACCAGTTGTACCCGATTTAAGT
AGTGACATTGATACTAGTAATTTTGATGACTTGGAAGAAGATAAAGGAGAGGAAGAAACATTCCCTATTCCTAAAGCTTTCGTTGGCAAT
CAACTACCTTTTGTAGGATTTACATATTATAGCAATCGTAGATACTTATCTTCAGCAAATCCTAATGATAACAGAACTAGCTCCAATGCA
GATAAAAGCTTGCAGGAAAGTTTGCAAAAAACAATCTATAAGCTGGAAGAACAGCTGCATAATGAAATGCAGTTAAAAGATGAAATGGAG
CAGAAGTGCAGAACCTCAAACATAAAACTAGACAAGATAATGAAAGAATTGGATGAAGAGGGAAATCAAAGAAGAAATCTAGAATCTACA
GTGTCTCAGATTGAGAAGGAGAAAATGTTGCTACAGCATAGAATTAATGAGTACCAAAGAAAAGCTGAACAGGAAAATGAGAAGAGAAGA
AATGTAGAAAATGAAGTTTCTACATTAAAGGATCAGTTGGAAGACTTAAAGAAAGTCAGTCAGAATTCACAGCTTGCTAATGAGAAGCTG
TCCCAGTTACAAAAGCAGCTAGAAGAAGCCAATGACTTACTTAGGACAGAATCGGACACAGCTGTAAGATTGAGGAAGAGTCACACAGAG
ATGAGCAAGTCAATTAGTCAGTTAGAGTCCCTGAACAGAGAGTTGCAAGAGAGAAATCGAATTTTAGAGAATTCTAAGTCACAAACAGAC
AAAGATTATTACCAGCTGCAAGCTATATTAGAAGCTGAACGAAGAGACAGAGGTCATGATTCTGAGATGATTGGAGACCTTCAAGAGTCA
AGTTCCCATTATGTAATCTCCCTAAAAGCTTTTAACAATGCCGGAGAAGGAGTTCCTCTTTATGAAAGTGCCACCACCAGGTCTATAACC
GATCCCACTGACCCAGTTGATTATTATCCTTTGCTTGATGATTTCCCCACCTCGGTCCCAGATCTCTCCACCCCCATGCTCCCACCAGTA
GGTGTACAGGCTGTGGCTCTTACCCATGATGCTGTGAGGGTCAGCTGGGCAGACAACTCTGTCCCTAAGAACCAAAAGACGTCTGAGGTG
CGACTTTACACCGTCCGGTGGAGAACCAGCTTTTCTGCAAGTGCAAAATACAAGTCAGAAGACACAACATCTCTAAGTTACACAGCAACA
GGCCTCAAACCAAACACAATGTATGAATTCTCGGTCATGGTAACAAAAAACAGAAGGTCCAGTACTTGGAGCATGACTGCACATGCCACC
ACGTATGAAGCAGCCCCCACCTCTGCTCCCAAGGACTTGACAGTCATTACTAGGGAAGGGAAGCCTCGTGCCGTCATTGTGAGTTGGCAG
CCTCCCTTGGAAGCCAATGGGAAAATTACTGCTTACATCTTATTTTATACCTTGGACAAGAACATCCCAATTGATGACTGGATTATGGAA
ACAATCAGTGGTGATAGGCTTACTCATCAAATCATGGATCTCAACCTTGATACTATGTATTACTTTCGAATTCAAGCACGAAATTCAAAA
GGAGTGGGGCCACTCTCTGATCCTATCCTCTTCAGGACTCTGAAAGTGGAACACCCTGACAAAATGGCTAATGACCAAGGTCGTCATGGA
GATGGAGGTTATTGGCCAGTTGATACTAATTTGATTGATAGAAGCACCCTAAATGAGCCGCCAATTGGACAAATGCACCCCCCGCATGGC
AGTGTCACTCCTCAGAAGAACAGCAACCTGCTTGTGATCATTGTGGTCACCGTTGGTGTCATCACAGTGCTGGTAGTGGTCATCGTGGCT
GTGATTTGCACCCGACGCTCTTCAGCCCAGCAGAGAAAGAAACGGGCCACCCACAGTGCTGGCAAAAGGAAGGGCAGCCAGAAGGACCTC
CGACCCCCTGATCTTTGGATCCATCATGAAGAAATGGAGATGAAAAATATTGAAAAGCCATCTGGCACTGACCCTGCAGGAAGGGACTCT
CCCATCCAAAGTTGCCAAGACCTCACACCAGTCAGCCACAGCCAGTCAGAAACCCAACTGGGAAGCAAAAGCACCTCTCATTCAGGTCAA
GACACTGAGGAAGCAGGGAGCTCTATGTCCACTCTGGAGAGGTCGCTGGCTGCACGCCGAGCCCCCCGGGCCAAGCTCATGATTCCCATG
GATGCCCAGTCCAACAATCCTGCTGTCGTGAGCGCCATCCCGGTGCCAACGCTAGAAAGTGCCCAGTACCCAGGAATCCTCCCGTCTCCC
ACCTGTGGATATCCCCACCCGCAGTTCACTCTCCGGCCTGTGCCATTCCCAACACTCTCAGTGGACCGAGGTTTCGGAGCAGGAAGAAGT
CAGTCAGTGAGTGAAGGACCAACTACCCAACAACCACCTATGCTGCCCCCATCTCAGCCTGAGCATTCTAGCAGCGAGGAGGCACCAAGC
AGAACCATCCCCACAGCTTGTGTTCGACCAACTCACCCACTCCGCAGCTTTGCTAATCCTTTGCTACCTCCACCAATGAGTGCAATAGAA
CCGAAAGTCCCTTACACACCACTTTTGTCTCAGCCAGGGCCCACTCTTCCTAAGACCCATGTGAAAACAGCCTCCCTTGGGTTGGCTGGA
AAAGCAAGATCCCCTTTGCTTCCTGTGTCTGTGCCAACAGCCCCTGAAGTGTCTGAGGAGAGCCACAAACCAACAGAGGATTCAGCCAAT
GTGTATGAACAGGATGATCTGAGTGAACAAATGGCAAGTTTGGAAGGACTCATGAAGCAGCTTAATGCCATCACAGGCTCAGCCTTTTAA

>In-frame_ROCK1_ENST00000399799_chr18_18586312_-_DCC_ENST00000412726_chr18_50912413_+_2676nt
ATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACCTGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTG
CTGGATGGATTGGATGCTTTGGTATATGATTTGGATTTTCCTGCCTTAAGAAAAAACAAAAATATTGACAACTTTTTAAGCAGATATAAA
GACACAATAAATAAAATCAGAGATTTACGAATGAAAGCTGAAGATTATGAAGTAGTGAAGGTGATTGGTAGAGGTGCATTTGGAGAAGTT
CAATTGGTAAGGCATAAATCCACCAGGAAGGTATATGCTATGAAGCTTCTCAGCAAATTTGAAATGATAAAGAGATCTGATTCTGCTTTT
TTCTGGGAAGAAAGGGACATCATGGCTTTTGCCAACAGTCCTTGGGTTGTTCAGCTTTTTTATGCATTCCAAGATGATCGTTATCTCTAC
ATGGTGATGGAATACATGCCTGGTGGAGATCTTGTAAACTTAATGAGCAACTATGATGTGCCTGAAAAATGGGCACGATTCTATACTGCA
GAAGTAGTTCTTGCATTGGATGCAATCCATTCCATGGGTTTTATTCACAGAGATGTGAAGCCTGATAACATGCTGCTGGATAAATCTGGA
CATTTGAAGTTAGCAGATTTTGGTACTTGTATGAAGATGAATAAGGAAGGCATGGTACGATGTGATACAGCGGTTGGAACACCTGATTAT
ATTTCCCCTGAAGTATTAAAATCCCAAGGTGGTGATGGTTATTATGGAAGAGAATGTGACTGGTGGTCGGTTGGGGTATTTTTATACGAA
ATGCTTGTAGGTGATACACCTTTTTATGCAGATTCTTTGGTTGGAACTTACAGTAAAATTATGAACCATAAAAATTCACTTACCTTTCCT
GATGATAATGACATATCAAAAGAAGCAAAAAACCTTATTTGTGCCTTCCTTACTGACAGGGAAGTGAGGTTAGGGCGAAATGGTGTAGAA
GAAATCAAACGACATCTCTTCTTCAAAAATGACCAGTGGGCTTGGGAAACGCTCCGAGACACTGTAGCACCAGTTGTACCCGATTTAAGT
AGTGACATTGATACTAGTAATTTTGATGACTTGGAAGAAGATAAAGGAGAGGAAGAAACATTCCCTATTCCTAAAGCTTTCGTTGGCAAT
CAACTACCTTTTGTAGGATTTACATATTATAGCAATCGTAGATACTTATCTTCAGCAAATCCTAATGATAACAGAACTAGCTCCAATGCA
GATAAAAGCTTGCAGGAAAGTTTGCAAAAAACAATCTATAAGCTGGAAGAACAGCTGCATAATGAAATGCAGTTAAAAGATGAAATGGAG
CAGAAGTGCAGAACCTCAAACATAAAACTAGACAAGATAATGAAAGAATTGGATGAAGAGGGAAATCAAAGAAGAAATCTAGAATCTACA
GTGTCTCAGATTGAGAAGGAGAAAATGTTGCTACAGCATAGAATTAATGAGTACCAAAGAAAAGCTGAACAGGAAAATGAGAAGAGAAGA
AATGTAGAAAATGAAGTTTCTACATTAAAGGATCAGTTGGAAGACTTAAAGAAAGTCAGTCAGAATTCACAGCTTGCTAATGAGAAGCTG
TCCCAGTTACAAAAGCAGCTAGAAGAAGCCAATGACTTACTTAGGACAGAATCGGACACAGCTGTAAGATTGAGGAAGAGTCACACAGAG
ATGAGCAAGTCAATTAGTCAGTTAGAGTCCCTGAACAGAGAGTTGCAAGAGAGAAATCGAATTTTAGAGAATTCTAAGTCACAAACAGAC
AAAGATTATTACCAGCTGCAAGCTATATTAGAAGCTGAACGAAGAGACAGAGGTCATGATTCTGAGATGATTGGAGACCTTCAAGAGTCA
AGTTCCCATTATGTAATCTCCCTAAAAGCTTTTAACAATGCCGGAGAAGGAGTTCCTCTTTATGAAAGTGCCACCACCAGGTCTATAACC
GATCTCTCCACCCCCATGCTCCCACCAGTAGGTGTACAGGCTGTGGCTCTTACCCATGATGCTGTGAGGGTCAGCTGGGCAGACAACTCT
GTCCCTAAGAACCAAAAGACGTCTGAGGTGCGACTTTACACCGTCCGGTGGAGAACCAGCTTTTCTGCAAGTGCAAAATACAAGTCAGAA
GACACAACATCTCTAAGTTACACAGCAACAGGCCTCAAACCAAACACAATGTATGAATTCTCGGTCATGGTAACAAAAAACAGAAGGTCC
AGTACTTGGAGCATGACTGCACATGCCACCACGTATGAAGCAGCCCCCACCTCTGCTCCCAAGGACTTGACAGTCATTACTAGGGAAGGG
AAGCCTCGTGCCGTCATTGTGAGTTGGCAGCCTCCCTTGGAAGCCAATGGGAAAATTACTGCTTACATCTTATTTTATACCTTGGACAAG
AACATCCCAATTGATGACTGGATTATGGAAACAATCAGTGGTGATAGGCTTACTCATCAAATCATGGATCTCAACCTTGATACTATGTAT
TACTTTCGAATTCAAGCACGAAATTCAAAAGGAGTGGGGCCACTCTCTGATCCTATCCTCTTCAGGACTCTGAAAGTGGAACACCCTGAC

>In-frame_ROCK1_ENST00000399799_chr18_18586312_-_DCC_ENST00000581580_chr18_50912413_+_3792nt
ATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACCTGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTG
CTGGATGGATTGGATGCTTTGGTATATGATTTGGATTTTCCTGCCTTAAGAAAAAACAAAAATATTGACAACTTTTTAAGCAGATATAAA
GACACAATAAATAAAATCAGAGATTTACGAATGAAAGCTGAAGATTATGAAGTAGTGAAGGTGATTGGTAGAGGTGCATTTGGAGAAGTT
CAATTGGTAAGGCATAAATCCACCAGGAAGGTATATGCTATGAAGCTTCTCAGCAAATTTGAAATGATAAAGAGATCTGATTCTGCTTTT
TTCTGGGAAGAAAGGGACATCATGGCTTTTGCCAACAGTCCTTGGGTTGTTCAGCTTTTTTATGCATTCCAAGATGATCGTTATCTCTAC
ATGGTGATGGAATACATGCCTGGTGGAGATCTTGTAAACTTAATGAGCAACTATGATGTGCCTGAAAAATGGGCACGATTCTATACTGCA
GAAGTAGTTCTTGCATTGGATGCAATCCATTCCATGGGTTTTATTCACAGAGATGTGAAGCCTGATAACATGCTGCTGGATAAATCTGGA
CATTTGAAGTTAGCAGATTTTGGTACTTGTATGAAGATGAATAAGGAAGGCATGGTACGATGTGATACAGCGGTTGGAACACCTGATTAT
ATTTCCCCTGAAGTATTAAAATCCCAAGGTGGTGATGGTTATTATGGAAGAGAATGTGACTGGTGGTCGGTTGGGGTATTTTTATACGAA
ATGCTTGTAGGTGATACACCTTTTTATGCAGATTCTTTGGTTGGAACTTACAGTAAAATTATGAACCATAAAAATTCACTTACCTTTCCT
GATGATAATGACATATCAAAAGAAGCAAAAAACCTTATTTGTGCCTTCCTTACTGACAGGGAAGTGAGGTTAGGGCGAAATGGTGTAGAA
GAAATCAAACGACATCTCTTCTTCAAAAATGACCAGTGGGCTTGGGAAACGCTCCGAGACACTGTAGCACCAGTTGTACCCGATTTAAGT
AGTGACATTGATACTAGTAATTTTGATGACTTGGAAGAAGATAAAGGAGAGGAAGAAACATTCCCTATTCCTAAAGCTTTCGTTGGCAAT
CAACTACCTTTTGTAGGATTTACATATTATAGCAATCGTAGATACTTATCTTCAGCAAATCCTAATGATAACAGAACTAGCTCCAATGCA
GATAAAAGCTTGCAGGAAAGTTTGCAAAAAACAATCTATAAGCTGGAAGAACAGCTGCATAATGAAATGCAGTTAAAAGATGAAATGGAG
CAGAAGTGCAGAACCTCAAACATAAAACTAGACAAGATAATGAAAGAATTGGATGAAGAGGGAAATCAAAGAAGAAATCTAGAATCTACA
GTGTCTCAGATTGAGAAGGAGAAAATGTTGCTACAGCATAGAATTAATGAGTACCAAAGAAAAGCTGAACAGGAAAATGAGAAGAGAAGA
AATGTAGAAAATGAAGTTTCTACATTAAAGGATCAGTTGGAAGACTTAAAGAAAGTCAGTCAGAATTCACAGCTTGCTAATGAGAAGCTG
TCCCAGTTACAAAAGCAGCTAGAAGAAGCCAATGACTTACTTAGGACAGAATCGGACACAGCTGTAAGATTGAGGAAGAGTCACACAGAG
ATGAGCAAGTCAATTAGTCAGTTAGAGTCCCTGAACAGAGAGTTGCAAGAGAGAAATCGAATTTTAGAGAATTCTAAGTCACAAACAGAC
AAAGATTATTACCAGCTGCAAGCTATATTAGAAGCTGAACGAAGAGACAGAGGTCATGATTCTGAGATGATTGGAGACCTTCAAGAGTCA
AGTTCCCATTATGTAATCTCCCTAAAAGCTTTTAACAATGCCGGAGAAGGAGTTCCTCTTTATGAAAGTGCCACCACCAGGTCTATAACC
GATCTCTCCACCCCCATGCTCCCACCAGTAGGTGTACAGGCTGTGGCTCTTACCCATGATGCTGTGAGGGTCAGCTGGGCAGACAACTCT
GTCCCTAAGAACCAAAAGACGTCTGAGGTGCGACTTTACACCGTCCGGTGGAGAACCAGCTTTTCTGCAAGTGCAAAATACAAGTCAGAA
GACACAACATCTCTAAGTTACACAGCAACAGGCCTCAAACCAAACACAATGTATGAATTCTCGGTCATGGTAACAAAAAACAGAAGGTCC
AGTACTTGGAGCATGACTGCACATGCCACCACGTATGAAGCAGCCCCCACCTCTGCTCCCAAGGACTTGACAGTCATTACTAGGGAAGGG
AAGCCTCGTGCCGTCATTGTGAGTTGGCAGCCTCCCTTGGAAGCCAATGGGAAAATTACTGCTTACATCTTATTTTATACCTTGGACAAG
AACATCCCAATTGATGACTGGATTATGGAAACAATCAGTGGTGATAGGCTTACTCATCAAATCATGGATCTCAACCTTGATACTATGTAT
TACTTTCGAATTCAAGCACGAAATTCAAAAGGAGTGGGGCCACTCTCTGATCCTATCCTCTTCAGGACTCTGAAAGTGGAACACCCTGAC
AAAATGGCTAATGACCAAGGTCGTCATGGAGATGGAGGTTATTGGCCAGTTGATACTAATTTGATTGATAGAAGCACCCTAAATGAGCCG
CCAATTGGACAAATGCACCCCCCGCATGGCAGTGTCACTCCTCAGAAGAACAGCAACCTGCTTGTGATCATTGTGGTCACCGTTGGTGTC
ATCACAGTGCTGGTAGTGGTCATCGTGGCTGTGATTTGCACCCGACGCTCTTCAGCCCAGCAGAGAAAGAAACGGGCCACCCACAGTGCT
GGCAAAAGGAAGGGCAGCCAGAAGGACCTCCGACCCCCTGATCTTTGGATCCATCATGAAGAAATGGAGATGAAAAATATTGAAAAGCCA
TCTGGCACTGACCCTGCAGGAAGGGACTCTCCCATCCAAAGTTGCCAAGACCTCACACCAGTCAGCCACAGCCAGTCAGAAACCCAACTG
GGAAGCAAAAGCACCTCTCATTCAGGTCAAGACACTGAGGAAGCAGGGAGCTCTATGTCCACTCTGGAGAGGTCGCTGGCTGCACGCCGA
GCCCCCCGGGCCAAGCTCATGATTCCCATGGATGCCCAGTCCAACAATCCTGCTGTCGTGAGCGCCATCCCGGTGCCAACGCTAGAAAGT
GCCCAGTACCCAGGAATCCTCCCGTCTCCCACCTGTGGATATCCCCACCCGCAGTTCACTCTCCGGCCTGTGCCATTCCCAACACTCTCA
GTGGACCGAGGTTTCGGAGCAGGAAGAACAGTGAGTGAAGGACCAACTACCCAACAACCACCTATGCTGCCCCCATCTCAGCCTGAGCAT
TCTAGCAGCGAGGAGGCACCAAGCAGAACCATCCCCACAGCTTGTGTTCGACCAACTCACCCACTCCGCAGCTTTGCTAATCCTTTGCTA
CCTCCACCAATGAGTGCAATAGAACCGAAAGTCCCTTACACACCACTTTTGTCTCAGCCAGGGCCCACTCTTCCTAAGACCCATGTGAAA
ACAGCCTCCCTTGGGTTGGCTGGAAAAGCAAGATCCCCTTTGCTTCCTGTGTCTGTGCCAACAGCCCCTGAAGTGTCTGAGGAGAGCCAC
AAACCAACAGAGGATTCAGCCAATGTGGAGATGGAGTGGGTGAAACAATATGCAATCTCTTATTATCCCCTTTTATTACCAGCATCTTCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ROCK1_ENST00000399799_chr18_18586312_-_DCC_ENST00000442544_chr18_50912413_+_5572nt
GCTGGTTCCCCTTCCGAGCGTCCGCGCCCCGCATGCGCAGTCTGCCCCGGCGGTCTCCGTTTGTTTGAACAGGAAGGCGGACATATTAGT
CCCTCTCAGCCCCCCTCGCCCCACCCCCCAGGCATTCGCCGCCGCGACTCGCCCTTTCCCCGGCTGGGACCGCAGCCCCTCCCAGAAGCT
CCCCCATCAGCAGCCGCCGGGACCCAACTATCGTCTTCCTCTTCGCCCGCTCTCCAGCCTTTCCTCTGCTAAGTCTCCATCGGGCATCGA
CCTCGCCCTGCCCCACCGGACACCGTAGCAGCAGCCCCAGCAGCGACGGGACAAAATGGGAGAGTGAGGCTGTCCTGCGTGGACCAGCTC
GTGGCCGAGACTGATCGGTGCGTCGGGCCGGGCCGAGTAGAGCCGGGGACGCGGGGCTAGACCGTCTACAGCGCCTCTGAGCGGAGCGGG
CCCGGCCCGTGGCCCGAGCGGCGGCCGCAGCTGGCACAGCTCCTCACCCGCCCTTTGCTTTCGCCTTTCCTCTTCTCCCTCCCTTGTTGC
CCGGAGGGAGTCTCCACCCTGCTTCTCTTTCTCTACCCGCTCCTGCCCATCTCGGGACGGGGACCCCTCCATGGCGACGGCGGCCGGGGC
CCGCTAGACTGAAGCACCTCGCCGGAGCGACGAGGCTGGTGGCGACGGCGCTGTCGGCTGTCGTGAGGGGCTGCCGGGTGGGATGCGACT
TTGGGCGTCCGAGCGGCTGTGGGTCGCTGTTGCCCCCGGCCCGGGGTCTGGAGAGCGGAGGTCCCCTCAGTGAGGGGAAGACGGGGGAAC
CGGGCGCACCTGGTGACCCTGAGGTTCCGGCTCCTCCGCCCCGCGGCTGCGAACCCACCGCGGAGGAAGTTGGTTGAAATTGCTTTCCGC
TGCTGGTGCTGGTAAGAGGGCATTGTCACAGCAGCAGCAACATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACC
TGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTGCTGGATGGATTGGATGCTTTGGTATATGATTTGGATTTTCCTGCCTTAA
GAAAAAACAAAAATATTGACAACTTTTTAAGCAGATATAAAGACACAATAAATAAAATCAGAGATTTACGAATGAAAGCTGAAGATTATG
AAGTAGTGAAGGTGATTGGTAGAGGTGCATTTGGAGAAGTTCAATTGGTAAGGCATAAATCCACCAGGAAGGTATATGCTATGAAGCTTC
TCAGCAAATTTGAAATGATAAAGAGATCTGATTCTGCTTTTTTCTGGGAAGAAAGGGACATCATGGCTTTTGCCAACAGTCCTTGGGTTG
TTCAGCTTTTTTATGCATTCCAAGATGATCGTTATCTCTACATGGTGATGGAATACATGCCTGGTGGAGATCTTGTAAACTTAATGAGCA
ACTATGATGTGCCTGAAAAATGGGCACGATTCTATACTGCAGAAGTAGTTCTTGCATTGGATGCAATCCATTCCATGGGTTTTATTCACA
GAGATGTGAAGCCTGATAACATGCTGCTGGATAAATCTGGACATTTGAAGTTAGCAGATTTTGGTACTTGTATGAAGATGAATAAGGAAG
GCATGGTACGATGTGATACAGCGGTTGGAACACCTGATTATATTTCCCCTGAAGTATTAAAATCCCAAGGTGGTGATGGTTATTATGGAA
GAGAATGTGACTGGTGGTCGGTTGGGGTATTTTTATACGAAATGCTTGTAGGTGATACACCTTTTTATGCAGATTCTTTGGTTGGAACTT
ACAGTAAAATTATGAACCATAAAAATTCACTTACCTTTCCTGATGATAATGACATATCAAAAGAAGCAAAAAACCTTATTTGTGCCTTCC
TTACTGACAGGGAAGTGAGGTTAGGGCGAAATGGTGTAGAAGAAATCAAACGACATCTCTTCTTCAAAAATGACCAGTGGGCTTGGGAAA
CGCTCCGAGACACTGTAGCACCAGTTGTACCCGATTTAAGTAGTGACATTGATACTAGTAATTTTGATGACTTGGAAGAAGATAAAGGAG
AGGAAGAAACATTCCCTATTCCTAAAGCTTTCGTTGGCAATCAACTACCTTTTGTAGGATTTACATATTATAGCAATCGTAGATACTTAT
CTTCAGCAAATCCTAATGATAACAGAACTAGCTCCAATGCAGATAAAAGCTTGCAGGAAAGTTTGCAAAAAACAATCTATAAGCTGGAAG
AACAGCTGCATAATGAAATGCAGTTAAAAGATGAAATGGAGCAGAAGTGCAGAACCTCAAACATAAAACTAGACAAGATAATGAAAGAAT
TGGATGAAGAGGGAAATCAAAGAAGAAATCTAGAATCTACAGTGTCTCAGATTGAGAAGGAGAAAATGTTGCTACAGCATAGAATTAATG
AGTACCAAAGAAAAGCTGAACAGGAAAATGAGAAGAGAAGAAATGTAGAAAATGAAGTTTCTACATTAAAGGATCAGTTGGAAGACTTAA
AGAAAGTCAGTCAGAATTCACAGCTTGCTAATGAGAAGCTGTCCCAGTTACAAAAGCAGCTAGAAGAAGCCAATGACTTACTTAGGACAG
AATCGGACACAGCTGTAAGATTGAGGAAGAGTCACACAGAGATGAGCAAGTCAATTAGTCAGTTAGAGTCCCTGAACAGAGAGTTGCAAG
AGAGAAATCGAATTTTAGAGAATTCTAAGTCACAAACAGACAAAGATTATTACCAGCTGCAAGCTATATTAGAAGCTGAACGAAGAGACA
GAGGTCATGATTCTGAGATGATTGGAGACCTTCAAGAGTCAAGTTCCCATTATGTAATCTCCCTAAAAGCTTTTAACAATGCCGGAGAAG
GAGTTCCTCTTTATGAAAGTGCCACCACCAGGTCTATAACCGATCCCACTGACCCAGTTGATTATTATCCTTTGCTTGATGATTTCCCCA
CCTCGGTCCCAGATCTCTCCACCCCCATGCTCCCACCAGTAGGTGTACAGGCTGTGGCTCTTACCCATGATGCTGTGAGGGTCAGCTGGG
CAGACAACTCTGTCCCTAAGAACCAAAAGACGTCTGAGGTGCGACTTTACACCGTCCGGTGGAGAACCAGCTTTTCTGCAAGTGCAAAAT
ACAAGTCAGAAGACACAACATCTCTAAGTTACACAGCAACAGGCCTCAAACCAAACACAATGTATGAATTCTCGGTCATGGTAACAAAAA
ACAGAAGGTCCAGTACTTGGAGCATGACTGCACATGCCACCACGTATGAAGCAGCCCCCACCTCTGCTCCCAAGGACTTGACAGTCATTA
CTAGGGAAGGGAAGCCTCGTGCCGTCATTGTGAGTTGGCAGCCTCCCTTGGAAGCCAATGGGAAAATTACTGCTTACATCTTATTTTATA
CCTTGGACAAGAACATCCCAATTGATGACTGGATTATGGAAACAATCAGTGGTGATAGGCTTACTCATCAAATCATGGATCTCAACCTTG
ATACTATGTATTACTTTCGAATTCAAGCACGAAATTCAAAAGGAGTGGGGCCACTCTCTGATCCTATCCTCTTCAGGACTCTGAAAGTGG
AACACCCTGACAAAATGGCTAATGACCAAGGTCGTCATGGAGATGGAGGTTATTGGCCAGTTGATACTAATTTGATTGATAGAAGCACCC
TAAATGAGCCGCCAATTGGACAAATGCACCCCCCGCATGGCAGTGTCACTCCTCAGAAGAACAGCAACCTGCTTGTGATCATTGTGGTCA
CCGTTGGTGTCATCACAGTGCTGGTAGTGGTCATCGTGGCTGTGATTTGCACCCGACGCTCTTCAGCCCAGCAGAGAAAGAAACGGGCCA
CCCACAGTGCTGGCAAAAGGAAGGGCAGCCAGAAGGACCTCCGACCCCCTGATCTTTGGATCCATCATGAAGAAATGGAGATGAAAAATA
TTGAAAAGCCATCTGGCACTGACCCTGCAGGAAGGGACTCTCCCATCCAAAGTTGCCAAGACCTCACACCAGTCAGCCACAGCCAGTCAG
AAACCCAACTGGGAAGCAAAAGCACCTCTCATTCAGGTCAAGACACTGAGGAAGCAGGGAGCTCTATGTCCACTCTGGAGAGGTCGCTGG
CTGCACGCCGAGCCCCCCGGGCCAAGCTCATGATTCCCATGGATGCCCAGTCCAACAATCCTGCTGTCGTGAGCGCCATCCCGGTGCCAA
CGCTAGAAAGTGCCCAGTACCCAGGAATCCTCCCGTCTCCCACCTGTGGATATCCCCACCCGCAGTTCACTCTCCGGCCTGTGCCATTCC
CAACACTCTCAGTGGACCGAGGTTTCGGAGCAGGAAGAAGTCAGTCAGTGAGTGAAGGACCAACTACCCAACAACCACCTATGCTGCCCC
CATCTCAGCCTGAGCATTCTAGCAGCGAGGAGGCACCAAGCAGAACCATCCCCACAGCTTGTGTTCGACCAACTCACCCACTCCGCAGCT
TTGCTAATCCTTTGCTACCTCCACCAATGAGTGCAATAGAACCGAAAGTCCCTTACACACCACTTTTGTCTCAGCCAGGGCCCACTCTTC
CTAAGACCCATGTGAAAACAGCCTCCCTTGGGTTGGCTGGAAAAGCAAGATCCCCTTTGCTTCCTGTGTCTGTGCCAACAGCCCCTGAAG
TGTCTGAGGAGAGCCACAAACCAACAGAGGATTCAGCCAATGTGTATGAACAGGATGATCTGAGTGAACAAATGGCAAGTTTGGAAGGAC
TCATGAAGCAGCTTAATGCCATCACAGGCTCAGCCTTTTAACATGTATTTCTGAATGGATGAGGTGAATTTTCCGGGAACTTTGCAGCAT
ACCAATTACCCATAAACAGCACACCTGTGTCCAAGAACTCTAACCAGTGTACAGGTCACCCATCAGGACCACTCAGTTAAGGAAGATCCT
GAAGCAGTTCAGAAGGAATAAGCATTCCTTCTTTCACAGGCATCAGGAATTGTCAAATGATGATTATGAGTTCCCTAAACAAAAGCAAAG
ATGCATTTTCACTGCAATGTCAAAGTTTAAGCTGCTAGAATAGTCATGGGCCTTTGTCACTGCAGTGACCACACTGTCATAACTAATACC
TATGTTTTCCTTTGTCAAGGCCTGTTGTTTAATGTGTAGGTCTAGTCTTACAAAATGCAAGTGCATTATTTAAGCCTGTACCATGCCATG
GCAAACCAGTGCAAGCTCACTATTTTGTTTTCAACTTAAACATACAAAGCACCCATGGGAATCTCTCATGCCATAGCACCAAAGGATTGG
ATGTTTTCCTTACAGCACAAAAAGTAAATAGTAAACAAACAAAAGGCAGAGAATGCTTATGTTTGTAACTCAGTCATTCATCTTGCACAA
GTGGTGGATATTAGTGAGTGGCTAAAAATTCACCTATTTTGGCAAGTATTTGTAAATCCACCCTTGGTTAATATGTATGTCTGGAGTCCA

>In-frame_ROCK1_ENST00000399799_chr18_18586312_-_DCC_ENST00000412726_chr18_50912413_+_3715nt
GCTGGTTCCCCTTCCGAGCGTCCGCGCCCCGCATGCGCAGTCTGCCCCGGCGGTCTCCGTTTGTTTGAACAGGAAGGCGGACATATTAGT
CCCTCTCAGCCCCCCTCGCCCCACCCCCCAGGCATTCGCCGCCGCGACTCGCCCTTTCCCCGGCTGGGACCGCAGCCCCTCCCAGAAGCT
CCCCCATCAGCAGCCGCCGGGACCCAACTATCGTCTTCCTCTTCGCCCGCTCTCCAGCCTTTCCTCTGCTAAGTCTCCATCGGGCATCGA
CCTCGCCCTGCCCCACCGGACACCGTAGCAGCAGCCCCAGCAGCGACGGGACAAAATGGGAGAGTGAGGCTGTCCTGCGTGGACCAGCTC
GTGGCCGAGACTGATCGGTGCGTCGGGCCGGGCCGAGTAGAGCCGGGGACGCGGGGCTAGACCGTCTACAGCGCCTCTGAGCGGAGCGGG
CCCGGCCCGTGGCCCGAGCGGCGGCCGCAGCTGGCACAGCTCCTCACCCGCCCTTTGCTTTCGCCTTTCCTCTTCTCCCTCCCTTGTTGC
CCGGAGGGAGTCTCCACCCTGCTTCTCTTTCTCTACCCGCTCCTGCCCATCTCGGGACGGGGACCCCTCCATGGCGACGGCGGCCGGGGC
CCGCTAGACTGAAGCACCTCGCCGGAGCGACGAGGCTGGTGGCGACGGCGCTGTCGGCTGTCGTGAGGGGCTGCCGGGTGGGATGCGACT
TTGGGCGTCCGAGCGGCTGTGGGTCGCTGTTGCCCCCGGCCCGGGGTCTGGAGAGCGGAGGTCCCCTCAGTGAGGGGAAGACGGGGGAAC
CGGGCGCACCTGGTGACCCTGAGGTTCCGGCTCCTCCGCCCCGCGGCTGCGAACCCACCGCGGAGGAAGTTGGTTGAAATTGCTTTCCGC
TGCTGGTGCTGGTAAGAGGGCATTGTCACAGCAGCAGCAACATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACC
TGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTGCTGGATGGATTGGATGCTTTGGTATATGATTTGGATTTTCCTGCCTTAA
GAAAAAACAAAAATATTGACAACTTTTTAAGCAGATATAAAGACACAATAAATAAAATCAGAGATTTACGAATGAAAGCTGAAGATTATG
AAGTAGTGAAGGTGATTGGTAGAGGTGCATTTGGAGAAGTTCAATTGGTAAGGCATAAATCCACCAGGAAGGTATATGCTATGAAGCTTC
TCAGCAAATTTGAAATGATAAAGAGATCTGATTCTGCTTTTTTCTGGGAAGAAAGGGACATCATGGCTTTTGCCAACAGTCCTTGGGTTG
TTCAGCTTTTTTATGCATTCCAAGATGATCGTTATCTCTACATGGTGATGGAATACATGCCTGGTGGAGATCTTGTAAACTTAATGAGCA
ACTATGATGTGCCTGAAAAATGGGCACGATTCTATACTGCAGAAGTAGTTCTTGCATTGGATGCAATCCATTCCATGGGTTTTATTCACA
GAGATGTGAAGCCTGATAACATGCTGCTGGATAAATCTGGACATTTGAAGTTAGCAGATTTTGGTACTTGTATGAAGATGAATAAGGAAG
GCATGGTACGATGTGATACAGCGGTTGGAACACCTGATTATATTTCCCCTGAAGTATTAAAATCCCAAGGTGGTGATGGTTATTATGGAA
GAGAATGTGACTGGTGGTCGGTTGGGGTATTTTTATACGAAATGCTTGTAGGTGATACACCTTTTTATGCAGATTCTTTGGTTGGAACTT
ACAGTAAAATTATGAACCATAAAAATTCACTTACCTTTCCTGATGATAATGACATATCAAAAGAAGCAAAAAACCTTATTTGTGCCTTCC
TTACTGACAGGGAAGTGAGGTTAGGGCGAAATGGTGTAGAAGAAATCAAACGACATCTCTTCTTCAAAAATGACCAGTGGGCTTGGGAAA
CGCTCCGAGACACTGTAGCACCAGTTGTACCCGATTTAAGTAGTGACATTGATACTAGTAATTTTGATGACTTGGAAGAAGATAAAGGAG
AGGAAGAAACATTCCCTATTCCTAAAGCTTTCGTTGGCAATCAACTACCTTTTGTAGGATTTACATATTATAGCAATCGTAGATACTTAT
CTTCAGCAAATCCTAATGATAACAGAACTAGCTCCAATGCAGATAAAAGCTTGCAGGAAAGTTTGCAAAAAACAATCTATAAGCTGGAAG
AACAGCTGCATAATGAAATGCAGTTAAAAGATGAAATGGAGCAGAAGTGCAGAACCTCAAACATAAAACTAGACAAGATAATGAAAGAAT
TGGATGAAGAGGGAAATCAAAGAAGAAATCTAGAATCTACAGTGTCTCAGATTGAGAAGGAGAAAATGTTGCTACAGCATAGAATTAATG
AGTACCAAAGAAAAGCTGAACAGGAAAATGAGAAGAGAAGAAATGTAGAAAATGAAGTTTCTACATTAAAGGATCAGTTGGAAGACTTAA
AGAAAGTCAGTCAGAATTCACAGCTTGCTAATGAGAAGCTGTCCCAGTTACAAAAGCAGCTAGAAGAAGCCAATGACTTACTTAGGACAG
AATCGGACACAGCTGTAAGATTGAGGAAGAGTCACACAGAGATGAGCAAGTCAATTAGTCAGTTAGAGTCCCTGAACAGAGAGTTGCAAG
AGAGAAATCGAATTTTAGAGAATTCTAAGTCACAAACAGACAAAGATTATTACCAGCTGCAAGCTATATTAGAAGCTGAACGAAGAGACA
GAGGTCATGATTCTGAGATGATTGGAGACCTTCAAGAGTCAAGTTCCCATTATGTAATCTCCCTAAAAGCTTTTAACAATGCCGGAGAAG
GAGTTCCTCTTTATGAAAGTGCCACCACCAGGTCTATAACCGATCTCTCCACCCCCATGCTCCCACCAGTAGGTGTACAGGCTGTGGCTC
TTACCCATGATGCTGTGAGGGTCAGCTGGGCAGACAACTCTGTCCCTAAGAACCAAAAGACGTCTGAGGTGCGACTTTACACCGTCCGGT
GGAGAACCAGCTTTTCTGCAAGTGCAAAATACAAGTCAGAAGACACAACATCTCTAAGTTACACAGCAACAGGCCTCAAACCAAACACAA
TGTATGAATTCTCGGTCATGGTAACAAAAAACAGAAGGTCCAGTACTTGGAGCATGACTGCACATGCCACCACGTATGAAGCAGCCCCCA
CCTCTGCTCCCAAGGACTTGACAGTCATTACTAGGGAAGGGAAGCCTCGTGCCGTCATTGTGAGTTGGCAGCCTCCCTTGGAAGCCAATG
GGAAAATTACTGCTTACATCTTATTTTATACCTTGGACAAGAACATCCCAATTGATGACTGGATTATGGAAACAATCAGTGGTGATAGGC
TTACTCATCAAATCATGGATCTCAACCTTGATACTATGTATTACTTTCGAATTCAAGCACGAAATTCAAAAGGAGTGGGGCCACTCTCTG
ATCCTATCCTCTTCAGGACTCTGAAAGTGGAACACCCTGACAAAATGGCTAATGACCAAGACACTGGCGTGACGATTAATCTTGTTAATG
AAGTTCTGCTTGGCTGAGGCTGCGGCTCTGATAAGGAAGATGTAAATTTTCTTGAGAGGAAATTGTTTTGTCTCCATTCTGAAGGACCAA

>In-frame_ROCK1_ENST00000399799_chr18_18586312_-_DCC_ENST00000581580_chr18_50912413_+_4754nt
GCTGGTTCCCCTTCCGAGCGTCCGCGCCCCGCATGCGCAGTCTGCCCCGGCGGTCTCCGTTTGTTTGAACAGGAAGGCGGACATATTAGT
CCCTCTCAGCCCCCCTCGCCCCACCCCCCAGGCATTCGCCGCCGCGACTCGCCCTTTCCCCGGCTGGGACCGCAGCCCCTCCCAGAAGCT
CCCCCATCAGCAGCCGCCGGGACCCAACTATCGTCTTCCTCTTCGCCCGCTCTCCAGCCTTTCCTCTGCTAAGTCTCCATCGGGCATCGA
CCTCGCCCTGCCCCACCGGACACCGTAGCAGCAGCCCCAGCAGCGACGGGACAAAATGGGAGAGTGAGGCTGTCCTGCGTGGACCAGCTC
GTGGCCGAGACTGATCGGTGCGTCGGGCCGGGCCGAGTAGAGCCGGGGACGCGGGGCTAGACCGTCTACAGCGCCTCTGAGCGGAGCGGG
CCCGGCCCGTGGCCCGAGCGGCGGCCGCAGCTGGCACAGCTCCTCACCCGCCCTTTGCTTTCGCCTTTCCTCTTCTCCCTCCCTTGTTGC
CCGGAGGGAGTCTCCACCCTGCTTCTCTTTCTCTACCCGCTCCTGCCCATCTCGGGACGGGGACCCCTCCATGGCGACGGCGGCCGGGGC
CCGCTAGACTGAAGCACCTCGCCGGAGCGACGAGGCTGGTGGCGACGGCGCTGTCGGCTGTCGTGAGGGGCTGCCGGGTGGGATGCGACT
TTGGGCGTCCGAGCGGCTGTGGGTCGCTGTTGCCCCCGGCCCGGGGTCTGGAGAGCGGAGGTCCCCTCAGTGAGGGGAAGACGGGGGAAC
CGGGCGCACCTGGTGACCCTGAGGTTCCGGCTCCTCCGCCCCGCGGCTGCGAACCCACCGCGGAGGAAGTTGGTTGAAATTGCTTTCCGC
TGCTGGTGCTGGTAAGAGGGCATTGTCACAGCAGCAGCAACATGTCGACTGGGGACAGTTTTGAGACTCGATTTGAAAAAATGGACAACC
TGCTGCGGGATCCCAAATCGGAAGTGAATTCGGATTGTTTGCTGGATGGATTGGATGCTTTGGTATATGATTTGGATTTTCCTGCCTTAA
GAAAAAACAAAAATATTGACAACTTTTTAAGCAGATATAAAGACACAATAAATAAAATCAGAGATTTACGAATGAAAGCTGAAGATTATG
AAGTAGTGAAGGTGATTGGTAGAGGTGCATTTGGAGAAGTTCAATTGGTAAGGCATAAATCCACCAGGAAGGTATATGCTATGAAGCTTC
TCAGCAAATTTGAAATGATAAAGAGATCTGATTCTGCTTTTTTCTGGGAAGAAAGGGACATCATGGCTTTTGCCAACAGTCCTTGGGTTG
TTCAGCTTTTTTATGCATTCCAAGATGATCGTTATCTCTACATGGTGATGGAATACATGCCTGGTGGAGATCTTGTAAACTTAATGAGCA
ACTATGATGTGCCTGAAAAATGGGCACGATTCTATACTGCAGAAGTAGTTCTTGCATTGGATGCAATCCATTCCATGGGTTTTATTCACA
GAGATGTGAAGCCTGATAACATGCTGCTGGATAAATCTGGACATTTGAAGTTAGCAGATTTTGGTACTTGTATGAAGATGAATAAGGAAG
GCATGGTACGATGTGATACAGCGGTTGGAACACCTGATTATATTTCCCCTGAAGTATTAAAATCCCAAGGTGGTGATGGTTATTATGGAA
GAGAATGTGACTGGTGGTCGGTTGGGGTATTTTTATACGAAATGCTTGTAGGTGATACACCTTTTTATGCAGATTCTTTGGTTGGAACTT
ACAGTAAAATTATGAACCATAAAAATTCACTTACCTTTCCTGATGATAATGACATATCAAAAGAAGCAAAAAACCTTATTTGTGCCTTCC
TTACTGACAGGGAAGTGAGGTTAGGGCGAAATGGTGTAGAAGAAATCAAACGACATCTCTTCTTCAAAAATGACCAGTGGGCTTGGGAAA
CGCTCCGAGACACTGTAGCACCAGTTGTACCCGATTTAAGTAGTGACATTGATACTAGTAATTTTGATGACTTGGAAGAAGATAAAGGAG
AGGAAGAAACATTCCCTATTCCTAAAGCTTTCGTTGGCAATCAACTACCTTTTGTAGGATTTACATATTATAGCAATCGTAGATACTTAT
CTTCAGCAAATCCTAATGATAACAGAACTAGCTCCAATGCAGATAAAAGCTTGCAGGAAAGTTTGCAAAAAACAATCTATAAGCTGGAAG
AACAGCTGCATAATGAAATGCAGTTAAAAGATGAAATGGAGCAGAAGTGCAGAACCTCAAACATAAAACTAGACAAGATAATGAAAGAAT
TGGATGAAGAGGGAAATCAAAGAAGAAATCTAGAATCTACAGTGTCTCAGATTGAGAAGGAGAAAATGTTGCTACAGCATAGAATTAATG
AGTACCAAAGAAAAGCTGAACAGGAAAATGAGAAGAGAAGAAATGTAGAAAATGAAGTTTCTACATTAAAGGATCAGTTGGAAGACTTAA
AGAAAGTCAGTCAGAATTCACAGCTTGCTAATGAGAAGCTGTCCCAGTTACAAAAGCAGCTAGAAGAAGCCAATGACTTACTTAGGACAG
AATCGGACACAGCTGTAAGATTGAGGAAGAGTCACACAGAGATGAGCAAGTCAATTAGTCAGTTAGAGTCCCTGAACAGAGAGTTGCAAG
AGAGAAATCGAATTTTAGAGAATTCTAAGTCACAAACAGACAAAGATTATTACCAGCTGCAAGCTATATTAGAAGCTGAACGAAGAGACA
GAGGTCATGATTCTGAGATGATTGGAGACCTTCAAGAGTCAAGTTCCCATTATGTAATCTCCCTAAAAGCTTTTAACAATGCCGGAGAAG
GAGTTCCTCTTTATGAAAGTGCCACCACCAGGTCTATAACCGATCTCTCCACCCCCATGCTCCCACCAGTAGGTGTACAGGCTGTGGCTC
TTACCCATGATGCTGTGAGGGTCAGCTGGGCAGACAACTCTGTCCCTAAGAACCAAAAGACGTCTGAGGTGCGACTTTACACCGTCCGGT
GGAGAACCAGCTTTTCTGCAAGTGCAAAATACAAGTCAGAAGACACAACATCTCTAAGTTACACAGCAACAGGCCTCAAACCAAACACAA
TGTATGAATTCTCGGTCATGGTAACAAAAAACAGAAGGTCCAGTACTTGGAGCATGACTGCACATGCCACCACGTATGAAGCAGCCCCCA
CCTCTGCTCCCAAGGACTTGACAGTCATTACTAGGGAAGGGAAGCCTCGTGCCGTCATTGTGAGTTGGCAGCCTCCCTTGGAAGCCAATG
GGAAAATTACTGCTTACATCTTATTTTATACCTTGGACAAGAACATCCCAATTGATGACTGGATTATGGAAACAATCAGTGGTGATAGGC
TTACTCATCAAATCATGGATCTCAACCTTGATACTATGTATTACTTTCGAATTCAAGCACGAAATTCAAAAGGAGTGGGGCCACTCTCTG
ATCCTATCCTCTTCAGGACTCTGAAAGTGGAACACCCTGACAAAATGGCTAATGACCAAGGTCGTCATGGAGATGGAGGTTATTGGCCAG
TTGATACTAATTTGATTGATAGAAGCACCCTAAATGAGCCGCCAATTGGACAAATGCACCCCCCGCATGGCAGTGTCACTCCTCAGAAGA
ACAGCAACCTGCTTGTGATCATTGTGGTCACCGTTGGTGTCATCACAGTGCTGGTAGTGGTCATCGTGGCTGTGATTTGCACCCGACGCT
CTTCAGCCCAGCAGAGAAAGAAACGGGCCACCCACAGTGCTGGCAAAAGGAAGGGCAGCCAGAAGGACCTCCGACCCCCTGATCTTTGGA
TCCATCATGAAGAAATGGAGATGAAAAATATTGAAAAGCCATCTGGCACTGACCCTGCAGGAAGGGACTCTCCCATCCAAAGTTGCCAAG
ACCTCACACCAGTCAGCCACAGCCAGTCAGAAACCCAACTGGGAAGCAAAAGCACCTCTCATTCAGGTCAAGACACTGAGGAAGCAGGGA
GCTCTATGTCCACTCTGGAGAGGTCGCTGGCTGCACGCCGAGCCCCCCGGGCCAAGCTCATGATTCCCATGGATGCCCAGTCCAACAATC
CTGCTGTCGTGAGCGCCATCCCGGTGCCAACGCTAGAAAGTGCCCAGTACCCAGGAATCCTCCCGTCTCCCACCTGTGGATATCCCCACC
CGCAGTTCACTCTCCGGCCTGTGCCATTCCCAACACTCTCAGTGGACCGAGGTTTCGGAGCAGGAAGAACAGTGAGTGAAGGACCAACTA
CCCAACAACCACCTATGCTGCCCCCATCTCAGCCTGAGCATTCTAGCAGCGAGGAGGCACCAAGCAGAACCATCCCCACAGCTTGTGTTC
GACCAACTCACCCACTCCGCAGCTTTGCTAATCCTTTGCTACCTCCACCAATGAGTGCAATAGAACCGAAAGTCCCTTACACACCACTTT
TGTCTCAGCCAGGGCCCACTCTTCCTAAGACCCATGTGAAAACAGCCTCCCTTGGGTTGGCTGGAAAAGCAAGATCCCCTTTGCTTCCTG
TGTCTGTGCCAACAGCCCCTGAAGTGTCTGAGGAGAGCCACAAACCAACAGAGGATTCAGCCAATGTGGAGATGGAGTGGGTGAAACAAT


Top

FusionGenePPI for ROCK1_DCC


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ROCK1CDC25A, PFN2, RHOA, RND3, GAB1, CFL1, LIMK2, HNRNPA1, ITSN2, ARRB1, TSG101, NOTCH1, SMURF1, SMAD2, CASP3, CASP7, CDK15, ANKFY1, MON2, FAM21A, KIAA1033, IKBKB, LMO2, MAGEB4, POLR3C, C6orf165, FAM124A, NXF1, NTRK1, MED23, XRCC5, NEIL3, TRIM15, HGS, SLC9A1, UBE2T, CDKN3, TENC1, ROCK2, ADD2, IL20RA, CYLDDCCAR, NTN1, CASP3, CASP9, MAPK3, NCK1, MAZ, SIAH1, APPL1, PTK2, RPL5, EIF2B2, RPL10A, RPL23, RPL13, EIF2S3, EIF2B4, RPL38, RPS24, EIF1AX, RPS10, RPL28, RPS13, EIF5A2, MAPK1, EIF2S2, EIF3E, EZR, EIF2B1, EIF4E3, RPS6, EIF4E, EIF2A, RPS4X, SIAH2, BARD1, ALB


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneDCCchr18:18586312chr18:50912413ENST00000442544+14291432_14397861448MYO10


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneROCK1chr18:18586312chr18:50912413ENST00000399799-1633368_7276281355FHOD1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ROCK1_DCC


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ROCK1_DCC


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneDCCC0009404Colorectal Neoplasms1CTD_human
TgeneDCCC0025202melanoma1CTD_human
TgeneDCCC0036341Schizophrenia1PSYGENET