FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31612

FusionGeneSummary for RNGTT_AHI1

check button Fusion gene summary
Fusion gene informationFusion gene name: RNGTT_AHI1
Fusion gene ID: 31612
HgeneTgene
Gene symbol

RNGTT

AHI1

Gene ID

8732

54806

Gene nameRNA guanylyltransferase and 5'-phosphataseAbelson helper integration site 1
SynonymsCAP1A|HCE|HCE1|hCAPAHI-1|JBTS3|ORF1|dJ71N10.1
Cytomap

6q15

6q23.3

Type of geneprotein-codingprotein-coding
DescriptionmRNA-capping enzymeHCAP1jouberinabelson helper integration site 1 protein homologcontatins SH3 and WD40 domains
Modification date2018052320180519
UniProtAcc

O60942

Q8N157

Ensembl transtripts involved in fusion geneENST00000369485, ENST00000265607, 
ENST00000538899, ENST00000369475, 
ENST00000367800, ENST00000457866, 
ENST00000417892, ENST00000327035, 
ENST00000488690, ENST00000367798, 
ENST00000528103, ENST00000534469, 
ENST00000531527, 
Fusion gene scores* DoF score8 X 6 X 4=1926 X 7 X 5=210
# samples 117
** MAII scorelog2(11/192*10)=-0.803602787196497
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RNGTT [Title/Abstract] AND AHI1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRNGTT

GO:0006370

7-methylguanosine mRNA capping

9473487

HgeneRNGTT

GO:0006396

RNA processing

21636784


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-EE-A2A0-06ARNGTTchr6

89479493

-AHI1chr6

135606785

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000369485ENST00000367800RNGTTchr6

89479493

-AHI1chr6

135606785

-
Frame-shiftENST00000369485ENST00000457866RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-3UTRENST00000369485ENST00000417892RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000369485ENST00000327035RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000369485ENST00000488690RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000369485ENST00000367798RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000369485ENST00000528103RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000369485ENST00000534469RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000369485ENST00000531527RNGTTchr6

89479493

-AHI1chr6

135606785

-
In-frameENST00000265607ENST00000367800RNGTTchr6

89479493

-AHI1chr6

135606785

-
Frame-shiftENST00000265607ENST00000457866RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-3UTRENST00000265607ENST00000417892RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000265607ENST00000327035RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000265607ENST00000488690RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000265607ENST00000367798RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000265607ENST00000528103RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000265607ENST00000534469RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000265607ENST00000531527RNGTTchr6

89479493

-AHI1chr6

135606785

-
Frame-shiftENST00000538899ENST00000367800RNGTTchr6

89479493

-AHI1chr6

135606785

-
Frame-shiftENST00000538899ENST00000457866RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-3UTRENST00000538899ENST00000417892RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000538899ENST00000327035RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000538899ENST00000488690RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000538899ENST00000367798RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000538899ENST00000528103RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000538899ENST00000534469RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000538899ENST00000531527RNGTTchr6

89479493

-AHI1chr6

135606785

-
In-frameENST00000369475ENST00000367800RNGTTchr6

89479493

-AHI1chr6

135606785

-
Frame-shiftENST00000369475ENST00000457866RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-3UTRENST00000369475ENST00000417892RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000369475ENST00000327035RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000369475ENST00000488690RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000369475ENST00000367798RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000369475ENST00000528103RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000369475ENST00000534469RNGTTchr6

89479493

-AHI1chr6

135606785

-
5CDS-intronENST00000369475ENST00000531527RNGTTchr6

89479493

-AHI1chr6

135606785

-

Top

FusionProtFeatures for RNGTT_AHI1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RNGTT

O60942

AHI1

Q8N157

Bifunctional mRNA-capping enzyme exhibiting RNA 5'-triphosphatase activity in the N-terminal part and mRNAguanylyltransferase activity in the C-terminal part. Catalyzes thefirst two steps of cap formation: by removing the gamma-phosphatefrom the 5'-triphosphate end of nascent mRNA to yield adiphosphate end, and by transferring the gmp moiety of GTP to the5'-diphosphate terminus. {ECO:0000269|PubMed:21636784,ECO:0000269|PubMed:9473487, ECO:0000269|PubMed:9512541}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRNGTTchr6:89479493chr6:135606785ENST00000265607-1215195_205456575Compositional biasNote=Asp/Glu-rich
HgeneRNGTTchr6:89479493chr6:135606785ENST00000369485-1316195_205479598Compositional biasNote=Asp/Glu-rich
HgeneRNGTTchr6:89479493chr6:135606785ENST00000265607-1215343_345456575Nucleotide bindingGTP
HgeneRNGTTchr6:89479493chr6:135606785ENST00000369485-1316343_345479598Nucleotide bindingGTP
HgeneRNGTTchr6:89479493chr6:135606785ENST00000369485-1316458_460479598Nucleotide bindingGTP
HgeneRNGTTchr6:89479493chr6:135606785ENST00000265607-12151_212456575RegionNote=TPase
HgeneRNGTTchr6:89479493chr6:135606785ENST00000369485-13161_212479598RegionNote=TPase
TgeneAHI1chr6:89479493chr6:135606785ENST00000327035-02313_45-931054Coiled coilOntology_term=ECO:0000255
TgeneAHI1chr6:89479493chr6:135606785ENST00000327035-023234_239-931054Compositional biasNote=Poly-Lys
TgeneAHI1chr6:89479493chr6:135606785ENST00000327035-0231051_1111-931054DomainSH3
TgeneAHI1chr6:89479493chr6:135606785ENST00000327035-023607_649-931054RepeatNote=WD 1
TgeneAHI1chr6:89479493chr6:135606785ENST00000327035-023652_691-931054RepeatNote=WD 2
TgeneAHI1chr6:89479493chr6:135606785ENST00000327035-023695_735-931054RepeatNote=WD 3
TgeneAHI1chr6:89479493chr6:135606785ENST00000327035-023742_781-931054RepeatNote=WD 4
TgeneAHI1chr6:89479493chr6:135606785ENST00000327035-023797_837-931054RepeatNote=WD 5
TgeneAHI1chr6:89479493chr6:135606785ENST00000327035-023841_880-931054RepeatNote=WD 6
TgeneAHI1chr6:89479493chr6:135606785ENST00000327035-023885_926-931054RepeatNote=WD 7

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRNGTTchr6:89479493chr6:135606785ENST00000265607-1215458_460456575Nucleotide bindingGTP
HgeneRNGTTchr6:89479493chr6:135606785ENST00000265607-1215528_533456575Nucleotide bindingGTP
HgeneRNGTTchr6:89479493chr6:135606785ENST00000369485-1316528_533479598Nucleotide bindingGTP
HgeneRNGTTchr6:89479493chr6:135606785ENST00000265607-1215229_597456575RegionNote=GTase
HgeneRNGTTchr6:89479493chr6:135606785ENST00000369485-1316229_597479598RegionNote=GTase
TgeneAHI1chr6:89479493chr6:135606785ENST00000367800-252713_4511961197Coiled coilOntology_term=ECO:0000255
TgeneAHI1chr6:89479493chr6:135606785ENST00000457866-262813_4511961197Coiled coilOntology_term=ECO:0000255
TgeneAHI1chr6:89479493chr6:135606785ENST00000367800-2527234_23911961197Compositional biasNote=Poly-Lys
TgeneAHI1chr6:89479493chr6:135606785ENST00000457866-2628234_23911961197Compositional biasNote=Poly-Lys
TgeneAHI1chr6:89479493chr6:135606785ENST00000367800-25271051_111111961197DomainSH3
TgeneAHI1chr6:89479493chr6:135606785ENST00000457866-26281051_111111961197DomainSH3
TgeneAHI1chr6:89479493chr6:135606785ENST00000367800-2527607_64911961197RepeatNote=WD 1
TgeneAHI1chr6:89479493chr6:135606785ENST00000367800-2527652_69111961197RepeatNote=WD 2
TgeneAHI1chr6:89479493chr6:135606785ENST00000367800-2527695_73511961197RepeatNote=WD 3
TgeneAHI1chr6:89479493chr6:135606785ENST00000367800-2527742_78111961197RepeatNote=WD 4
TgeneAHI1chr6:89479493chr6:135606785ENST00000367800-2527797_83711961197RepeatNote=WD 5
TgeneAHI1chr6:89479493chr6:135606785ENST00000367800-2527841_88011961197RepeatNote=WD 6
TgeneAHI1chr6:89479493chr6:135606785ENST00000367800-2527885_92611961197RepeatNote=WD 7
TgeneAHI1chr6:89479493chr6:135606785ENST00000457866-2628607_64911961197RepeatNote=WD 1
TgeneAHI1chr6:89479493chr6:135606785ENST00000457866-2628652_69111961197RepeatNote=WD 2
TgeneAHI1chr6:89479493chr6:135606785ENST00000457866-2628695_73511961197RepeatNote=WD 3
TgeneAHI1chr6:89479493chr6:135606785ENST00000457866-2628742_78111961197RepeatNote=WD 4
TgeneAHI1chr6:89479493chr6:135606785ENST00000457866-2628797_83711961197RepeatNote=WD 5
TgeneAHI1chr6:89479493chr6:135606785ENST00000457866-2628841_88011961197RepeatNote=WD 6
TgeneAHI1chr6:89479493chr6:135606785ENST00000457866-2628885_92611961197RepeatNote=WD 7


Top

FusionGeneSequence for RNGTT_AHI1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RNGTT_ENST00000369485_chr6_89479493_-_AHI1_ENST00000367800_chr6_135606785_-_480aa
MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQ
CKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDI
EEAPPPPLLPDWCFEDDEDEDEDEDGKKESEPGSSASFGKRRKERLKLGAIFLEGVTVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPG
AQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYL
IYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKP

>In-frame_RNGTT_ENST00000265607_chr6_89479493_-_AHI1_ENST00000367800_chr6_135606785_-_457aa
MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQ
CKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDI
EEAPPPPLLPDWCFEDDEDEDEDEDGKKESEPGSSASFGKRRKERLKLGAIFLEGVTVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPG
AQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYL
IYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKKYKPGRCDDILKWKPPSLNSVDFRLKI

>In-frame_RNGTT_ENST00000369475_chr6_89479493_-_AHI1_ENST00000367800_chr6_135606785_-_480aa
MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQ
CKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDI
EEAPPPPLLPDWCFEDDEDEDEDEDGKKESEPGSSASFGKRRKERLKLGAIFLEGVTVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPG
AQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYL
IYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RNGTT_ENST00000369485_chr6_89479493_-_AHI1_ENST00000367800_chr6_135606785_-_1442nt
ATGGCTCACAACAAGATCCCGCCGCGGTGGCTGAACTGTCCCCGGCGCGGCCAGCCGGTGGCAGGAAGATTCTTACCTCTGAAGACAATG
TTAGGACCAAGATATGATAGTCAAGTTGCTGAAGAAAATCGGTTCCATCCCAGCATGCTCTCAAATTACCTAAAGAGCCTAAAGGTTAAA
ATGGGCTTGTTGGTGGACCTGACAAATACTTCAAGGTTCTATGACCGAAATGACATAGAAAAAGAAGGAATCAAATATATAAAACTTCAG
TGTAAAGGACATGGTGAGTGCCCTACCACTGAGAATACTGAGACCTTTATTCGTCTGTGTGAGCGGTTTAATGAAAGAAATCCACCTGAA
CTTATAGGTGTTCATTGTACTCATGGCTTCAATCGCACTGGTTTCCTCATATGTGCCTTTTTGGTGGAGAAAATGGATTGGAGTATCGAA
GCAGCAGTTGCTACTTTTGCCCAAGCCAGACCACCAGGAATCTACAAGGGTGATTATTTGAAGGAACTTTTTCGTCGGTATGGTGACATA
GAGGAAGCACCACCCCCACCTCTATTGCCAGATTGGTGTTTTGAGGATGATGAAGACGAAGATGAGGATGAGGATGGAAAGAAGGAATCA
GAACCCGGGTCAAGTGCTTCTTTTGGCAAAAGGAGAAAAGAACGGTTAAAACTGGGCGCTATTTTCTTGGAAGGTGTTACTGTTAAAGGT
GTAACTCAAGTAACAACACAACCAAAGTTAGGAGAGGTACAGCAGAAGTGTCATCAATTCTGTGGCTGGGAAGGGTCTGGATTCCCTGGA
GCACAGCCTGTTTCCATGGACAAGCAAAATATTAAACTTTTAGACCTGAAGCCATACAAAGTAAGCTGGAAAGCAGATGGTACTCGGTAC
ATGATGTTGATTGATGGCACAAATGAAGTTTTTATGATTGATAGAGACAATTCAGTATTTCATGTTTCAAATCTGGAATTTCCATTTCGT
AAAGATCTTCGTATGCATTTATCAAATACTCTCTTGGATGGCGAGATGATTATTGACAGAGTAAATGGACAGGCTGTTCCTAGATATTTG
ATATATGACATAATTAAATTCAATTCACAGCCCGTTGGAGATTGTGATTTTAATGTTCGTCTGCAGTGTATAGAACGAGAAATTATAAGT
CCTCGACACGAAAAAATGAAGACTGGGCTCATTGACAAAACACAGGAACCATTTAGCGTCAGAAATAAGCCGTTTTTTGACATCTGTACT
TCAAGAAAGCTACTTGAAGGAAATTTTGCCAAAGAAGTGAGCCATGAAATGGATGGACTTATTTTTCAGCCTACTGGAAAATACAAACCT
GGTCGATGTGATGATATTTTGAAATGGAAGCCTCCCAGTCTGAATTCTGTGGATTTTCGTCTAAAAATAACAAGAATGGGAGGAGAAGGT

>In-frame_RNGTT_ENST00000265607_chr6_89479493_-_AHI1_ENST00000367800_chr6_135606785_-_1373nt
ATGGCTCACAACAAGATCCCGCCGCGGTGGCTGAACTGTCCCCGGCGCGGCCAGCCGGTGGCAGGAAGATTCTTACCTCTGAAGACAATG
TTAGGACCAAGATATGATAGTCAAGTTGCTGAAGAAAATCGGTTCCATCCCAGCATGCTCTCAAATTACCTAAAGAGCCTAAAGGTTAAA
ATGGGCTTGTTGGTGGACCTGACAAATACTTCAAGGTTCTATGACCGAAATGACATAGAAAAAGAAGGAATCAAATATATAAAACTTCAG
TGTAAAGGACATGGTGAGTGCCCTACCACTGAGAATACTGAGACCTTTATTCGTCTGTGTGAGCGGTTTAATGAAAGAAATCCACCTGAA
CTTATAGGTGTTCATTGTACTCATGGCTTCAATCGCACTGGTTTCCTCATATGTGCCTTTTTGGTGGAGAAAATGGATTGGAGTATCGAA
GCAGCAGTTGCTACTTTTGCCCAAGCCAGACCACCAGGAATCTACAAGGGTGATTATTTGAAGGAACTTTTTCGTCGGTATGGTGACATA
GAGGAAGCACCACCCCCACCTCTATTGCCAGATTGGTGTTTTGAGGATGATGAAGACGAAGATGAGGATGAGGATGGAAAGAAGGAATCA
GAACCCGGGTCAAGTGCTTCTTTTGGCAAAAGGAGAAAAGAACGGTTAAAACTGGGCGCTATTTTCTTGGAAGGTGTTACTGTTAAAGGT
GTAACTCAAGTAACAACACAACCAAAGTTAGGAGAGGTACAGCAGAAGTGTCATCAATTCTGTGGCTGGGAAGGGTCTGGATTCCCTGGA
GCACAGCCTGTTTCCATGGACAAGCAAAATATTAAACTTTTAGACCTGAAGCCATACAAAGTAAGCTGGAAAGCAGATGGTACTCGGTAC
ATGATGTTGATTGATGGCACAAATGAAGTTTTTATGATTGATAGAGACAATTCAGTATTTCATGTTTCAAATCTGGAATTTCCATTTCGT
AAAGATCTTCGTATGCATTTATCAAATACTCTCTTGGATGGCGAGATGATTATTGACAGAGTAAATGGACAGGCTGTTCCTAGATATTTG
ATATATGACATAATTAAATTCAATTCACAGCCCGTTGGAGATTGTGATTTTAATGTTCGTCTGCAGTGTATAGAACGAGAAATTATAAGT
CCTCGACACGAAAAAATGAAGACTGGGCTCATTGACAAAACACAGGAACCATTTAGCGTCAGAAATAAGCCGTTTTTTGACATCTGTACT
TCAAGAAAGAAATACAAACCTGGTCGATGTGATGATATTTTGAAATGGAAGCCTCCCAGTCTGAATTCTGTGGATTTTCGTCTAAAAATA

>In-frame_RNGTT_ENST00000369475_chr6_89479493_-_AHI1_ENST00000367800_chr6_135606785_-_1442nt
ATGGCTCACAACAAGATCCCGCCGCGGTGGCTGAACTGTCCCCGGCGCGGCCAGCCGGTGGCAGGAAGATTCTTACCTCTGAAGACAATG
TTAGGACCAAGATATGATAGTCAAGTTGCTGAAGAAAATCGGTTCCATCCCAGCATGCTCTCAAATTACCTAAAGAGCCTAAAGGTTAAA
ATGGGCTTGTTGGTGGACCTGACAAATACTTCAAGGTTCTATGACCGAAATGACATAGAAAAAGAAGGAATCAAATATATAAAACTTCAG
TGTAAAGGACATGGTGAGTGCCCTACCACTGAGAATACTGAGACCTTTATTCGTCTGTGTGAGCGGTTTAATGAAAGAAATCCACCTGAA
CTTATAGGTGTTCATTGTACTCATGGCTTCAATCGCACTGGTTTCCTCATATGTGCCTTTTTGGTGGAGAAAATGGATTGGAGTATCGAA
GCAGCAGTTGCTACTTTTGCCCAAGCCAGACCACCAGGAATCTACAAGGGTGATTATTTGAAGGAACTTTTTCGTCGGTATGGTGACATA
GAGGAAGCACCACCCCCACCTCTATTGCCAGATTGGTGTTTTGAGGATGATGAAGACGAAGATGAGGATGAGGATGGAAAGAAGGAATCA
GAACCCGGGTCAAGTGCTTCTTTTGGCAAAAGGAGAAAAGAACGGTTAAAACTGGGCGCTATTTTCTTGGAAGGTGTTACTGTTAAAGGT
GTAACTCAAGTAACAACACAACCAAAGTTAGGAGAGGTACAGCAGAAGTGTCATCAATTCTGTGGCTGGGAAGGGTCTGGATTCCCTGGA
GCACAGCCTGTTTCCATGGACAAGCAAAATATTAAACTTTTAGACCTGAAGCCATACAAAGTAAGCTGGAAAGCAGATGGTACTCGGTAC
ATGATGTTGATTGATGGCACAAATGAAGTTTTTATGATTGATAGAGACAATTCAGTATTTCATGTTTCAAATCTGGAATTTCCATTTCGT
AAAGATCTTCGTATGCATTTATCAAATACTCTCTTGGATGGCGAGATGATTATTGACAGAGTAAATGGACAGGCTGTTCCTAGATATTTG
ATATATGACATAATTAAATTCAATTCACAGCCCGTTGGAGATTGTGATTTTAATGTTCGTCTGCAGTGTATAGAACGAGAAATTATAAGT
CCTCGACACGAAAAAATGAAGACTGGGCTCATTGACAAAACACAGGAACCATTTAGCGTCAGAAATAAGCCGTTTTTTGACATCTGTACT
TCAAGAAAGCTACTTGAAGGAAATTTTGCCAAAGAAGTGAGCCATGAAATGGATGGACTTATTTTTCAGCCTACTGGAAAATACAAACCT
GGTCGATGTGATGATATTTTGAAATGGAAGCCTCCCAGTCTGAATTCTGTGGATTTTCGTCTAAAAATAACAAGAATGGGAGGAGAAGGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_RNGTT_ENST00000369485_chr6_89479493_-_AHI1_ENST00000367800_chr6_135606785_-_3742nt
TGTGGAGTTGATCCTGAATGAAAGTGGCGCGCCGCCCCTGACGTTACCCGGATCGGAGAGGTTGGAATTCAGATTACGGCTGCGATTCGG
GTGTCTCGGACCCCGGTGTGCACCGGACCACGGGGAGGCGGCTCCAAAGGCGCGGTGAACGTTGGTGAGGGAGGGCAGCTCTGCGCAGCC
CCAAGACATGGCTCACAACAAGATCCCGCCGCGGTGGCTGAACTGTCCCCGGCGCGGCCAGCCGGTGGCAGGAAGATTCTTACCTCTGAA
GACAATGTTAGGACCAAGATATGATAGTCAAGTTGCTGAAGAAAATCGGTTCCATCCCAGCATGCTCTCAAATTACCTAAAGAGCCTAAA
GGTTAAAATGGGCTTGTTGGTGGACCTGACAAATACTTCAAGGTTCTATGACCGAAATGACATAGAAAAAGAAGGAATCAAATATATAAA
ACTTCAGTGTAAAGGACATGGTGAGTGCCCTACCACTGAGAATACTGAGACCTTTATTCGTCTGTGTGAGCGGTTTAATGAAAGAAATCC
ACCTGAACTTATAGGTGTTCATTGTACTCATGGCTTCAATCGCACTGGTTTCCTCATATGTGCCTTTTTGGTGGAGAAAATGGATTGGAG
TATCGAAGCAGCAGTTGCTACTTTTGCCCAAGCCAGACCACCAGGAATCTACAAGGGTGATTATTTGAAGGAACTTTTTCGTCGGTATGG
TGACATAGAGGAAGCACCACCCCCACCTCTATTGCCAGATTGGTGTTTTGAGGATGATGAAGACGAAGATGAGGATGAGGATGGAAAGAA
GGAATCAGAACCCGGGTCAAGTGCTTCTTTTGGCAAAAGGAGAAAAGAACGGTTAAAACTGGGCGCTATTTTCTTGGAAGGTGTTACTGT
TAAAGGTGTAACTCAAGTAACAACACAACCAAAGTTAGGAGAGGTACAGCAGAAGTGTCATCAATTCTGTGGCTGGGAAGGGTCTGGATT
CCCTGGAGCACAGCCTGTTTCCATGGACAAGCAAAATATTAAACTTTTAGACCTGAAGCCATACAAAGTAAGCTGGAAAGCAGATGGTAC
TCGGTACATGATGTTGATTGATGGCACAAATGAAGTTTTTATGATTGATAGAGACAATTCAGTATTTCATGTTTCAAATCTGGAATTTCC
ATTTCGTAAAGATCTTCGTATGCATTTATCAAATACTCTCTTGGATGGCGAGATGATTATTGACAGAGTAAATGGACAGGCTGTTCCTAG
ATATTTGATATATGACATAATTAAATTCAATTCACAGCCCGTTGGAGATTGTGATTTTAATGTTCGTCTGCAGTGTATAGAACGAGAAAT
TATAAGTCCTCGACACGAAAAAATGAAGACTGGGCTCATTGACAAAACACAGGAACCATTTAGCGTCAGAAATAAGCCGTTTTTTGACAT
CTGTACTTCAAGAAAGCTACTTGAAGGAAATTTTGCCAAAGAAGTGAGCCATGAAATGGATGGACTTATTTTTCAGCCTACTGGAAAATA
CAAACCTGGTCGATGTGATGATATTTTGAAATGGAAGCCTCCCAGTCTGAATTCTGTGGATTTTCGTCTAAAAATAACAAGAATGGGAGG
AGAAGGTAAAGAATTGAAGAAAAGTTAAGAGCTGCCGAAATGCACAGAGGTGAAAATGACAAACCAAATGGAATTTCTCTTCAGAGTTCA
GAATTTTCAGATACTAAGGAGGAAGAAAGGATCCACTACTTCTTGTTCTTATGAATGACTCTAGAAAAATCAGAATCAAGTTGTGGGTGG
AAAAATCAACGTGGCCTTTGAGTTCAGTTGTTATAAACCATTGTGACTATTGTTGGTCAAAGTATTGGTACTTATATTGTTAGTAATTGC
ATCATAATTACATTACCAGTGTTGGAAAACTAATGAAGAAAACACTGTAATTGCTACTCAGCAAATGTGAATAAAAGGTGTTTGCGTTAT
TAGGATGTCTGTTAAGTAATCATTTAATATTATTATATTGGTAATGGTTGTATGTGTGATGCTATGCCCAGAATATGAAGTATCTGTTTT
TGAAATTCACTTTATTTAAAAGATAAGCAGCTGACTGGGCACGGTGCCTCATGCCTGTAATCCTAGCACCTTGGGAGGCTGAGGCAGGTG
GATCACCTAAGGTCAGGAGTTCAACAACACCAGCCTGACCAACATGGTGAAACCCCATCTCTACTAAAAATACAAAAATCAGCCGGGTCT
CATGGCAGGCACCTGTAATCCCATCTACTGAGGCAGGAGAATTGCTTGACCCAGGAGGCAGAGGTTGCAGTGAGCCAAGATCACGCCATT
GCACTCCAGCCTGGGGGACAGAGCAAGACTCTATCTCCAAAAAACAAAAAAGATAAGCAGCTTTAGAATATGGCGCATTCAAAACAGTCT
CAGTAACAAAGACATTAAAAGAAAACAATTTACTTTCTAATTAAAATTTTGTGTTTCTTAAGATCAAATCATATAGGTAACTTCATAGAC
CTAAATTAAAAGTGATTTTTGGCTGGACTGGCAACAATGTTCCCAATGTCTTTACTTTTTAAAAAAGGCTTTTCATATTTAAGCACATAC
CTATTTTGTAGACTTACATTGTTTAATATTTATTTTAATCTTAATATTTTTACATTATTATATTGCATTATTTATTTTTTCTAAGTTCCA
GAATAATAGTGTCATTATTATAGACTATATGTTTTGAAGTTTGATATTATAATGGGATATTCATTTTTTGTTCTTTTCTTGACTCCTTTC
TCAAGTGTGTGATAAGGTCTGCTGATAAAATATTTAACCCCAAGAAAGTGAAAACTAATATAAAATTAGAAAGACCTATCCAAATTAGAC
AGTCAATTCCATTAAAATAAGAAGTGAGAAAAACAATGTTGGGCATTGAGGTGTAAATTTTGCCCAGATGTATACCCAGTGTGAAATATC
TTCTAATAAAAATATATTTGGCTCTTATCCCTGCACATGTAGAGGCATAAAAATTGGTAAACATGTCCCGCTGTGTAGAACTTTAAAAAA
AAGGCATTTTTGAAAGTGTTGAGTGGCACTGATAACTGGTGAAGCCTACAGCCATCCGCCCAAAAGTCTGTTCTGATGGCACTGAGTTTT
CATTGTTCTGGATGTATAAGTCTGTGTGTCAGGTACAGCTGGGCCCAGCCAGCTTGAGTCACTCTTGTACAAGCTTGTTTTTTTCTGTCT
TGTGAATGCACTTGATAATTTAAAAATAAAAATATCTGTTTCTCTGCAGTTTCAGCTAATAATTTTGAGATATGTGTTGATTTTCTGATT
GAATCACCAAGAATTTCAACAAGTTTAGAAATAATTTAAGATGAATGAAAAATATGTCAGGGGGAGCTAAGCATTTGCTAAGCTCTTGAT
GTTTATATGAAAAATAAAGGGTTGTTTTTATATTGCAACTACTAAAGAGAAAAATAGCAGTTGAAGCAAACACCAGGAAAATTTGGCTCT
ACTGAAAGCCCAGTCCTTTTCCCCTTTGTCTCGCTGACAAAGTAAGACTAGGGTTATGTTCATGAATAGATTAATAAAAGATGTTTCTTT
ACCACACAATCTGAGATGAGATGGGGTGGGGGAGATCATGACAGTGCCCTCCAAGCAATAGATCCAGCTGATAATCAAGCAGAAAATCAG

>In-frame_RNGTT_ENST00000265607_chr6_89479493_-_AHI1_ENST00000367800_chr6_135606785_-_3706nt
GAAGTTGCGGTGCATTGTGGGTTCTCCTGGAGCTGTGGAGTTGATCCTGAATGAAAGTGGCGCGCCGCCCCTGACGTTACCCGGATCGGA
GAGGTTGGAATTCAGATTACGGCTGCGATTCGGGTGTCTCGGACCCCGGTGTGCACCGGACCACGGGGAGGCGGCTCCAAAGGCGCGGTG
AACGTTGGTGAGGGAGGGCAGCTCTGCGCAGCCCCAAGACATGGCTCACAACAAGATCCCGCCGCGGTGGCTGAACTGTCCCCGGCGCGG
CCAGCCGGTGGCAGGAAGATTCTTACCTCTGAAGACAATGTTAGGACCAAGATATGATAGTCAAGTTGCTGAAGAAAATCGGTTCCATCC
CAGCATGCTCTCAAATTACCTAAAGAGCCTAAAGGTTAAAATGGGCTTGTTGGTGGACCTGACAAATACTTCAAGGTTCTATGACCGAAA
TGACATAGAAAAAGAAGGAATCAAATATATAAAACTTCAGTGTAAAGGACATGGTGAGTGCCCTACCACTGAGAATACTGAGACCTTTAT
TCGTCTGTGTGAGCGGTTTAATGAAAGAAATCCACCTGAACTTATAGGTGTTCATTGTACTCATGGCTTCAATCGCACTGGTTTCCTCAT
ATGTGCCTTTTTGGTGGAGAAAATGGATTGGAGTATCGAAGCAGCAGTTGCTACTTTTGCCCAAGCCAGACCACCAGGAATCTACAAGGG
TGATTATTTGAAGGAACTTTTTCGTCGGTATGGTGACATAGAGGAAGCACCACCCCCACCTCTATTGCCAGATTGGTGTTTTGAGGATGA
TGAAGACGAAGATGAGGATGAGGATGGAAAGAAGGAATCAGAACCCGGGTCAAGTGCTTCTTTTGGCAAAAGGAGAAAAGAACGGTTAAA
ACTGGGCGCTATTTTCTTGGAAGGTGTTACTGTTAAAGGTGTAACTCAAGTAACAACACAACCAAAGTTAGGAGAGGTACAGCAGAAGTG
TCATCAATTCTGTGGCTGGGAAGGGTCTGGATTCCCTGGAGCACAGCCTGTTTCCATGGACAAGCAAAATATTAAACTTTTAGACCTGAA
GCCATACAAAGTAAGCTGGAAAGCAGATGGTACTCGGTACATGATGTTGATTGATGGCACAAATGAAGTTTTTATGATTGATAGAGACAA
TTCAGTATTTCATGTTTCAAATCTGGAATTTCCATTTCGTAAAGATCTTCGTATGCATTTATCAAATACTCTCTTGGATGGCGAGATGAT
TATTGACAGAGTAAATGGACAGGCTGTTCCTAGATATTTGATATATGACATAATTAAATTCAATTCACAGCCCGTTGGAGATTGTGATTT
TAATGTTCGTCTGCAGTGTATAGAACGAGAAATTATAAGTCCTCGACACGAAAAAATGAAGACTGGGCTCATTGACAAAACACAGGAACC
ATTTAGCGTCAGAAATAAGCCGTTTTTTGACATCTGTACTTCAAGAAAGAAATACAAACCTGGTCGATGTGATGATATTTTGAAATGGAA
GCCTCCCAGTCTGAATTCTGTGGATTTTCGTCTAAAAATAACAAGAATGGGAGGAGAAGGTAAAGAATTGAAGAAAAGTTAAGAGCTGCC
GAAATGCACAGAGGTGAAAATGACAAACCAAATGGAATTTCTCTTCAGAGTTCAGAATTTTCAGATACTAAGGAGGAAGAAAGGATCCAC
TACTTCTTGTTCTTATGAATGACTCTAGAAAAATCAGAATCAAGTTGTGGGTGGAAAAATCAACGTGGCCTTTGAGTTCAGTTGTTATAA
ACCATTGTGACTATTGTTGGTCAAAGTATTGGTACTTATATTGTTAGTAATTGCATCATAATTACATTACCAGTGTTGGAAAACTAATGA
AGAAAACACTGTAATTGCTACTCAGCAAATGTGAATAAAAGGTGTTTGCGTTATTAGGATGTCTGTTAAGTAATCATTTAATATTATTAT
ATTGGTAATGGTTGTATGTGTGATGCTATGCCCAGAATATGAAGTATCTGTTTTTGAAATTCACTTTATTTAAAAGATAAGCAGCTGACT
GGGCACGGTGCCTCATGCCTGTAATCCTAGCACCTTGGGAGGCTGAGGCAGGTGGATCACCTAAGGTCAGGAGTTCAACAACACCAGCCT
GACCAACATGGTGAAACCCCATCTCTACTAAAAATACAAAAATCAGCCGGGTCTCATGGCAGGCACCTGTAATCCCATCTACTGAGGCAG
GAGAATTGCTTGACCCAGGAGGCAGAGGTTGCAGTGAGCCAAGATCACGCCATTGCACTCCAGCCTGGGGGACAGAGCAAGACTCTATCT
CCAAAAAACAAAAAAGATAAGCAGCTTTAGAATATGGCGCATTCAAAACAGTCTCAGTAACAAAGACATTAAAAGAAAACAATTTACTTT
CTAATTAAAATTTTGTGTTTCTTAAGATCAAATCATATAGGTAACTTCATAGACCTAAATTAAAAGTGATTTTTGGCTGGACTGGCAACA
ATGTTCCCAATGTCTTTACTTTTTAAAAAAGGCTTTTCATATTTAAGCACATACCTATTTTGTAGACTTACATTGTTTAATATTTATTTT
AATCTTAATATTTTTACATTATTATATTGCATTATTTATTTTTTCTAAGTTCCAGAATAATAGTGTCATTATTATAGACTATATGTTTTG
AAGTTTGATATTATAATGGGATATTCATTTTTTGTTCTTTTCTTGACTCCTTTCTCAAGTGTGTGATAAGGTCTGCTGATAAAATATTTA
ACCCCAAGAAAGTGAAAACTAATATAAAATTAGAAAGACCTATCCAAATTAGACAGTCAATTCCATTAAAATAAGAAGTGAGAAAAACAA
TGTTGGGCATTGAGGTGTAAATTTTGCCCAGATGTATACCCAGTGTGAAATATCTTCTAATAAAAATATATTTGGCTCTTATCCCTGCAC
ATGTAGAGGCATAAAAATTGGTAAACATGTCCCGCTGTGTAGAACTTTAAAAAAAAGGCATTTTTGAAAGTGTTGAGTGGCACTGATAAC
TGGTGAAGCCTACAGCCATCCGCCCAAAAGTCTGTTCTGATGGCACTGAGTTTTCATTGTTCTGGATGTATAAGTCTGTGTGTCAGGTAC
AGCTGGGCCCAGCCAGCTTGAGTCACTCTTGTACAAGCTTGTTTTTTTCTGTCTTGTGAATGCACTTGATAATTTAAAAATAAAAATATC
TGTTTCTCTGCAGTTTCAGCTAATAATTTTGAGATATGTGTTGATTTTCTGATTGAATCACCAAGAATTTCAACAAGTTTAGAAATAATT
TAAGATGAATGAAAAATATGTCAGGGGGAGCTAAGCATTTGCTAAGCTCTTGATGTTTATATGAAAAATAAAGGGTTGTTTTTATATTGC
AACTACTAAAGAGAAAAATAGCAGTTGAAGCAAACACCAGGAAAATTTGGCTCTACTGAAAGCCCAGTCCTTTTCCCCTTTGTCTCGCTG
ACAAAGTAAGACTAGGGTTATGTTCATGAATAGATTAATAAAAGATGTTTCTTTACCACACAATCTGAGATGAGATGGGGTGGGGGAGAT
CATGACAGTGCCCTCCAAGCAATAGATCCAGCTGATAATCAAGCAGAAAATCAGACACCAGAATCCATTTGATGATGTACGGCATTAAAC

>In-frame_RNGTT_ENST00000369475_chr6_89479493_-_AHI1_ENST00000367800_chr6_135606785_-_3707nt
CCCTGACGTTACCCGGATCGGAGAGGTTGGAATTCAGATTACGGCTGCGATTCGGGTGTCTCGGACCCCGGTGTGCACCGGACCACGGGG
AGGCGGCTCCAAAGGCGCGGTGAACGTTGGTGAGGGAGGGCAGCTCTGCGCAGCCCCAAGACATGGCTCACAACAAGATCCCGCCGCGGT
GGCTGAACTGTCCCCGGCGCGGCCAGCCGGTGGCAGGAAGATTCTTACCTCTGAAGACAATGTTAGGACCAAGATATGATAGTCAAGTTG
CTGAAGAAAATCGGTTCCATCCCAGCATGCTCTCAAATTACCTAAAGAGCCTAAAGGTTAAAATGGGCTTGTTGGTGGACCTGACAAATA
CTTCAAGGTTCTATGACCGAAATGACATAGAAAAAGAAGGAATCAAATATATAAAACTTCAGTGTAAAGGACATGGTGAGTGCCCTACCA
CTGAGAATACTGAGACCTTTATTCGTCTGTGTGAGCGGTTTAATGAAAGAAATCCACCTGAACTTATAGGTGTTCATTGTACTCATGGCT
TCAATCGCACTGGTTTCCTCATATGTGCCTTTTTGGTGGAGAAAATGGATTGGAGTATCGAAGCAGCAGTTGCTACTTTTGCCCAAGCCA
GACCACCAGGAATCTACAAGGGTGATTATTTGAAGGAACTTTTTCGTCGGTATGGTGACATAGAGGAAGCACCACCCCCACCTCTATTGC
CAGATTGGTGTTTTGAGGATGATGAAGACGAAGATGAGGATGAGGATGGAAAGAAGGAATCAGAACCCGGGTCAAGTGCTTCTTTTGGCA
AAAGGAGAAAAGAACGGTTAAAACTGGGCGCTATTTTCTTGGAAGGTGTTACTGTTAAAGGTGTAACTCAAGTAACAACACAACCAAAGT
TAGGAGAGGTACAGCAGAAGTGTCATCAATTCTGTGGCTGGGAAGGGTCTGGATTCCCTGGAGCACAGCCTGTTTCCATGGACAAGCAAA
ATATTAAACTTTTAGACCTGAAGCCATACAAAGTAAGCTGGAAAGCAGATGGTACTCGGTACATGATGTTGATTGATGGCACAAATGAAG
TTTTTATGATTGATAGAGACAATTCAGTATTTCATGTTTCAAATCTGGAATTTCCATTTCGTAAAGATCTTCGTATGCATTTATCAAATA
CTCTCTTGGATGGCGAGATGATTATTGACAGAGTAAATGGACAGGCTGTTCCTAGATATTTGATATATGACATAATTAAATTCAATTCAC
AGCCCGTTGGAGATTGTGATTTTAATGTTCGTCTGCAGTGTATAGAACGAGAAATTATAAGTCCTCGACACGAAAAAATGAAGACTGGGC
TCATTGACAAAACACAGGAACCATTTAGCGTCAGAAATAAGCCGTTTTTTGACATCTGTACTTCAAGAAAGCTACTTGAAGGAAATTTTG
CCAAAGAAGTGAGCCATGAAATGGATGGACTTATTTTTCAGCCTACTGGAAAATACAAACCTGGTCGATGTGATGATATTTTGAAATGGA
AGCCTCCCAGTCTGAATTCTGTGGATTTTCGTCTAAAAATAACAAGAATGGGAGGAGAAGGTAAAGAATTGAAGAAAAGTTAAGAGCTGC
CGAAATGCACAGAGGTGAAAATGACAAACCAAATGGAATTTCTCTTCAGAGTTCAGAATTTTCAGATACTAAGGAGGAAGAAAGGATCCA
CTACTTCTTGTTCTTATGAATGACTCTAGAAAAATCAGAATCAAGTTGTGGGTGGAAAAATCAACGTGGCCTTTGAGTTCAGTTGTTATA
AACCATTGTGACTATTGTTGGTCAAAGTATTGGTACTTATATTGTTAGTAATTGCATCATAATTACATTACCAGTGTTGGAAAACTAATG
AAGAAAACACTGTAATTGCTACTCAGCAAATGTGAATAAAAGGTGTTTGCGTTATTAGGATGTCTGTTAAGTAATCATTTAATATTATTA
TATTGGTAATGGTTGTATGTGTGATGCTATGCCCAGAATATGAAGTATCTGTTTTTGAAATTCACTTTATTTAAAAGATAAGCAGCTGAC
TGGGCACGGTGCCTCATGCCTGTAATCCTAGCACCTTGGGAGGCTGAGGCAGGTGGATCACCTAAGGTCAGGAGTTCAACAACACCAGCC
TGACCAACATGGTGAAACCCCATCTCTACTAAAAATACAAAAATCAGCCGGGTCTCATGGCAGGCACCTGTAATCCCATCTACTGAGGCA
GGAGAATTGCTTGACCCAGGAGGCAGAGGTTGCAGTGAGCCAAGATCACGCCATTGCACTCCAGCCTGGGGGACAGAGCAAGACTCTATC
TCCAAAAAACAAAAAAGATAAGCAGCTTTAGAATATGGCGCATTCAAAACAGTCTCAGTAACAAAGACATTAAAAGAAAACAATTTACTT
TCTAATTAAAATTTTGTGTTTCTTAAGATCAAATCATATAGGTAACTTCATAGACCTAAATTAAAAGTGATTTTTGGCTGGACTGGCAAC
AATGTTCCCAATGTCTTTACTTTTTAAAAAAGGCTTTTCATATTTAAGCACATACCTATTTTGTAGACTTACATTGTTTAATATTTATTT
TAATCTTAATATTTTTACATTATTATATTGCATTATTTATTTTTTCTAAGTTCCAGAATAATAGTGTCATTATTATAGACTATATGTTTT
GAAGTTTGATATTATAATGGGATATTCATTTTTTGTTCTTTTCTTGACTCCTTTCTCAAGTGTGTGATAAGGTCTGCTGATAAAATATTT
AACCCCAAGAAAGTGAAAACTAATATAAAATTAGAAAGACCTATCCAAATTAGACAGTCAATTCCATTAAAATAAGAAGTGAGAAAAACA
ATGTTGGGCATTGAGGTGTAAATTTTGCCCAGATGTATACCCAGTGTGAAATATCTTCTAATAAAAATATATTTGGCTCTTATCCCTGCA
CATGTAGAGGCATAAAAATTGGTAAACATGTCCCGCTGTGTAGAACTTTAAAAAAAAGGCATTTTTGAAAGTGTTGAGTGGCACTGATAA
CTGGTGAAGCCTACAGCCATCCGCCCAAAAGTCTGTTCTGATGGCACTGAGTTTTCATTGTTCTGGATGTATAAGTCTGTGTGTCAGGTA
CAGCTGGGCCCAGCCAGCTTGAGTCACTCTTGTACAAGCTTGTTTTTTTCTGTCTTGTGAATGCACTTGATAATTTAAAAATAAAAATAT
CTGTTTCTCTGCAGTTTCAGCTAATAATTTTGAGATATGTGTTGATTTTCTGATTGAATCACCAAGAATTTCAACAAGTTTAGAAATAAT
TTAAGATGAATGAAAAATATGTCAGGGGGAGCTAAGCATTTGCTAAGCTCTTGATGTTTATATGAAAAATAAAGGGTTGTTTTTATATTG
CAACTACTAAAGAGAAAAATAGCAGTTGAAGCAAACACCAGGAAAATTTGGCTCTACTGAAAGCCCAGTCCTTTTCCCCTTTGTCTCGCT
GACAAAGTAAGACTAGGGTTATGTTCATGAATAGATTAATAAAAGATGTTTCTTTACCACACAATCTGAGATGAGATGGGGTGGGGGAGA
TCATGACAGTGCCCTCCAAGCAATAGATCCAGCTGATAATCAAGCAGAAAATCAGACACCAGAATCCATTTGATGATGTACGGCATTAAA


Top

FusionGenePPI for RNGTT_AHI1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RNGTTRNMT, MYC, CRK, BARD1, BRCA1, SOX2, NUP50, NTRK1, HERC2, NFATC2, POLR2A, POLR2B, POLR2C, POLR2D, POLR2E, POLR2G, PPP4C, PPP4R2, SMEK1, SMEK2, SUPT5H, EEF1D, POLR2I, RNGTT, LACRT, SCGB2A1, PROL1, SUPT4H1, SNX18, SNX9, RPAP2, LY6G5B, CSNK2A2, BRIX1, RPL36AL, CLUH, RPS19BP1, RPS10P5, CSNK2A1, GADD45GIP1, BCAS2, HNRNPH3, IGHA1, RPL37A, INTU, TRIM25AHI1ELAVL1, KHDRBS1, DNM2, OFD1, PCM1, DSP, DVL1, ECD, HAUS8, IQCB1, MAPK9, MB21D2, NMT1, PPP2CA, PPP2R1A, PPP2R2A, SIRT2, SSX2IP, UNC45A, CEP131, CAD, CCDC138, LRRC49, MED4, PPP2R2B, SRP72, WRAP73, CC2D2A, DOCK5, PTPRQ, PIBF1, SLC9A3R2, PAFAH1B1, NINL, DCTN1, DCTN2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneRNGTTchr6:89479493chr6:135606785ENST00000265607-1215330_386456575POLR2A
HgeneRNGTTchr6:89479493chr6:135606785ENST00000369485-1316330_386479598POLR2A
TgeneAHI1chr6:89479493chr6:135606785ENST00000327035-023141_434-931054HAP1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneAHI1chr6:89479493chr6:135606785ENST00000367800-2527141_43411961197HAP1
TgeneAHI1chr6:89479493chr6:135606785ENST00000457866-2628141_43411961197HAP1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RNGTT_AHI1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneRNGTTO60942DB02325Isopropyl AlcoholmRNA-capping enzymesmall moleculeapproved|investigational

Top

RelatedDiseases for RNGTT_AHI1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneAHI1C1837713JOUBERT SYNDROME 35CTD_human;UNIPROT
TgeneAHI1C0004352Autistic Disorder1CTD_human
TgeneAHI1C0005586Bipolar Disorder1PSYGENET
TgeneAHI1C0007760Cerebellar Diseases1CTD_human
TgeneAHI1C0035304Retinal Degeneration1CTD_human
TgeneAHI1C0036341Schizophrenia1CTD_human
TgeneAHI1C0162538Immunoglobulin A deficiency (disorder)1CTD_human
TgeneAHI1C3714756Intellectual Disability1CTD_human;HPO