FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31520

FusionGeneSummary for RNF213_HSD17B14

check button Fusion gene summary
Fusion gene informationFusion gene name: RNF213_HSD17B14
Fusion gene ID: 31520
HgeneTgene
Gene symbol

RNF213

HSD17B14

Gene ID

57674

51171

Gene namering finger protein 213hydroxysteroid 17-beta dehydrogenase 14
SynonymsALO17|C17orf27|KIAA1618|MYMY2|MYSTR|NET57DHRS10|SDR47C1|retSDR3
Cytomap

17q25.3

19q13.33

Type of geneprotein-codingprotein-coding
DescriptionE3 ubiquitin-protein ligase RNF213ALK lymphoma oligomerization partner on chromosome 17RING-type E3 ubiquitin transferase RNF213mysterin17-beta-hydroxysteroid dehydrogenase 1417-beta-HSD 1417-beta-hydroxysteroid dehydrogenase DHRS10dehydrogenase/reductase (SDR family) member 10retinal short-chain dehydrogenase/reductase 3retinal short-chain dehydrogenase/reductase retSDR3short chain
Modification date2018052720180522
UniProtAcc

Q63HN8

Q9BPX1

Ensembl transtripts involved in fusion geneENST00000508628, ENST00000456466, 
ENST00000582970, ENST00000319921, 
ENST00000336301, ENST00000427003, 
ENST00000263278, ENST00000599157, 
Fusion gene scores* DoF score22 X 22 X 12=58084 X 2 X 3=24
# samples 305
** MAII scorelog2(30/5808*10)=-4.27500704749987
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/24*10)=1.05889368905357
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RNF213 [Title/Abstract] AND HSD17B14 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRNF213

GO:0016567

protein ubiquitination

21799892

HgeneRNF213

GO:0051260

protein homooligomerization

24658080|26126547

HgeneRNF213

GO:0051865

protein autoubiquitination

21799892

TgeneHSD17B14

GO:0006706

steroid catabolic process

17067289


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLIHCTCGA-DD-A11C-01ARNF213chr17

78286967

+HSD17B14chr19

49318398

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000508628ENST00000263278RNF213chr17

78286967

+HSD17B14chr19

49318398

-
In-frameENST00000508628ENST00000599157RNF213chr17

78286967

+HSD17B14chr19

49318398

-
In-frameENST00000456466ENST00000263278RNF213chr17

78286967

+HSD17B14chr19

49318398

-
In-frameENST00000456466ENST00000599157RNF213chr17

78286967

+HSD17B14chr19

49318398

-
In-frameENST00000582970ENST00000263278RNF213chr17

78286967

+HSD17B14chr19

49318398

-
In-frameENST00000582970ENST00000599157RNF213chr17

78286967

+HSD17B14chr19

49318398

-
In-frameENST00000319921ENST00000263278RNF213chr17

78286967

+HSD17B14chr19

49318398

-
In-frameENST00000319921ENST00000599157RNF213chr17

78286967

+HSD17B14chr19

49318398

-
intron-3CDSENST00000336301ENST00000263278RNF213chr17

78286967

+HSD17B14chr19

49318398

-
intron-3CDSENST00000336301ENST00000599157RNF213chr17

78286967

+HSD17B14chr19

49318398

-
intron-3CDSENST00000427003ENST00000263278RNF213chr17

78286967

+HSD17B14chr19

49318398

-
intron-3CDSENST00000427003ENST00000599157RNF213chr17

78286967

+HSD17B14chr19

49318398

-

Top

FusionProtFeatures for RNF213_HSD17B14


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RNF213

Q63HN8

HSD17B14

Q9BPX1

Has NAD-dependent 17-beta-hydroxysteroid dehydrogenaseactivity. Converts oestradiol to oestrone. The physiologicalsubstrate is not known. Acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro). {ECO:0000269|PubMed:17067289}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRNF213chr17:78286967chr19:49318398ENST00000319921+1517343_3749371064Coiled coilOntology_term=ECO:0000255
HgeneRNF213chr17:78286967chr19:49318398ENST00000508628+1669343_3749865257Coiled coilOntology_term=ECO:0000255
HgeneRNF213chr17:78286967chr19:49318398ENST00000582970+1568343_3749375208Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRNF213chr17:78286967chr19:49318398ENST00000319921+15173997_40369371064Zinc fingerRING-type
HgeneRNF213chr17:78286967chr19:49318398ENST00000508628+16693997_40369865257Zinc fingerRING-type
HgeneRNF213chr17:78286967chr19:49318398ENST00000582970+15683997_40369375208Zinc fingerRING-type
TgeneHSD17B14chr17:78286967chr19:49318398ENST00000263278-4913_40123271Nucleotide bindingNAD


Top

FusionGeneSequence for RNF213_HSD17B14


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RNF213_ENST00000508628_chr17_78286967_+_HSD17B14_ENST00000263278_chr19_49318398_-_1134aa
MECPSCQHVSKEETPKFCSQCGERLPPAAPIADSENNNSTMASASEGEMECGQELKEEGGPCLFPGSDSWQENPEEPCSKASWTVQEGAT
SEVLVDAAVDLISDEWEAANAIPSKRRKQDAAPLEAASVPSADCEQSKKKKRKKKKKGNKSASSELASLPLSPASPCHLTLLSNPWPQDT
ALPHSQAQQSGPTGQPSQPPGTATTPLEGDGLSAPTEVGDSPLQAQALGEAGVATGSEAQSSPQFQDHTEGEDQDASIPSGGRGLSQEGT
GPPTSAGEGHSRTEDAAQELLLPESKGGSSEPGTELQTTEQQAGASASMAVDAVAEPANAVKGAGKEMKEKTQRMKQPPATTPPFKTHCQ
EAETKTKDEMAAAEEKVGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKNQEADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDLHKVF
IRGGEEFGESKWDSNICELHYTRDLGHDRVLVEGIVCISKKHLDKYIPYKYVITNGESFETEFIYKHQQKKGEYVNRCLFIKSSLLGSGD
WHQYTDIVTMKPHGRLQKVMNHITDGPRKDLVKGKQIAAALMLDSTFSILQTWDTINLNSFFTQFEQFCFVLQQPMITEGQAQLWTDLQY
REKEVKRYLWQHLKKHVVPLPDGKSTDFLPVDCPVRSKLKTGLIVLFVVEKIELLLEGSLDWLCHLLTSDASSPDEFHRDLSHILGIPQS
WRLYLVNLCQRCMDTRTYTWLGALPVLHCCMELAPRHKDAWRQPEDTWAALEGLSFSPFREQMLDTSSLLQFMREKQHLLSIDEPLFRSW
FSLLPLSHLVMTMENFIEHLGRFPAHILDCLSGIYYRLPGLEQVLNTQDVQDVQNVQNILEMLLRLLDTYRDKIPEEALSPSYLTVCLKL
HEAICSSTKLLKFYELPALSAEIVCRMIRLLSLVDSAGQRDETGNNSVQTVFQGTLAATKRWLREVFTKNMLTSSGASFTYVKEIELALP
YLRKSQGNVINISSLVGAIGQAQAVPTVATKGAVTAMTKALALDESPTGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGR

>In-frame_RNF213_ENST00000508628_chr17_78286967_+_HSD17B14_ENST00000599157_chr19_49318398_-_1134aa
MECPSCQHVSKEETPKFCSQCGERLPPAAPIADSENNNSTMASASEGEMECGQELKEEGGPCLFPGSDSWQENPEEPCSKASWTVQEGAT
SEVLVDAAVDLISDEWEAANAIPSKRRKQDAAPLEAASVPSADCEQSKKKKRKKKKKGNKSASSELASLPLSPASPCHLTLLSNPWPQDT
ALPHSQAQQSGPTGQPSQPPGTATTPLEGDGLSAPTEVGDSPLQAQALGEAGVATGSEAQSSPQFQDHTEGEDQDASIPSGGRGLSQEGT
GPPTSAGEGHSRTEDAAQELLLPESKGGSSEPGTELQTTEQQAGASASMAVDAVAEPANAVKGAGKEMKEKTQRMKQPPATTPPFKTHCQ
EAETKTKDEMAAAEEKVGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKNQEADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDLHKVF
IRGGEEFGESKWDSNICELHYTRDLGHDRVLVEGIVCISKKHLDKYIPYKYVITNGESFETEFIYKHQQKKGEYVNRCLFIKSSLLGSGD
WHQYTDIVTMKPHGRLQKVMNHITDGPRKDLVKGKQIAAALMLDSTFSILQTWDTINLNSFFTQFEQFCFVLQQPMITEGQAQLWTDLQY
REKEVKRYLWQHLKKHVVPLPDGKSTDFLPVDCPVRSKLKTGLIVLFVVEKIELLLEGSLDWLCHLLTSDASSPDEFHRDLSHILGIPQS
WRLYLVNLCQRCMDTRTYTWLGALPVLHCCMELAPRHKDAWRQPEDTWAALEGLSFSPFREQMLDTSSLLQFMREKQHLLSIDEPLFRSW
FSLLPLSHLVMTMENFIEHLGRFPAHILDCLSGIYYRLPGLEQVLNTQDVQDVQNVQNILEMLLRLLDTYRDKIPEEALSPSYLTVCLKL
HEAICSSTKLLKFYELPALSAEIVCRMIRLLSLVDSAGQRDETGNNSVQTVFQGTLAATKRWLREVFTKNMLTSSGASFTYVKEIELALP
YLRKSQGNVINISSLVGAIGQAQAVPTVATKGAVTAMTKALALDESPTGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGR

>In-frame_RNF213_ENST00000456466_chr17_78286967_+_HSD17B14_ENST00000263278_chr19_49318398_-_1085aa
MECPSCQHVSKEETPKFCSQCGERLPPAAPIADSENNNSTMASASEGEMECGQELKEEGGPCLFPGSDSWQENPEEPCSKASWTVQESKK
KKRKKKKKGNKSASSELASLPLSPASPCHLTLLSNPWPQDTALPHSQAQQSGPTGQPSQPPGTATTPLEGDGLSAPTEVGDSPLQAQALG
EAGVATGSEAQSSPQFQDHTEGEDQDASIPSGGRGLSQEGTGPPTSAGEGHSRTEDAAQELLLPESKGGSSEPGTELQTTEQQAGASASM
AVDAVAEPANAVKGAGKEMKEKTQRMKQPPATTPPFKTHCQEAETKTKDEMAAAEEKVGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKN
QEADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDLHKVFIRGGEEFGESKWDSNICELHYTRDLGHDRVLVEGIVCISKKHLDKYIPY
KYVITNGESFETEFIYKHQQKKGEYVNRCLFIKSSLLGSGDWHQYTDIVTMKPHGRLQKVMNHITDGPRKDLVKGKQIAAALMLDSTFSI
LQTWDTINLNSFFTQFEQFCFVLQQPMITEGQAQLWTDLQYREKEVKRYLWQHLKKHVVPLPDGKSTDFLPVDCPVRSKLKTGLIVLFVV
EKIELLLEGSLDWLCHLLTSDASSPDEFHRDLSHILGIPQSWRLYLVNLCQRCMDTRTYTWLGALPVLHCCMELAPRHKDAWRQPEDTWA
ALEGLSFSPFREQMLDTSSLLQFMREKQHLLSIDEPLFRSWFSLLPLSHLVMTMENFIEHLGRFPAHILDCLSGIYYRLPGLEQVLNTQD
VQDVQNVQNILEMLLRLLDTYRDKIPEEALSPSYLTVCLKLHEAICSSTKLLKFYELPALSAEIVCRMIRLLSLVDSAGQRDETGNNSVQ
TVFQGTLAATKRWLREVFTKNMLTSSGASFTYVKEIELALPYLRKSQGNVINISSLVGAIGQAQAVPTVATKGAVTAMTKALALDESPTG
VRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAP

>In-frame_RNF213_ENST00000456466_chr17_78286967_+_HSD17B14_ENST00000599157_chr19_49318398_-_1085aa
MECPSCQHVSKEETPKFCSQCGERLPPAAPIADSENNNSTMASASEGEMECGQELKEEGGPCLFPGSDSWQENPEEPCSKASWTVQESKK
KKRKKKKKGNKSASSELASLPLSPASPCHLTLLSNPWPQDTALPHSQAQQSGPTGQPSQPPGTATTPLEGDGLSAPTEVGDSPLQAQALG
EAGVATGSEAQSSPQFQDHTEGEDQDASIPSGGRGLSQEGTGPPTSAGEGHSRTEDAAQELLLPESKGGSSEPGTELQTTEQQAGASASM
AVDAVAEPANAVKGAGKEMKEKTQRMKQPPATTPPFKTHCQEAETKTKDEMAAAEEKVGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKN
QEADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDLHKVFIRGGEEFGESKWDSNICELHYTRDLGHDRVLVEGIVCISKKHLDKYIPY
KYVITNGESFETEFIYKHQQKKGEYVNRCLFIKSSLLGSGDWHQYTDIVTMKPHGRLQKVMNHITDGPRKDLVKGKQIAAALMLDSTFSI
LQTWDTINLNSFFTQFEQFCFVLQQPMITEGQAQLWTDLQYREKEVKRYLWQHLKKHVVPLPDGKSTDFLPVDCPVRSKLKTGLIVLFVV
EKIELLLEGSLDWLCHLLTSDASSPDEFHRDLSHILGIPQSWRLYLVNLCQRCMDTRTYTWLGALPVLHCCMELAPRHKDAWRQPEDTWA
ALEGLSFSPFREQMLDTSSLLQFMREKQHLLSIDEPLFRSWFSLLPLSHLVMTMENFIEHLGRFPAHILDCLSGIYYRLPGLEQVLNTQD
VQDVQNVQNILEMLLRLLDTYRDKIPEEALSPSYLTVCLKLHEAICSSTKLLKFYELPALSAEIVCRMIRLLSLVDSAGQRDETGNNSVQ
TVFQGTLAATKRWLREVFTKNMLTSSGASFTYVKEIELALPYLRKSQGNVINISSLVGAIGQAQAVPTVATKGAVTAMTKALALDESPTG
VRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAP

>In-frame_RNF213_ENST00000582970_chr17_78286967_+_HSD17B14_ENST00000263278_chr19_49318398_-_1085aa
MECPSCQHVSKEETPKFCSQCGERLPPAAPIADSENNNSTMASASEGEMECGQELKEEGGPCLFPGSDSWQENPEEPCSKASWTVQESKK
KKRKKKKKGNKSASSELASLPLSPASPCHLTLLSNPWPQDTALPHSQAQQSGPTGQPSQPPGTATTPLEGDGLSAPTEVGDSPLQAQALG
EAGVATGSEAQSSPQFQDHTEGEDQDASIPSGGRGLSQEGTGPPTSAGEGHSRTEDAAQELLLPESKGGSSEPGTELQTTEQQAGASASM
AVDAVAEPANAVKGAGKEMKEKTQRMKQPPATTPPFKTHCQEAETKTKDEMAAAEEKVGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKN
QEADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDLHKVFIRGGEEFGESKWDSNICELHYTRDLGHDRVLVEGIVCISKKHLDKYIPY
KYVITNGESFETEFIYKHQQKKGEYVNRCLFIKSSLLGSGDWHQYTDIVTMKPHGRLQKVMNHITDGPRKDLVKGKQIAAALMLDSTFSI
LQTWDTINLNSFFTQFEQFCFVLQQPMITEGQAQLWTDLQYREKEVKRYLWQHLKKHVVPLPDGKSTDFLPVDCPVRSKLKTGLIVLFVV
EKIELLLEGSLDWLCHLLTSDASSPDEFHRDLSHILGIPQSWRLYLVNLCQRCMDTRTYTWLGALPVLHCCMELAPRHKDAWRQPEDTWA
ALEGLSFSPFREQMLDTSSLLQFMREKQHLLSIDEPLFRSWFSLLPLSHLVMTMENFIEHLGRFPAHILDCLSGIYYRLPGLEQVLNTQD
VQDVQNVQNILEMLLRLLDTYRDKIPEEALSPSYLTVCLKLHEAICSSTKLLKFYELPALSAEIVCRMIRLLSLVDSAGQRDETGNNSVQ
TVFQGTLAATKRWLREVFTKNMLTSSGASFTYVKEIELALPYLRKSQGNVINISSLVGAIGQAQAVPTVATKGAVTAMTKALALDESPTG
VRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAP

>In-frame_RNF213_ENST00000582970_chr17_78286967_+_HSD17B14_ENST00000599157_chr19_49318398_-_1085aa
MECPSCQHVSKEETPKFCSQCGERLPPAAPIADSENNNSTMASASEGEMECGQELKEEGGPCLFPGSDSWQENPEEPCSKASWTVQESKK
KKRKKKKKGNKSASSELASLPLSPASPCHLTLLSNPWPQDTALPHSQAQQSGPTGQPSQPPGTATTPLEGDGLSAPTEVGDSPLQAQALG
EAGVATGSEAQSSPQFQDHTEGEDQDASIPSGGRGLSQEGTGPPTSAGEGHSRTEDAAQELLLPESKGGSSEPGTELQTTEQQAGASASM
AVDAVAEPANAVKGAGKEMKEKTQRMKQPPATTPPFKTHCQEAETKTKDEMAAAEEKVGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKN
QEADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDLHKVFIRGGEEFGESKWDSNICELHYTRDLGHDRVLVEGIVCISKKHLDKYIPY
KYVITNGESFETEFIYKHQQKKGEYVNRCLFIKSSLLGSGDWHQYTDIVTMKPHGRLQKVMNHITDGPRKDLVKGKQIAAALMLDSTFSI
LQTWDTINLNSFFTQFEQFCFVLQQPMITEGQAQLWTDLQYREKEVKRYLWQHLKKHVVPLPDGKSTDFLPVDCPVRSKLKTGLIVLFVV
EKIELLLEGSLDWLCHLLTSDASSPDEFHRDLSHILGIPQSWRLYLVNLCQRCMDTRTYTWLGALPVLHCCMELAPRHKDAWRQPEDTWA
ALEGLSFSPFREQMLDTSSLLQFMREKQHLLSIDEPLFRSWFSLLPLSHLVMTMENFIEHLGRFPAHILDCLSGIYYRLPGLEQVLNTQD
VQDVQNVQNILEMLLRLLDTYRDKIPEEALSPSYLTVCLKLHEAICSSTKLLKFYELPALSAEIVCRMIRLLSLVDSAGQRDETGNNSVQ
TVFQGTLAATKRWLREVFTKNMLTSSGASFTYVKEIELALPYLRKSQGNVINISSLVGAIGQAQAVPTVATKGAVTAMTKALALDESPTG
VRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAP

>In-frame_RNF213_ENST00000319921_chr17_78286967_+_HSD17B14_ENST00000263278_chr19_49318398_-_1085aa
MECPSCQHVSKEETPKFCSQCGERLPPAAPIADSENNNSTMASASEGEMECGQELKEEGGPCLFPGSDSWQENPEEPCSKASWTVQESKK
KKRKKKKKGNKSASSELASLPLSPASPCHLTLLSNPWPQDTALPHSQAQQSGPTGQPSQPPGTATTPLEGDGLSAPTEVGDSPLQAQALG
EAGVATGSEAQSSPQFQDHTEGEDQDASIPSGGRGLSQEGTGPPTSAGEGHSRTEDAAQELLLPESKGGSSEPGTELQTTEQQAGASASM
AVDAVAEPANAVKGAGKEMKEKTQRMKQPPATTPPFKTHCQEAETKTKDEMAAAEEKVGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKN
QEADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDLHKVFIRGGEEFGESKWDSNICELHYTRDLGHDRVLVEGIVCISKKHLDKYIPY
KYVITNGESFETEFIYKHQQKKGEYVNRCLFIKSSLLGSGDWHQYTDIVTMKPHGRLQKVMNHITDGPRKDLVKGKQIAAALMLDSTFSI
LQTWDTINLNSFFTQFEQFCFVLQQPMITEGQAQLWTDLQYREKEVKRYLWQHLKKHVVPLPDGKSTDFLPVDCPVRSKLKTGLIVLFVV
EKIELLLEGSLDWLCHLLTSDASSPDEFHRDLSHILGIPQSWRLYLVNLCQRCMDTRTYTWLGALPVLHCCMELAPRHKDAWRQPEDTWA
ALEGLSFSPFREQMLDTSSLLQFMREKQHLLSIDEPLFRSWFSLLPLSHLVMTMENFIEHLGRFPAHILDCLSGIYYRLPGLEQVLNTQD
VQDVQNVQNILEMLLRLLDTYRDKIPEEALSPSYLTVCLKLHEAICSSTKLLKFYELPALSAEIVCRMIRLLSLVDSAGQRDETGNNSVQ
TVFQGTLAATKRWLREVFTKNMLTSSGASFTYVKEIELALPYLRKSQGNVINISSLVGAIGQAQAVPTVATKGAVTAMTKALALDESPTG
VRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAP

>In-frame_RNF213_ENST00000319921_chr17_78286967_+_HSD17B14_ENST00000599157_chr19_49318398_-_1085aa
MECPSCQHVSKEETPKFCSQCGERLPPAAPIADSENNNSTMASASEGEMECGQELKEEGGPCLFPGSDSWQENPEEPCSKASWTVQESKK
KKRKKKKKGNKSASSELASLPLSPASPCHLTLLSNPWPQDTALPHSQAQQSGPTGQPSQPPGTATTPLEGDGLSAPTEVGDSPLQAQALG
EAGVATGSEAQSSPQFQDHTEGEDQDASIPSGGRGLSQEGTGPPTSAGEGHSRTEDAAQELLLPESKGGSSEPGTELQTTEQQAGASASM
AVDAVAEPANAVKGAGKEMKEKTQRMKQPPATTPPFKTHCQEAETKTKDEMAAAEEKVGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKN
QEADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDLHKVFIRGGEEFGESKWDSNICELHYTRDLGHDRVLVEGIVCISKKHLDKYIPY
KYVITNGESFETEFIYKHQQKKGEYVNRCLFIKSSLLGSGDWHQYTDIVTMKPHGRLQKVMNHITDGPRKDLVKGKQIAAALMLDSTFSI
LQTWDTINLNSFFTQFEQFCFVLQQPMITEGQAQLWTDLQYREKEVKRYLWQHLKKHVVPLPDGKSTDFLPVDCPVRSKLKTGLIVLFVV
EKIELLLEGSLDWLCHLLTSDASSPDEFHRDLSHILGIPQSWRLYLVNLCQRCMDTRTYTWLGALPVLHCCMELAPRHKDAWRQPEDTWA
ALEGLSFSPFREQMLDTSSLLQFMREKQHLLSIDEPLFRSWFSLLPLSHLVMTMENFIEHLGRFPAHILDCLSGIYYRLPGLEQVLNTQD
VQDVQNVQNILEMLLRLLDTYRDKIPEEALSPSYLTVCLKLHEAICSSTKLLKFYELPALSAEIVCRMIRLLSLVDSAGQRDETGNNSVQ
TVFQGTLAATKRWLREVFTKNMLTSSGASFTYVKEIELALPYLRKSQGNVINISSLVGAIGQAQAVPTVATKGAVTAMTKALALDESPTG
VRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RNF213_ENST00000508628_chr17_78286967_+_HSD17B14_ENST00000263278_chr19_49318398_-_3402nt
ATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCC
ATAGCAGATTCTGAGAACAATAACTCCACAATGGCGTCGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGC
CCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAAACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAGGAGCTACA
TCAGAGGTTTTGGTAGATGCTGCTGTAGACCTCATATCCGATGAATGGGAAGCTGCTAATGCCATACCCAGCAAGAGAAGGAAGCAGGAT
GCAGCCCCGCTTGAGGCCGCCAGCGTGCCTTCTGCAGACTGTGAGCAGAGCAAAAAGAAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAG
TCCGCTTCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTGACTTTGCTTTCAAACCCGTGGCCTCAGGACACA
GCCCTGCCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCCCCAGGCACAGCCACCACGCCACTGGAGGGTGAC
GGCCTCTCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGAGAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAG
AGCAGCCCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCCTCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACC
GGTCCCCCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAGCTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCT
GAGCCCGGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATGGCAGTTGATGCTGTAGCTGAGCCAGCCAATGCA
GTTAAAGGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCAGCAACCACTCCTCCTTTCAAAACACACTGCCAG
GAAGCTGAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAGAATGAACAAGGGGAGCCTGAAGACCTCAAGAAG
CCAGAGGGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAACCAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGC
ACGCTGAGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCATTTCCCATTCAATCCTGACCTCCATAAAGTCTTC
ATCAGAGGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTGCACTACACCAGAGACTTGGGTCATGACCGCGTT
CTTGTTGAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTACAAGTACGTCATTTATAATGGGGAATCTTTTGAG
TATGAGTTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTGTTCATAAAATCTTCACTTCTGGGCTCAGGAGAC
TGGCATCAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTCATGAACCACATCACAGACGGGCCGAGGAAGGAC
CTGGTGAAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATCCTGCAGACCTGGGACACCATCAACCTGAACAGC
TTCTTCACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAAGGACAGGCACAGCTGTGGACCGATTTGCAGTAC
AGGGAGAAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCATTGCCGGACGGAAAAAGCACGGACTTTTTGCCT
GTGGACTGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTGGAAAAAATTGAGCTTTTATTAGAAGGCAGCCTG
GACTGGTTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGTGACCTAAGCCACATCCTTGGGATACCTCAGAGC
TGGCGGCTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACCTGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGT
ATGGAGCTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCCGCTCTGGAGGGACTCTCCTTCTCACCGTTCCGG
GAACAAATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTGCTGAGCATAGACGAGCCTCTCTTCCGGTCCTGG
TTTAGTCTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCACCTGGGTCGTTTTCCTGCTCATATCCTGGACTGT
CTTTCAGGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGATGTTCAGGATGTTCAGAACGTTCAGAACATTTTA
GAAATGCTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTGTCACCATCCTACCTGACTGTGTGTCTGAAACTG
CATGAAGCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTATCTGCCGAGATTGTCTGCAGAATGATTAGACTT
CTATCTCTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAAACAGTCTTCCAAGGGACCCTTGCTGCTACGAAA
AGGTGGCTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTCACATACGTCAAGGAAATTGAGCTCGCCCTCCCC
TACCTGCGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATCGGCCAGGCCCAGGCAGTTCCCTATGTGGCCACC
AAGGGGGCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGTGTCCGAGTCAACTGTATCTCCCCAGGAAACATC
TGGACCCCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATCCGAGAGGGCATGCTGGCCCAGCCACTGGGCCGC
ATGGGCCAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAACTTCTGCACGGGCATTGAACTGCTCGTGACGGGG

>In-frame_RNF213_ENST00000508628_chr17_78286967_+_HSD17B14_ENST00000599157_chr19_49318398_-_3402nt
ATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCC
ATAGCAGATTCTGAGAACAATAACTCCACAATGGCGTCGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGC
CCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAAACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAGGAGCTACA
TCAGAGGTTTTGGTAGATGCTGCTGTAGACCTCATATCCGATGAATGGGAAGCTGCTAATGCCATACCCAGCAAGAGAAGGAAGCAGGAT
GCAGCCCCGCTTGAGGCCGCCAGCGTGCCTTCTGCAGACTGTGAGCAGAGCAAAAAGAAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAG
TCCGCTTCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTGACTTTGCTTTCAAACCCGTGGCCTCAGGACACA
GCCCTGCCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCCCCAGGCACAGCCACCACGCCACTGGAGGGTGAC
GGCCTCTCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGAGAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAG
AGCAGCCCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCCTCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACC
GGTCCCCCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAGCTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCT
GAGCCCGGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATGGCAGTTGATGCTGTAGCTGAGCCAGCCAATGCA
GTTAAAGGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCAGCAACCACTCCTCCTTTCAAAACACACTGCCAG
GAAGCTGAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAGAATGAACAAGGGGAGCCTGAAGACCTCAAGAAG
CCAGAGGGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAACCAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGC
ACGCTGAGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCATTTCCCATTCAATCCTGACCTCCATAAAGTCTTC
ATCAGAGGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTGCACTACACCAGAGACTTGGGTCATGACCGCGTT
CTTGTTGAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTACAAGTACGTCATTTATAATGGGGAATCTTTTGAG
TATGAGTTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTGTTCATAAAATCTTCACTTCTGGGCTCAGGAGAC
TGGCATCAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTCATGAACCACATCACAGACGGGCCGAGGAAGGAC
CTGGTGAAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATCCTGCAGACCTGGGACACCATCAACCTGAACAGC
TTCTTCACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAAGGACAGGCACAGCTGTGGACCGATTTGCAGTAC
AGGGAGAAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCATTGCCGGACGGAAAAAGCACGGACTTTTTGCCT
GTGGACTGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTGGAAAAAATTGAGCTTTTATTAGAAGGCAGCCTG
GACTGGTTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGTGACCTAAGCCACATCCTTGGGATACCTCAGAGC
TGGCGGCTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACCTGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGT
ATGGAGCTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCCGCTCTGGAGGGACTCTCCTTCTCACCGTTCCGG
GAACAAATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTGCTGAGCATAGACGAGCCTCTCTTCCGGTCCTGG
TTTAGTCTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCACCTGGGTCGTTTTCCTGCTCATATCCTGGACTGT
CTTTCAGGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGATGTTCAGGATGTTCAGAACGTTCAGAACATTTTA
GAAATGCTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTGTCACCATCCTACCTGACTGTGTGTCTGAAACTG
CATGAAGCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTATCTGCCGAGATTGTCTGCAGAATGATTAGACTT
CTATCTCTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAAACAGTCTTCCAAGGGACCCTTGCTGCTACGAAA
AGGTGGCTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTCACATACGTCAAGGAAATTGAGCTCGCCCTCCCC
TACCTGCGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATCGGCCAGGCCCAGGCAGTTCCCTATGTGGCCACC
AAGGGGGCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGTGTCCGAGTCAACTGTATCTCCCCAGGAAACATC
TGGACCCCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATCCGAGAGGGCATGCTGGCCCAGCCACTGGGCCGC
ATGGGCCAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAACTTCTGCACGGGCATTGAACTGCTCGTGACGGGG

>In-frame_RNF213_ENST00000456466_chr17_78286967_+_HSD17B14_ENST00000263278_chr19_49318398_-_3255nt
ATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCC
ATAGCAGATTCTGAGAACAATAACTCCACAATGGCGTCGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGC
CCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAAACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAAGCAAAAAG
AAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCGCTTCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTG
ACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCCTGCCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCC
CCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCCTCTCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGA
GAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCAGCCCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCC
TCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTCCCCCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAG
CTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGCCCGGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATG
GCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTAAAGGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCA
GCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAGCTGAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAG
AATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAGAGGGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAAC
CAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGCTGAGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCAT
TTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCAGAGGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTG
CACTACACCAGAGACTTGGGTCATGACCGCGTTCTTGTTGAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTAC
AAGTACGTCATTTATAATGGGGAATCTTTTGAGTATGAGTTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTG
TTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGCATCAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTC
ATGAACCACATCACAGACGGGCCGAGGAAGGACCTGGTGAAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATC
CTGCAGACCTGGGACACCATCAACCTGAACAGCTTCTTCACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAA
GGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGGAGAAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCA
TTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGGACTGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTG
GAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACTGGTTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGT
GACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGCGGCTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACC
TGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGGAGCTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCC
GCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAACAAATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTG
CTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTAGTCTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCAC
CTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTTCAGGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGAT
GTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAATGCTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTG
TCACCATCCTACCTGACTGTGTGTCTGAAACTGCATGAAGCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTA
TCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTATCTCTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAA
ACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGTGGCTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTC
ACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACCTGCGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATC
GGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGGGGGCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGT
GTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGACCCCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATC
CGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGGGCCAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAAC
TTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTGCAGAGCTGGGGTACGGGTGCAAGGCCAGTCGGAGCACCCCCGTGGACGCCCCC

>In-frame_RNF213_ENST00000456466_chr17_78286967_+_HSD17B14_ENST00000599157_chr19_49318398_-_3255nt
ATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCC
ATAGCAGATTCTGAGAACAATAACTCCACAATGGCGTCGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGC
CCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAAACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAAGCAAAAAG
AAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCGCTTCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTG
ACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCCTGCCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCC
CCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCCTCTCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGA
GAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCAGCCCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCC
TCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTCCCCCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAG
CTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGCCCGGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATG
GCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTAAAGGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCA
GCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAGCTGAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAG
AATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAGAGGGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAAC
CAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGCTGAGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCAT
TTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCAGAGGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTG
CACTACACCAGAGACTTGGGTCATGACCGCGTTCTTGTTGAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTAC
AAGTACGTCATTTATAATGGGGAATCTTTTGAGTATGAGTTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTG
TTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGCATCAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTC
ATGAACCACATCACAGACGGGCCGAGGAAGGACCTGGTGAAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATC
CTGCAGACCTGGGACACCATCAACCTGAACAGCTTCTTCACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAA
GGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGGAGAAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCA
TTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGGACTGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTG
GAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACTGGTTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGT
GACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGCGGCTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACC
TGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGGAGCTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCC
GCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAACAAATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTG
CTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTAGTCTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCAC
CTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTTCAGGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGAT
GTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAATGCTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTG
TCACCATCCTACCTGACTGTGTGTCTGAAACTGCATGAAGCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTA
TCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTATCTCTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAA
ACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGTGGCTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTC
ACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACCTGCGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATC
GGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGGGGGCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGT
GTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGACCCCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATC
CGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGGGCCAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAAC
TTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTGCAGAGCTGGGGTACGGGTGCAAGGCCAGTCGGAGCACCCCCGTGGACGCCCCC

>In-frame_RNF213_ENST00000582970_chr17_78286967_+_HSD17B14_ENST00000263278_chr19_49318398_-_3255nt
ATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCC
ATAGCAGATTCTGAGAACAATAACTCCACAATGGCGTCGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGC
CCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAAACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAAGCAAAAAG
AAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCGCTTCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTG
ACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCCTGCCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCC
CCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCCTCTCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGA
GAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCAGCCCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCC
TCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTCCCCCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAG
CTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGCCCGGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATG
GCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTAAAGGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCA
GCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAGCTGAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAG
AATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAGAGGGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAAC
CAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGCTGAGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCAT
TTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCAGAGGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTG
CACTACACCAGAGACTTGGGTCATGACCGCGTTCTTGTTGAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTAC
AAGTACGTCATTTATAATGGGGAATCTTTTGAGTATGAGTTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTG
TTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGCATCAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTC
ATGAACCACATCACAGACGGGCCGAGGAAGGACCTGGTGAAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATC
CTGCAGACCTGGGACACCATCAACCTGAACAGCTTCTTCACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAA
GGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGGAGAAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCA
TTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGGACTGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTG
GAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACTGGTTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGT
GACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGCGGCTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACC
TGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGGAGCTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCC
GCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAACAAATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTG
CTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTAGTCTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCAC
CTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTTCAGGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGAT
GTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAATGCTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTG
TCACCATCCTACCTGACTGTGTGTCTGAAACTGCATGAAGCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTA
TCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTATCTCTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAA
ACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGTGGCTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTC
ACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACCTGCGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATC
GGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGGGGGCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGT
GTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGACCCCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATC
CGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGGGCCAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAAC
TTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTGCAGAGCTGGGGTACGGGTGCAAGGCCAGTCGGAGCACCCCCGTGGACGCCCCC

>In-frame_RNF213_ENST00000582970_chr17_78286967_+_HSD17B14_ENST00000599157_chr19_49318398_-_3255nt
ATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCC
ATAGCAGATTCTGAGAACAATAACTCCACAATGGCGTCGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGC
CCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAAACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAAGCAAAAAG
AAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCGCTTCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTG
ACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCCTGCCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCC
CCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCCTCTCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGA
GAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCAGCCCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCC
TCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTCCCCCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAG
CTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGCCCGGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATG
GCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTAAAGGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCA
GCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAGCTGAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAG
AATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAGAGGGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAAC
CAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGCTGAGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCAT
TTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCAGAGGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTG
CACTACACCAGAGACTTGGGTCATGACCGCGTTCTTGTTGAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTAC
AAGTACGTCATTTATAATGGGGAATCTTTTGAGTATGAGTTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTG
TTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGCATCAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTC
ATGAACCACATCACAGACGGGCCGAGGAAGGACCTGGTGAAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATC
CTGCAGACCTGGGACACCATCAACCTGAACAGCTTCTTCACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAA
GGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGGAGAAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCA
TTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGGACTGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTG
GAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACTGGTTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGT
GACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGCGGCTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACC
TGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGGAGCTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCC
GCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAACAAATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTG
CTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTAGTCTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCAC
CTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTTCAGGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGAT
GTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAATGCTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTG
TCACCATCCTACCTGACTGTGTGTCTGAAACTGCATGAAGCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTA
TCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTATCTCTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAA
ACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGTGGCTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTC
ACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACCTGCGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATC
GGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGGGGGCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGT
GTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGACCCCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATC
CGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGGGCCAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAAC
TTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTGCAGAGCTGGGGTACGGGTGCAAGGCCAGTCGGAGCACCCCCGTGGACGCCCCC

>In-frame_RNF213_ENST00000319921_chr17_78286967_+_HSD17B14_ENST00000263278_chr19_49318398_-_3255nt
ATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCC
ATAGCAGATTCTGAGAACAATAACTCCACAATGGCGTCGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGC
CCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAAACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAAGCAAAAAG
AAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCGCTTCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTG
ACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCCTGCCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCC
CCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCCTCTCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGA
GAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCAGCCCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCC
TCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTCCCCCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAG
CTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGCCCGGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATG
GCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTAAAGGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCA
GCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAGCTGAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAG
AATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAGAGGGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAAC
CAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGCTGAGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCAT
TTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCAGAGGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTG
CACTACACCAGAGACTTGGGTCATGACCGCGTTCTTGTTGAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTAC
AAGTACGTCATTTATAATGGGGAATCTTTTGAGTATGAGTTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTG
TTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGCATCAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTC
ATGAACCACATCACAGACGGGCCGAGGAAGGACCTGGTGAAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATC
CTGCAGACCTGGGACACCATCAACCTGAACAGCTTCTTCACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAA
GGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGGAGAAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCA
TTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGGACTGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTG
GAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACTGGTTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGT
GACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGCGGCTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACC
TGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGGAGCTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCC
GCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAACAAATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTG
CTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTAGTCTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCAC
CTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTTCAGGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGAT
GTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAATGCTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTG
TCACCATCCTACCTGACTGTGTGTCTGAAACTGCATGAAGCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTA
TCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTATCTCTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAA
ACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGTGGCTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTC
ACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACCTGCGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATC
GGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGGGGGCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGT
GTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGACCCCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATC
CGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGGGCCAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAAC
TTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTGCAGAGCTGGGGTACGGGTGCAAGGCCAGTCGGAGCACCCCCGTGGACGCCCCC

>In-frame_RNF213_ENST00000319921_chr17_78286967_+_HSD17B14_ENST00000599157_chr19_49318398_-_3255nt
ATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCC
ATAGCAGATTCTGAGAACAATAACTCCACAATGGCGTCGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGC
CCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAAACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAAGCAAAAAG
AAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCGCTTCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTG
ACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCCTGCCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCC
CCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCCTCTCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGA
GAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCAGCCCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCC
TCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTCCCCCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAG
CTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGCCCGGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATG
GCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTAAAGGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCA
GCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAGCTGAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAG
AATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAGAGGGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAAC
CAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGCTGAGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCAT
TTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCAGAGGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTG
CACTACACCAGAGACTTGGGTCATGACCGCGTTCTTGTTGAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTAC
AAGTACGTCATTTATAATGGGGAATCTTTTGAGTATGAGTTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTG
TTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGCATCAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTC
ATGAACCACATCACAGACGGGCCGAGGAAGGACCTGGTGAAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATC
CTGCAGACCTGGGACACCATCAACCTGAACAGCTTCTTCACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAA
GGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGGAGAAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCA
TTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGGACTGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTG
GAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACTGGTTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGT
GACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGCGGCTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACC
TGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGGAGCTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCC
GCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAACAAATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTG
CTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTAGTCTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCAC
CTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTTCAGGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGAT
GTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAATGCTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTG
TCACCATCCTACCTGACTGTGTGTCTGAAACTGCATGAAGCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTA
TCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTATCTCTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAA
ACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGTGGCTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTC
ACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACCTGCGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATC
GGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGGGGGCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGT
GTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGACCCCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATC
CGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGGGCCAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAAC
TTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTGCAGAGCTGGGGTACGGGTGCAAGGCCAGTCGGAGCACCCCCGTGGACGCCCCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_RNF213_ENST00000508628_chr17_78286967_+_HSD17B14_ENST00000263278_chr19_49318398_-_3705nt
GACAGCGCGCGGCAGGCGGCGAGCTCGGGGGCCGCAGAAAATGAAACTGAAGCCGTGGTCACGTGACAGGACATGTAGTATATAGCAGGC
TGCCAGCGACTCCTGCTCTTGCTTCTGGATCTGCAGGGCAGTCCCAGCAGGACCCATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGA
GGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCCATAGCAGATTCTGAGAACAATAACTCCACAATGGC
GTCGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGCCCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGA
AAACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAGGAGCTACATCAGAGGTTTTGGTAGATGCTGCTGTAGACCTCAT
ATCCGATGAATGGGAAGCTGCTAATGCCATACCCAGCAAGAGAAGGAAGCAGGATGCAGCCCCGCTTGAGGCCGCCAGCGTGCCTTCTGC
AGACTGTGAGCAGAGCAAAAAGAAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCGCTTCCTCAGAGCTGGCTTCCTTGCCCCTTTC
TCCTGCCAGCCCCTGTCACCTGACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCCTGCCCCACAGCCAAGCCCAGCAGAGTGGCCC
CACTGGCCAGCCGAGCCAGCCCCCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCCTCTCCGCGCCCACCGAGGTTGGCGACAGCCC
CCTGCAGGCCCAGGCTTTGGGAGAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCAGCCCGCAATTCCAGGACCACACGGAAGGGGA
GGACCAGGACGCTTCCATCCCCTCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTCCCCCCACCTCTGCTGGTGAAGGCCATTCTAG
GACTGAAGATGCTGCCCAGGAGCTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGCCCGGGACAGAACTGCAGACCACCGAGCAACA
GGCAGGGGCCTCAGCCTCTATGGCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTAAAGGGGCCGGGAAGGAAATGAAAGAGAAGAC
CCAGAGAATGAAACAGCCACCAGCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAGCTGAGACCAAGACCAAGGACGAGATGGCTGC
TGCTGAAGAAAAAGTCGGTAAGAATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAGAGGGGAAGAACAGAAGTGCAGCTGCTGTGAA
AAACGAGAAGGAGCAAAAAAACCAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGCTGAGCCCGGGTGGAGGAGTCACCGTGTTCTT
CCACGCCATCATCTCTCTTCATTTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCAGAGGAGGAGAAGAATTTGGGGAGTCAAAATG
GGACAGCAATATCTGTGAGCTGCACTACACCAGAGACTTGGGTCATGACCGCGTTCTTGTTGAAGGCATTGTCTGCATTTCCAAGAAGCA
CCTAGATAAATACATTCCTTACAAGTACGTCATTTATAATGGGGAATCTTTTGAGTATGAGTTCATTTACAAGCACCAGCAGAAGAAGGG
CGAGTACGTCAACCGCTGTCTGTTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGCATCAGTACTATGACATAGTTTATATGAAGCC
TCATGGGAGACTCCAGAAAGTCATGAACCACATCACAGACGGGCCGAGGAAGGACCTGGTGAAGGGGAAGCAGATTGCCGCTGCGCTCAT
GCTGGACAGCACCTTCAGCATCCTGCAGACCTGGGACACCATCAACCTGAACAGCTTCTTCACCCAGTTCGAGCAGTTTTGCTTTGTCCT
GCAACAGCCTATGATTTATGAAGGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGGAGAAAGAGGTGAAGAGATACCTGTGGCAACA
TCTGAAAAAACACGTGGTACCATTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGGACTGCCCAGTGAGGAGTAAACTGAAAACAGG
CCTGATTGTCCTTTTTGTAGTGGAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACTGGTTGTGTCACCTCCTAACCTCAGATGCCAG
CTCACCAGATGAGTTTCACCGTGACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGCGGCTGTACCTGGTGAACCTGTGCCAAAGATG
CATGGACACAAGGACGTACACCTGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGGAGCTGGCCCCGCGGCACAAGGATGCCTGGAG
ACAGCCTGAGGACACCTGGGCCGCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAACAAATGCTAGATACGAGTTCCCTACTTCAGTT
TATGAGAGAGAAGCAGCATTTGCTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTAGTCTGCTACCTCTGAGTCACCTGGTTATGTA
TATGGAAAACTTCATTGAGCACCTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTTCAGGGATTTACTACCGGCTTCCGGGACTTGA
GCAAGTCTTGAATACGCAGGATGTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAATGCTGTTGCGACTCCTGGACACTTACCGGGA
CAAGATTCCCGAGGAGGCCTTGTCACCATCCTACCTGACTGTGTGTCTGAAACTGCATGAAGCCATCTGCAGCAGCACAAAGCTACTTAA
GTTTTACGAGCTGCCAGCCTTATCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTATCTCTGGTGGATTCTGCAGGACAGAGAGATGA
AACTGGAAATAATTCAGTCCAAACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGTGGCTCCGAGAAGTTTTTACAAAGAACATGCT
CACATCTTCAGGTGCCTCATTCACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACCTGCGGAAGAGTCAAGGGAATGTCATCAACAT
CTCCAGCCTGGTGGGGGCAATCGGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGGGGGCAGTAACAGCCATGACCAAAGCTTTGGC
CCTGGATGAAAGTCCATATGGTGTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGACCCCGCTGTGGGAGGAGCTGGCAGCCTTAAT
GCCAGACCCTAGGGCCACAATCCGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGGGCCAGCCCGCTGAGGTCGGGGCTGCGGCAGT
GTTCCTGGCCTCCGAAGCCAACTTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTGCAGAGCTGGGGTACGGGTGCAAGGCCAGTCG
GAGCACCCCCGTGGACGCCCCCGATATCCCTTCCTGATTTCTCTCATTTCTACTTGGGGCCCCCTTCCTAGGACTCTCCCACCCCAAACT
CCAACCTGTATCAGATGCAGCCCCCAAGCCCTTAGACTCTAAGCCCAGTTAGCAAGGTGCCGGGTCACCCTGCAGGTTCCCATAAAAACG

>In-frame_RNF213_ENST00000508628_chr17_78286967_+_HSD17B14_ENST00000599157_chr19_49318398_-_3698nt
GACAGCGCGCGGCAGGCGGCGAGCTCGGGGGCCGCAGAAAATGAAACTGAAGCCGTGGTCACGTGACAGGACATGTAGTATATAGCAGGC
TGCCAGCGACTCCTGCTCTTGCTTCTGGATCTGCAGGGCAGTCCCAGCAGGACCCATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGA
GGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCCATAGCAGATTCTGAGAACAATAACTCCACAATGGC
GTCGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGCCCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGA
AAACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAGGAGCTACATCAGAGGTTTTGGTAGATGCTGCTGTAGACCTCAT
ATCCGATGAATGGGAAGCTGCTAATGCCATACCCAGCAAGAGAAGGAAGCAGGATGCAGCCCCGCTTGAGGCCGCCAGCGTGCCTTCTGC
AGACTGTGAGCAGAGCAAAAAGAAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCGCTTCCTCAGAGCTGGCTTCCTTGCCCCTTTC
TCCTGCCAGCCCCTGTCACCTGACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCCTGCCCCACAGCCAAGCCCAGCAGAGTGGCCC
CACTGGCCAGCCGAGCCAGCCCCCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCCTCTCCGCGCCCACCGAGGTTGGCGACAGCCC
CCTGCAGGCCCAGGCTTTGGGAGAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCAGCCCGCAATTCCAGGACCACACGGAAGGGGA
GGACCAGGACGCTTCCATCCCCTCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTCCCCCCACCTCTGCTGGTGAAGGCCATTCTAG
GACTGAAGATGCTGCCCAGGAGCTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGCCCGGGACAGAACTGCAGACCACCGAGCAACA
GGCAGGGGCCTCAGCCTCTATGGCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTAAAGGGGCCGGGAAGGAAATGAAAGAGAAGAC
CCAGAGAATGAAACAGCCACCAGCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAGCTGAGACCAAGACCAAGGACGAGATGGCTGC
TGCTGAAGAAAAAGTCGGTAAGAATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAGAGGGGAAGAACAGAAGTGCAGCTGCTGTGAA
AAACGAGAAGGAGCAAAAAAACCAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGCTGAGCCCGGGTGGAGGAGTCACCGTGTTCTT
CCACGCCATCATCTCTCTTCATTTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCAGAGGAGGAGAAGAATTTGGGGAGTCAAAATG
GGACAGCAATATCTGTGAGCTGCACTACACCAGAGACTTGGGTCATGACCGCGTTCTTGTTGAAGGCATTGTCTGCATTTCCAAGAAGCA
CCTAGATAAATACATTCCTTACAAGTACGTCATTTATAATGGGGAATCTTTTGAGTATGAGTTCATTTACAAGCACCAGCAGAAGAAGGG
CGAGTACGTCAACCGCTGTCTGTTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGCATCAGTACTATGACATAGTTTATATGAAGCC
TCATGGGAGACTCCAGAAAGTCATGAACCACATCACAGACGGGCCGAGGAAGGACCTGGTGAAGGGGAAGCAGATTGCCGCTGCGCTCAT
GCTGGACAGCACCTTCAGCATCCTGCAGACCTGGGACACCATCAACCTGAACAGCTTCTTCACCCAGTTCGAGCAGTTTTGCTTTGTCCT
GCAACAGCCTATGATTTATGAAGGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGGAGAAAGAGGTGAAGAGATACCTGTGGCAACA
TCTGAAAAAACACGTGGTACCATTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGGACTGCCCAGTGAGGAGTAAACTGAAAACAGG
CCTGATTGTCCTTTTTGTAGTGGAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACTGGTTGTGTCACCTCCTAACCTCAGATGCCAG
CTCACCAGATGAGTTTCACCGTGACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGCGGCTGTACCTGGTGAACCTGTGCCAAAGATG
CATGGACACAAGGACGTACACCTGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGGAGCTGGCCCCGCGGCACAAGGATGCCTGGAG
ACAGCCTGAGGACACCTGGGCCGCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAACAAATGCTAGATACGAGTTCCCTACTTCAGTT
TATGAGAGAGAAGCAGCATTTGCTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTAGTCTGCTACCTCTGAGTCACCTGGTTATGTA
TATGGAAAACTTCATTGAGCACCTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTTCAGGGATTTACTACCGGCTTCCGGGACTTGA
GCAAGTCTTGAATACGCAGGATGTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAATGCTGTTGCGACTCCTGGACACTTACCGGGA
CAAGATTCCCGAGGAGGCCTTGTCACCATCCTACCTGACTGTGTGTCTGAAACTGCATGAAGCCATCTGCAGCAGCACAAAGCTACTTAA
GTTTTACGAGCTGCCAGCCTTATCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTATCTCTGGTGGATTCTGCAGGACAGAGAGATGA
AACTGGAAATAATTCAGTCCAAACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGTGGCTCCGAGAAGTTTTTACAAAGAACATGCT
CACATCTTCAGGTGCCTCATTCACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACCTGCGGAAGAGTCAAGGGAATGTCATCAACAT
CTCCAGCCTGGTGGGGGCAATCGGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGGGGGCAGTAACAGCCATGACCAAAGCTTTGGC
CCTGGATGAAAGTCCATATGGTGTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGACCCCGCTGTGGGAGGAGCTGGCAGCCTTAAT
GCCAGACCCTAGGGCCACAATCCGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGGGCCAGCCCGCTGAGGTCGGGGCTGCGGCAGT
GTTCCTGGCCTCCGAAGCCAACTTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTGCAGAGCTGGGGTACGGGTGCAAGGCCAGTCG
GAGCACCCCCGTGGACGCCCCCGATATCCCTTCCTGATTTCTCTCATTTCTACTTGGGGCCCCCTTCCTAGGACTCTCCCACCCCAAACT
CCAACCTGTATCAGATGCAGCCCCCAAGCCCTTAGACTCTAAGCCCAGTTAGCAAGGTGCCGGGTCACCCTGCAGGTTCCCATAAAAACG

>In-frame_RNF213_ENST00000456466_chr17_78286967_+_HSD17B14_ENST00000263278_chr19_49318398_-_3556nt
CAGCGCGCGGCAGGCGGCGAGCTCGGGGGCCGCAGAAAATGAAACTGAAGCCGTGGTCACGTGACAGGACATGTAGTATATAGCAGGCTG
CCAGCGACTCCTGCTCTTGCTTCTGGATCTGCAGGGCAGTCCCAGCAGGACCCATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGG
AAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCCATAGCAGATTCTGAGAACAATAACTCCACAATGGCGT
CGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGCCCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAA
ACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAAGCAAAAAGAAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCG
CTTCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTGACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCC
TGCCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCCCCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCC
TCTCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGAGAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCA
GCCCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCCTCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTC
CCCCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAGCTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGC
CCGGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATGGCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTA
AAGGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCAGCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAG
CTGAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAGAATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAG
AGGGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAACCAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGC
TGAGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCATTTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCA
GAGGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTGCACTACACCAGAGACTTGGGTCATGACCGCGTTCTTG
TTGAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTACAAGTACGTCATTTATAATGGGGAATCTTTTGAGTATG
AGTTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTGTTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGC
ATCAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTCATGAACCACATCACAGACGGGCCGAGGAAGGACCTGG
TGAAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATCCTGCAGACCTGGGACACCATCAACCTGAACAGCTTCT
TCACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAAGGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGG
AGAAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCATTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGG
ACTGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTGGAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACT
GGTTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGTGACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGC
GGCTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACCTGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGG
AGCTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCCGCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAAC
AAATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTGCTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTA
GTCTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCACCTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTT
CAGGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGATGTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAA
TGCTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTGTCACCATCCTACCTGACTGTGTGTCTGAAACTGCATG
AAGCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTATCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTAT
CTCTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAAACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGT
GGCTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTCACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACC
TGCGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATCGGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGG
GGGCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGTGTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGA
CCCCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATCCGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGG
GCCAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAACTTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTG
CAGAGCTGGGGTACGGGTGCAAGGCCAGTCGGAGCACCCCCGTGGACGCCCCCGATATCCCTTCCTGATTTCTCTCATTTCTACTTGGGG
CCCCCTTCCTAGGACTCTCCCACCCCAAACTCCAACCTGTATCAGATGCAGCCCCCAAGCCCTTAGACTCTAAGCCCAGTTAGCAAGGTG

>In-frame_RNF213_ENST00000456466_chr17_78286967_+_HSD17B14_ENST00000599157_chr19_49318398_-_3549nt
CAGCGCGCGGCAGGCGGCGAGCTCGGGGGCCGCAGAAAATGAAACTGAAGCCGTGGTCACGTGACAGGACATGTAGTATATAGCAGGCTG
CCAGCGACTCCTGCTCTTGCTTCTGGATCTGCAGGGCAGTCCCAGCAGGACCCATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGG
AAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCCATAGCAGATTCTGAGAACAATAACTCCACAATGGCGT
CGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGCCCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAA
ACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAAGCAAAAAGAAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCG
CTTCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTGACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCC
TGCCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCCCCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCC
TCTCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGAGAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCA
GCCCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCCTCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTC
CCCCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAGCTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGC
CCGGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATGGCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTA
AAGGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCAGCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAG
CTGAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAGAATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAG
AGGGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAACCAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGC
TGAGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCATTTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCA
GAGGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTGCACTACACCAGAGACTTGGGTCATGACCGCGTTCTTG
TTGAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTACAAGTACGTCATTTATAATGGGGAATCTTTTGAGTATG
AGTTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTGTTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGC
ATCAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTCATGAACCACATCACAGACGGGCCGAGGAAGGACCTGG
TGAAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATCCTGCAGACCTGGGACACCATCAACCTGAACAGCTTCT
TCACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAAGGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGG
AGAAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCATTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGG
ACTGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTGGAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACT
GGTTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGTGACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGC
GGCTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACCTGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGG
AGCTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCCGCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAAC
AAATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTGCTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTA
GTCTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCACCTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTT
CAGGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGATGTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAA
TGCTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTGTCACCATCCTACCTGACTGTGTGTCTGAAACTGCATG
AAGCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTATCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTAT
CTCTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAAACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGT
GGCTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTCACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACC
TGCGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATCGGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGG
GGGCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGTGTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGA
CCCCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATCCGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGG
GCCAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAACTTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTG
CAGAGCTGGGGTACGGGTGCAAGGCCAGTCGGAGCACCCCCGTGGACGCCCCCGATATCCCTTCCTGATTTCTCTCATTTCTACTTGGGG
CCCCCTTCCTAGGACTCTCCCACCCCAAACTCCAACCTGTATCAGATGCAGCCCCCAAGCCCTTAGACTCTAAGCCCAGTTAGCAAGGTG

>In-frame_RNF213_ENST00000582970_chr17_78286967_+_HSD17B14_ENST00000263278_chr19_49318398_-_3556nt
CAGCGCGCGGCAGGCGGCGAGCTCGGGGGCCGCAGAAAATGAAACTGAAGCCGTGGTCACGTGACAGGACATGTAGTATATAGCAGGCTG
CCAGCGACTCCTGCTCTTGCTTCTGGATCTGCAGGGCAGTCCCAGCAGGACCCATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGG
AAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCCATAGCAGATTCTGAGAACAATAACTCCACAATGGCGT
CGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGCCCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAA
ACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAAGCAAAAAGAAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCG
CTTCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTGACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCC
TGCCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCCCCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCC
TCTCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGAGAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCA
GCCCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCCTCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTC
CCCCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAGCTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGC
CCGGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATGGCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTA
AAGGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCAGCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAG
CTGAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAGAATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAG
AGGGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAACCAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGC
TGAGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCATTTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCA
GAGGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTGCACTACACCAGAGACTTGGGTCATGACCGCGTTCTTG
TTGAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTACAAGTACGTCATTTATAATGGGGAATCTTTTGAGTATG
AGTTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTGTTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGC
ATCAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTCATGAACCACATCACAGACGGGCCGAGGAAGGACCTGG
TGAAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATCCTGCAGACCTGGGACACCATCAACCTGAACAGCTTCT
TCACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAAGGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGG
AGAAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCATTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGG
ACTGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTGGAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACT
GGTTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGTGACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGC
GGCTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACCTGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGG
AGCTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCCGCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAAC
AAATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTGCTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTA
GTCTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCACCTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTT
CAGGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGATGTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAA
TGCTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTGTCACCATCCTACCTGACTGTGTGTCTGAAACTGCATG
AAGCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTATCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTAT
CTCTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAAACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGT
GGCTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTCACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACC
TGCGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATCGGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGG
GGGCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGTGTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGA
CCCCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATCCGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGG
GCCAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAACTTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTG
CAGAGCTGGGGTACGGGTGCAAGGCCAGTCGGAGCACCCCCGTGGACGCCCCCGATATCCCTTCCTGATTTCTCTCATTTCTACTTGGGG
CCCCCTTCCTAGGACTCTCCCACCCCAAACTCCAACCTGTATCAGATGCAGCCCCCAAGCCCTTAGACTCTAAGCCCAGTTAGCAAGGTG

>In-frame_RNF213_ENST00000582970_chr17_78286967_+_HSD17B14_ENST00000599157_chr19_49318398_-_3549nt
CAGCGCGCGGCAGGCGGCGAGCTCGGGGGCCGCAGAAAATGAAACTGAAGCCGTGGTCACGTGACAGGACATGTAGTATATAGCAGGCTG
CCAGCGACTCCTGCTCTTGCTTCTGGATCTGCAGGGCAGTCCCAGCAGGACCCATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGG
AAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCCATAGCAGATTCTGAGAACAATAACTCCACAATGGCGT
CGGCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGCCCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAA
ACCCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAAGCAAAAAGAAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCG
CTTCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTGACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCC
TGCCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCCCCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCC
TCTCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGAGAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCA
GCCCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCCTCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTC
CCCCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAGCTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGC
CCGGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATGGCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTA
AAGGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCAGCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAG
CTGAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAGAATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAG
AGGGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAACCAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGC
TGAGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCATTTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCA
GAGGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTGCACTACACCAGAGACTTGGGTCATGACCGCGTTCTTG
TTGAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTACAAGTACGTCATTTATAATGGGGAATCTTTTGAGTATG
AGTTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTGTTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGC
ATCAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTCATGAACCACATCACAGACGGGCCGAGGAAGGACCTGG
TGAAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATCCTGCAGACCTGGGACACCATCAACCTGAACAGCTTCT
TCACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAAGGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGG
AGAAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCATTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGG
ACTGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTGGAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACT
GGTTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGTGACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGC
GGCTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACCTGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGG
AGCTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCCGCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAAC
AAATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTGCTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTA
GTCTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCACCTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTT
CAGGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGATGTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAA
TGCTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTGTCACCATCCTACCTGACTGTGTGTCTGAAACTGCATG
AAGCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTATCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTAT
CTCTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAAACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGT
GGCTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTCACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACC
TGCGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATCGGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGG
GGGCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGTGTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGA
CCCCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATCCGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGG
GCCAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAACTTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTG
CAGAGCTGGGGTACGGGTGCAAGGCCAGTCGGAGCACCCCCGTGGACGCCCCCGATATCCCTTCCTGATTTCTCTCATTTCTACTTGGGG
CCCCCTTCCTAGGACTCTCCCACCCCAAACTCCAACCTGTATCAGATGCAGCCCCCAAGCCCTTAGACTCTAAGCCCAGTTAGCAAGGTG

>In-frame_RNF213_ENST00000319921_chr17_78286967_+_HSD17B14_ENST00000263278_chr19_49318398_-_3554nt
GCGCGCGGCAGGCGGCGAGCTCGGGGGCCGCAGAAAATGAAACTGAAGCCGTGGTCACGTGACAGGACATGTAGTATATAGCAGGCTGCC
AGCGACTCCTGCTCTTGCTTCTGGATCTGCAGGGCAGTCCCAGCAGGACCCATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAA
ACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCCATAGCAGATTCTGAGAACAATAACTCCACAATGGCGTCG
GCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGCCCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAAAC
CCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAAGCAAAAAGAAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCGCT
TCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTGACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCCTG
CCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCCCCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCCTC
TCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGAGAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCAGC
CCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCCTCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTCCC
CCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAGCTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGCCC
GGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATGGCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTAAA
GGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCAGCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAGCT
GAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAGAATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAGAG
GGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAACCAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGCTG
AGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCATTTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCAGA
GGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTGCACTACACCAGAGACTTGGGTCATGACCGCGTTCTTGTT
GAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTACAAGTACGTCATTTATAATGGGGAATCTTTTGAGTATGAG
TTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTGTTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGCAT
CAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTCATGAACCACATCACAGACGGGCCGAGGAAGGACCTGGTG
AAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATCCTGCAGACCTGGGACACCATCAACCTGAACAGCTTCTTC
ACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAAGGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGGAG
AAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCATTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGGAC
TGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTGGAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACTGG
TTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGTGACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGCGG
CTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACCTGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGGAG
CTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCCGCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAACAA
ATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTGCTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTAGT
CTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCACCTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTTCA
GGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGATGTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAATG
CTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTGTCACCATCCTACCTGACTGTGTGTCTGAAACTGCATGAA
GCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTATCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTATCT
CTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAAACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGTGG
CTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTCACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACCTG
CGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATCGGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGGGG
GCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGTGTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGACC
CCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATCCGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGGGC
CAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAACTTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTGCA
GAGCTGGGGTACGGGTGCAAGGCCAGTCGGAGCACCCCCGTGGACGCCCCCGATATCCCTTCCTGATTTCTCTCATTTCTACTTGGGGCC
CCCTTCCTAGGACTCTCCCACCCCAAACTCCAACCTGTATCAGATGCAGCCCCCAAGCCCTTAGACTCTAAGCCCAGTTAGCAAGGTGCC

>In-frame_RNF213_ENST00000319921_chr17_78286967_+_HSD17B14_ENST00000599157_chr19_49318398_-_3547nt
GCGCGCGGCAGGCGGCGAGCTCGGGGGCCGCAGAAAATGAAACTGAAGCCGTGGTCACGTGACAGGACATGTAGTATATAGCAGGCTGCC
AGCGACTCCTGCTCTTGCTTCTGGATCTGCAGGGCAGTCCCAGCAGGACCCATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAA
ACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCCATAGCAGATTCTGAGAACAATAACTCCACAATGGCGTCG
GCCTCGGAGGGTGAAATGGAGTGTGGGCAGGAGCTGAAGGAGGAAGGGGGCCCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAAAC
CCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAAGCAAAAAGAAGAAAAGGAAGAAGAAAAAGAAGGGGAACAAGTCCGCT
TCCTCAGAGCTGGCTTCCTTGCCCCTTTCTCCTGCCAGCCCCTGTCACCTGACTTTGCTTTCAAACCCGTGGCCTCAGGACACAGCCCTG
CCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCCCCAGGCACAGCCACCACGCCACTGGAGGGTGACGGCCTC
TCCGCGCCCACCGAGGTTGGCGACAGCCCCCTGCAGGCCCAGGCTTTGGGAGAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCAGC
CCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCCTCTGGGGGCAGAGGCCTGTCCCAGGAGGGGACCGGTCCC
CCCACCTCTGCTGGTGAAGGCCATTCTAGGACTGAAGATGCTGCCCAGGAGCTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGCCC
GGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTATGGCAGTTGATGCTGTAGCTGAGCCAGCCAATGCAGTTAAA
GGGGCCGGGAAGGAAATGAAAGAGAAGACCCAGAGAATGAAACAGCCACCAGCAACCACTCCTCCTTTCAAAACACACTGCCAGGAAGCT
GAGACCAAGACCAAGGACGAGATGGCTGCTGCTGAAGAAAAAGTCGGTAAGAATGAACAAGGGGAGCCTGAAGACCTCAAGAAGCCAGAG
GGGAAGAACAGAAGTGCAGCTGCTGTGAAAAACGAGAAGGAGCAAAAAAACCAGGAAGCAGATGTCCAGGAAGTGAAGGCAAGCACGCTG
AGCCCGGGTGGAGGAGTCACCGTGTTCTTCCACGCCATCATCTCTCTTCATTTCCCATTCAATCCTGACCTCCATAAAGTCTTCATCAGA
GGAGGAGAAGAATTTGGGGAGTCAAAATGGGACAGCAATATCTGTGAGCTGCACTACACCAGAGACTTGGGTCATGACCGCGTTCTTGTT
GAAGGCATTGTCTGCATTTCCAAGAAGCACCTAGATAAATACATTCCTTACAAGTACGTCATTTATAATGGGGAATCTTTTGAGTATGAG
TTCATTTACAAGCACCAGCAGAAGAAGGGCGAGTACGTCAACCGCTGTCTGTTCATAAAATCTTCACTTCTGGGCTCAGGAGACTGGCAT
CAGTACTATGACATAGTTTATATGAAGCCTCATGGGAGACTCCAGAAAGTCATGAACCACATCACAGACGGGCCGAGGAAGGACCTGGTG
AAGGGGAAGCAGATTGCCGCTGCGCTCATGCTGGACAGCACCTTCAGCATCCTGCAGACCTGGGACACCATCAACCTGAACAGCTTCTTC
ACCCAGTTCGAGCAGTTTTGCTTTGTCCTGCAACAGCCTATGATTTATGAAGGACAGGCACAGCTGTGGACCGATTTGCAGTACAGGGAG
AAAGAGGTGAAGAGATACCTGTGGCAACATCTGAAAAAACACGTGGTACCATTGCCGGACGGAAAAAGCACGGACTTTTTGCCTGTGGAC
TGCCCAGTGAGGAGTAAACTGAAAACAGGCCTGATTGTCCTTTTTGTAGTGGAAAAAATTGAGCTTTTATTAGAAGGCAGCCTGGACTGG
TTGTGTCACCTCCTAACCTCAGATGCCAGCTCACCAGATGAGTTTCACCGTGACCTAAGCCACATCCTTGGGATACCTCAGAGCTGGCGG
CTGTACCTGGTGAACCTGTGCCAAAGATGCATGGACACAAGGACGTACACCTGGCTGGGCGCCCTGCCTGTCCTGCACTGCTGTATGGAG
CTGGCCCCGCGGCACAAGGATGCCTGGAGACAGCCTGAGGACACCTGGGCCGCTCTGGAGGGACTCTCCTTCTCACCGTTCCGGGAACAA
ATGCTAGATACGAGTTCCCTACTTCAGTTTATGAGAGAGAAGCAGCATTTGCTGAGCATAGACGAGCCTCTCTTCCGGTCCTGGTTTAGT
CTGCTACCTCTGAGTCACCTGGTTATGTATATGGAAAACTTCATTGAGCACCTGGGTCGTTTTCCTGCTCATATCCTGGACTGTCTTTCA
GGGATTTACTACCGGCTTCCGGGACTTGAGCAAGTCTTGAATACGCAGGATGTTCAGGATGTTCAGAACGTTCAGAACATTTTAGAAATG
CTGTTGCGACTCCTGGACACTTACCGGGACAAGATTCCCGAGGAGGCCTTGTCACCATCCTACCTGACTGTGTGTCTGAAACTGCATGAA
GCCATCTGCAGCAGCACAAAGCTACTTAAGTTTTACGAGCTGCCAGCCTTATCTGCCGAGATTGTCTGCAGAATGATTAGACTTCTATCT
CTGGTGGATTCTGCAGGACAGAGAGATGAAACTGGAAATAATTCAGTCCAAACAGTCTTCCAAGGGACCCTTGCTGCTACGAAAAGGTGG
CTCCGAGAAGTTTTTACAAAGAACATGCTCACATCTTCAGGTGCCTCATTCACATACGTCAAGGAAATTGAGCTCGCCCTCCCCTACCTG
CGGAAGAGTCAAGGGAATGTCATCAACATCTCCAGCCTGGTGGGGGCAATCGGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGGGG
GCAGTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGTGTCCGAGTCAACTGTATCTCCCCAGGAAACATCTGGACC
CCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCAGACCCTAGGGCCACAATCCGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGGGC
CAGCCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAACTTCTGCACGGGCATTGAACTGCTCGTGACGGGGGGTGCA
GAGCTGGGGTACGGGTGCAAGGCCAGTCGGAGCACCCCCGTGGACGCCCCCGATATCCCTTCCTGATTTCTCTCATTTCTACTTGGGGCC
CCCTTCCTAGGACTCTCCCACCCCAAACTCCAACCTGTATCAGATGCAGCCCCCAAGCCCTTAGACTCTAAGCCCAGTTAGCAAGGTGCC


Top

FusionGenePPI for RNF213_HSD17B14


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RNF213UBC, CBX2, CBX4, CBX6, EGFR, PLAC9, RNF213, TRIM23, GOLGA2, REL, TRIM27, TRIP6, UBXN11, KRT40, CD244, SCN2B, IFI16, PTPN1, MRPL50, RNASEH2B, GAN, MCM2, ATOH1, DLK2, SIGLECL1, SDC2, LAMP3, CYLDHSD17B14DDIT3, WDYHV1, HSD17B14, NUDT18, PSMA1, CA8, CDKN2D, MPG, PHF1, SNAPC3, SNRPC, NEK6, TBC1D22B, LINC00152, SREK1IP1, MIR4435-1HG, ABAT, GLO1, ILVBL, RAE1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RNF213_HSD17B14


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RNF213_HSD17B14


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRNF213C1846689MOYAMOYA DISEASE 23UNIPROT