FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31162

FusionGeneSummary for RHOA_C3orf84

check button Fusion gene summary
Fusion gene informationFusion gene name: RHOA_C3orf84
Fusion gene ID: 31162
HgeneTgene
Gene symbol

RHOA

C3orf84

Gene ID

387

646498

Gene nameras homolog family member Achromosome 3 open reading frame 84
SynonymsARH12|ARHA|RHO12|RHOH12-
Cytomap

3p21.31

3p21.31

Type of geneprotein-codingprotein-coding
Descriptiontransforming protein RhoAAplysia ras-related homolog 12oncogene RHO H12small GTP binding protein RhoAuncharacterized protein C3orf84
Modification date2018052720180329
UniProtAcc

P61586

H3BNL1

Ensembl transtripts involved in fusion geneENST00000418115, ENST00000454011, 
ENST00000422781, ENST00000265538, 
ENST00000545770, ENST00000443990, 
ENST00000432035, 
Fusion gene scores* DoF score16 X 8 X 10=12802 X 1 X 2=4
# samples 162
** MAII scorelog2(16/1280*10)=-3
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/4*10)=2.32192809488736
Context

PubMed: RHOA [Title/Abstract] AND C3orf84 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRHOA

GO:0007266

Rho protein signal transduction

26529257

HgeneRHOA

GO:0016477

cell migration

26529257

HgeneRHOA

GO:0032956

regulation of actin cytoskeleton organization

25911094

HgeneRHOA

GO:0035385

Roundabout signaling pathway

26529257

HgeneRHOA

GO:0036089

cleavage furrow formation

16103226

HgeneRHOA

GO:0051496

positive regulation of stress fiber assembly

15467718

HgeneRHOA

GO:0060193

positive regulation of lipase activity

19887681

HgeneRHOA

GO:0071222

cellular response to lipopolysaccharide

19734146

HgeneRHOA

GO:0071902

positive regulation of protein serine/threonine kinase activity

8617235


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-QC-A6FX-01ARHOAchr3

49412867

-C3orf84chr3

49215971

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000418115ENST00000545770RHOAchr3

49412867

-C3orf84chr3

49215971

-
5CDS-5UTRENST00000418115ENST00000443990RHOAchr3

49412867

-C3orf84chr3

49215971

-
5CDS-5UTRENST00000418115ENST00000432035RHOAchr3

49412867

-C3orf84chr3

49215971

-
In-frameENST00000454011ENST00000545770RHOAchr3

49412867

-C3orf84chr3

49215971

-
5CDS-5UTRENST00000454011ENST00000443990RHOAchr3

49412867

-C3orf84chr3

49215971

-
5CDS-5UTRENST00000454011ENST00000432035RHOAchr3

49412867

-C3orf84chr3

49215971

-
In-frameENST00000422781ENST00000545770RHOAchr3

49412867

-C3orf84chr3

49215971

-
5CDS-5UTRENST00000422781ENST00000443990RHOAchr3

49412867

-C3orf84chr3

49215971

-
5CDS-5UTRENST00000422781ENST00000432035RHOAchr3

49412867

-C3orf84chr3

49215971

-
intron-3CDSENST00000265538ENST00000545770RHOAchr3

49412867

-C3orf84chr3

49215971

-
intron-5UTRENST00000265538ENST00000443990RHOAchr3

49412867

-C3orf84chr3

49215971

-
intron-5UTRENST00000265538ENST00000432035RHOAchr3

49412867

-C3orf84chr3

49215971

-

Top

FusionProtFeatures for RHOA_C3orf84


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RHOA

P61586

C3orf84

H3BNL1

Regulates a signal transduction pathway linking plasmamembrane receptors to the assembly of focal adhesions and actinstress fibers. Involved in a microtubule-dependent signal that isrequired for the myosin contractile ring formation during cellcycle cytokinesis. Plays an essential role in cleavage furrowformation. Required for the apical junction formation ofkeratinocyte cell-cell adhesion. Stimulates PKN2 kinase activity.May be an activator of PLCE1. Activated by ARHGEF2, which promotesthe exchange of GDP for GTP. Essential for the SPATA13-mediatedregulation of cell migration and adhesion assembly anddisassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays animportant role in ERBB2-dependent stabilization of microtubules atthe cell cortex. It controls the localization of APC and CLASP2 tothe cell membrane, via the regulation of GSK3B activity. In turn,membrane-bound APC allows the localization of the MACF1 to thecell membrane, which is required for microtubule capture andstabilization. Regulates a signal transduction pathway linkingplasma membrane receptors to the assembly of focal adhesions andactin stress fibers. Involved in a microtubule-dependent signalthat is required for the myosin contractile ring formation duringcell cycle cytokinesis. Plays an essential role in cleavage furrowformation. Required for the apical junction formation ofkeratinocyte cell-cell adhesion. May be an activator of PLCE1.Activated by ARHGEF2, which promotes the exchange of GDP for GTP.Essential for the SPATA13-mediated regulation of cell migrationand adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1signaling pathway plays an important role in ERBB2-dependentstabilization of microtubules at the cell cortex. It controls thelocalization of APC and CLASP2 to the cell membrane, via theregulation of GSK3B activity. In turn, membrane-bound APC allowsthe localization of the MACF1 to the cell membrane, which isrequired for microtubule capture and stabilization (Bysimilarity). Regulates KCNA2 potassium channel activity byreducing its location at the cell surface in response to CHRM1activation; promotes KCNA2 endocytosis (PubMed:9635436,PubMed:19403695). {ECO:0000250, ECO:0000269|PubMed:12900402,ECO:0000269|PubMed:16103226, ECO:0000269|PubMed:16236794,ECO:0000269|PubMed:19934221, ECO:0000269|PubMed:20937854,ECO:0000269|PubMed:20974804, ECO:0000269|PubMed:8910519,ECO:0000269|PubMed:9121475, ECO:0000269|PubMed:9635436}. (Microbial infection) Serves as a target for the yopTcysteine peptidase from Yersinia pestis, vector of the plague.{ECO:0000269|PubMed:12062101, ECO:0000269|PubMed:12538863}. (Microbial infection) Serves as a target for the yopTcysteine peptidase from Yersinia pseudotuberculosis, which causesgastrointestinal disorders. {ECO:0000269|PubMed:12062101,ECO:0000269|PubMed:12538863}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRHOAchr3:49412867chr3:49215971ENST00000418115-2534_4252194MotifEffector region
HgeneRHOAchr3:49412867chr3:49215971ENST00000418115-2512_1952194Nucleotide bindingGTP

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRHOAchr3:49412867chr3:49215971ENST00000418115-25182_18752194Compositional biasNote=Arg/Lys-rich (basic)
HgeneRHOAchr3:49412867chr3:49215971ENST00000418115-25117_12052194Nucleotide bindingGTP
HgeneRHOAchr3:49412867chr3:49215971ENST00000418115-2559_6352194Nucleotide bindingGTP


Top

FusionGeneSequence for RHOA_C3orf84


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RHOA_ENST00000418115_chr3_49412867_-_C3orf84_ENST00000545770_chr3_49215971_-_210aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVTVPTVFENTVADIEVDGKQEPAQRHFFSKHDNRTSFDKGPTCLLQGIGRRKDLERLW
QRHTFLRWAPCEIELRQQGPLESSYQADFRPGPGLSGLPQHLIHFVQVQPSHTRTTYQQNFCCPSQGGHTGSYKVGPQAPVTDVLPDLPG

>In-frame_RHOA_ENST00000454011_chr3_49412867_-_C3orf84_ENST00000545770_chr3_49215971_-_210aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVTVPTVFENTVADIEVDGKQEPAQRHFFSKHDNRTSFDKGPTCLLQGIGRRKDLERLW
QRHTFLRWAPCEIELRQQGPLESSYQADFRPGPGLSGLPQHLIHFVQVQPSHTRTTYQQNFCCPSQGGHTGSYKVGPQAPVTDVLPDLPG

>In-frame_RHOA_ENST00000422781_chr3_49412867_-_C3orf84_ENST00000545770_chr3_49215971_-_210aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVTVPTVFENTVADIEVDGKQEPAQRHFFSKHDNRTSFDKGPTCLLQGIGRRKDLERLW
QRHTFLRWAPCEIELRQQGPLESSYQADFRPGPGLSGLPQHLIHFVQVQPSHTRTTYQQNFCCPSQGGHTGSYKVGPQAPVTDVLPDLPG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RHOA_ENST00000418115_chr3_49412867_-_C3orf84_ENST00000545770_chr3_49215971_-_630nt
ATGGCTGCCATCCGGAAGAAACTGGTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATAGTCTTCAGCAAGGACCAGTTC
CCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGAGGTGGATGGAAAGCAGGAGCCGGCGCAGCGACACTTCTTC
TCCAAGCACGACAACCGTACTTCCTTTGACAAAGGTCCCTATTGCCTGCTGCAGGGAATCGGAAGGCGGAAGGACCTGGAGCGCCTGTGG
CAGCGGCACACCTTCCTGCGCTGGGCACCCTGTGAGATAGAGTTGCGCCAGCAGGGGCCCCTGGAATCTTCTTACCAGGCTGATTTCAGG
CCAGGCCCAGGACTCAGTGGCCTCCCCCAGCACCTCATCCACTTTGTGCAGGTCCAGCCTTCCCATACCAGGACCACCTACCAGCAGAAC
TTCTGCTGCCCATCCCAGGGTGGCCACTATGGCAGCTACAAGGTAGGGCCCCAGGCGCCGGTCACTGACGTACTGCCTGACCTCCCAGGG
ATCCCAAGACCCAAGCTGCTGCAGCACTACCTTCATGCTGGGGTCTCTGAGTGTCTAAACTGGTCCAGAGCATTAAACAAGGACAGCTGA

>In-frame_RHOA_ENST00000454011_chr3_49412867_-_C3orf84_ENST00000545770_chr3_49215971_-_630nt
ATGGCTGCCATCCGGAAGAAACTGGTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATAGTCTTCAGCAAGGACCAGTTC
CCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGAGGTGGATGGAAAGCAGGAGCCGGCGCAGCGACACTTCTTC
TCCAAGCACGACAACCGTACTTCCTTTGACAAAGGTCCCTATTGCCTGCTGCAGGGAATCGGAAGGCGGAAGGACCTGGAGCGCCTGTGG
CAGCGGCACACCTTCCTGCGCTGGGCACCCTGTGAGATAGAGTTGCGCCAGCAGGGGCCCCTGGAATCTTCTTACCAGGCTGATTTCAGG
CCAGGCCCAGGACTCAGTGGCCTCCCCCAGCACCTCATCCACTTTGTGCAGGTCCAGCCTTCCCATACCAGGACCACCTACCAGCAGAAC
TTCTGCTGCCCATCCCAGGGTGGCCACTATGGCAGCTACAAGGTAGGGCCCCAGGCGCCGGTCACTGACGTACTGCCTGACCTCCCAGGG
ATCCCAAGACCCAAGCTGCTGCAGCACTACCTTCATGCTGGGGTCTCTGAGTGTCTAAACTGGTCCAGAGCATTAAACAAGGACAGCTGA

>In-frame_RHOA_ENST00000422781_chr3_49412867_-_C3orf84_ENST00000545770_chr3_49215971_-_630nt
ATGGCTGCCATCCGGAAGAAACTGGTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATAGTCTTCAGCAAGGACCAGTTC
CCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGAGGTGGATGGAAAGCAGGAGCCGGCGCAGCGACACTTCTTC
TCCAAGCACGACAACCGTACTTCCTTTGACAAAGGTCCCTATTGCCTGCTGCAGGGAATCGGAAGGCGGAAGGACCTGGAGCGCCTGTGG
CAGCGGCACACCTTCCTGCGCTGGGCACCCTGTGAGATAGAGTTGCGCCAGCAGGGGCCCCTGGAATCTTCTTACCAGGCTGATTTCAGG
CCAGGCCCAGGACTCAGTGGCCTCCCCCAGCACCTCATCCACTTTGTGCAGGTCCAGCCTTCCCATACCAGGACCACCTACCAGCAGAAC
TTCTGCTGCCCATCCCAGGGTGGCCACTATGGCAGCTACAAGGTAGGGCCCCAGGCGCCGGTCACTGACGTACTGCCTGACCTCCCAGGG
ATCCCAAGACCCAAGCTGCTGCAGCACTACCTTCATGCTGGGGTCTCTGAGTGTCTAAACTGGTCCAGAGCATTAAACAAGGACAGCTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_RHOA_ENST00000418115_chr3_49412867_-_C3orf84_ENST00000545770_chr3_49215971_-_1019nt
AATAGCAACCAGGTCTTTTATAGCCCCGGAGTTCCCGTGATGCCCCACGCGGCTGCAATGATTGGTTAAGGGTTTTGCTTTTAGGGCGTG
GACGGGCTCCTGAGCAATAGTGGATGAGCTGTGAGTGCGCGCGCGTGCGCGGGGCCGCGACCTGTGCCGGCTCGAGCCCGCTGGGCACTC
GGAGGCGCGCACGTCGTTCCCCGCCCTCCCGCCGCCGCCCGCCCTCGCTCTCTCGCGCTACCCTCCCGCCGCCCGCGGTCCTCCGTCGGT
TCTCTCGTTAGTCCACGGTCTGGTCTTCAGCTACCCGCCTTCGTCTCCGAGTTTGCGACTCGCGGACCGGCGTCCCCGGCGCGAAGAGGC
TGGACTCGGATTCGTTGCCTGAGCAATGGCTGCCATCCGGAAGAAACTGGTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCT
CATAGTCTTCAGCAAGGACCAGTTCCCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGAGGTGGATGGAAAGCA
GGAGCCGGCGCAGCGACACTTCTTCTCCAAGCACGACAACCGTACTTCCTTTGACAAAGGTCCCTATTGCCTGCTGCAGGGAATCGGAAG
GCGGAAGGACCTGGAGCGCCTGTGGCAGCGGCACACCTTCCTGCGCTGGGCACCCTGTGAGATAGAGTTGCGCCAGCAGGGGCCCCTGGA
ATCTTCTTACCAGGCTGATTTCAGGCCAGGCCCAGGACTCAGTGGCCTCCCCCAGCACCTCATCCACTTTGTGCAGGTCCAGCCTTCCCA
TACCAGGACCACCTACCAGCAGAACTTCTGCTGCCCATCCCAGGGTGGCCACTATGGCAGCTACAAGGTAGGGCCCCAGGCGCCGGTCAC
TGACGTACTGCCTGACCTCCCAGGGATCCCAAGACCCAAGCTGCTGCAGCACTACCTTCATGCTGGGGTCTCTGAGTGTCTAAACTGGTC

>In-frame_RHOA_ENST00000454011_chr3_49412867_-_C3orf84_ENST00000545770_chr3_49215971_-_745nt
TCGTTAGTCCACGGTCTGGTCTTCAGCTACCCGCCTTCGTCTCCGAGTTTGCGACTCGCGGACCGGCGTCCCCGGCGCGAAGAGGCTGGA
CTCGGATTCGTTGCCTGAGCAATGGCTGCCATCCGGAAGAAACTGGTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATA
GTCTTCAGCAAGGACCAGTTCCCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGAGGTGGATGGAAAGCAGGAG
CCGGCGCAGCGACACTTCTTCTCCAAGCACGACAACCGTACTTCCTTTGACAAAGGTCCCTATTGCCTGCTGCAGGGAATCGGAAGGCGG
AAGGACCTGGAGCGCCTGTGGCAGCGGCACACCTTCCTGCGCTGGGCACCCTGTGAGATAGAGTTGCGCCAGCAGGGGCCCCTGGAATCT
TCTTACCAGGCTGATTTCAGGCCAGGCCCAGGACTCAGTGGCCTCCCCCAGCACCTCATCCACTTTGTGCAGGTCCAGCCTTCCCATACC
AGGACCACCTACCAGCAGAACTTCTGCTGCCCATCCCAGGGTGGCCACTATGGCAGCTACAAGGTAGGGCCCCAGGCGCCGGTCACTGAC
GTACTGCCTGACCTCCCAGGGATCCCAAGACCCAAGCTGCTGCAGCACTACCTTCATGCTGGGGTCTCTGAGTGTCTAAACTGGTCCAGA

>In-frame_RHOA_ENST00000422781_chr3_49412867_-_C3orf84_ENST00000545770_chr3_49215971_-_787nt
TCGCGCTACCCTCCCGCCGCCCGCGGTCCTCCGTCGGTTCTCTCGTTAGTCCACGGTCTGGTCTTCAGCTACCCGCCTTCGTCTCCGAGT
TTGCGACTCGCGGACCGGCGTCCCCGGCGCGAAGAGGCTGGACTCGGATTCGTTGCCTGAGCAATGGCTGCCATCCGGAAGAAACTGGTG
ATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATAGTCTTCAGCAAGGACCAGTTCCCAGAGGTGTATGTGCCCACAGTGTTT
GAGAACTATGTGGCAGATATCGAGGTGGATGGAAAGCAGGAGCCGGCGCAGCGACACTTCTTCTCCAAGCACGACAACCGTACTTCCTTT
GACAAAGGTCCCTATTGCCTGCTGCAGGGAATCGGAAGGCGGAAGGACCTGGAGCGCCTGTGGCAGCGGCACACCTTCCTGCGCTGGGCA
CCCTGTGAGATAGAGTTGCGCCAGCAGGGGCCCCTGGAATCTTCTTACCAGGCTGATTTCAGGCCAGGCCCAGGACTCAGTGGCCTCCCC
CAGCACCTCATCCACTTTGTGCAGGTCCAGCCTTCCCATACCAGGACCACCTACCAGCAGAACTTCTGCTGCCCATCCCAGGGTGGCCAC
TATGGCAGCTACAAGGTAGGGCCCCAGGCGCCGGTCACTGACGTACTGCCTGACCTCCCAGGGATCCCAAGACCCAAGCTGCTGCAGCAC


Top

FusionGenePPI for RHOA_C3orf84


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RHOAPDE6D, RAP1GDS1, ARHGAP1, ARHGDIA, BID, TNFRSF10B, EZR, FADD, FASLG, MAPK8, MSN, CASP10, CASP8, FAS, TNFRSF1A, ARHGEF25, DEF6, ARHGAP32, ARHGAP5, ROCK1, PKN1, DIAPH1, CIT, RHPN2, KTN1, ITPR1, TRPC1, ARHGEF1, PLD1, RTKN, NET1, CRMP1, DPYSL2, ARHGEF12, HSPA1A, PLCG1, ARHGEF3, AKAP13, PKN2, ICMT, VAV3, ARHGEF18, ARHGAP26, ARHGAP10, KCNA2, ARHGEF4, ARHGEF2, ARHGAP35, ARHGEF11, RIPK4, MPRIP, OPHN1, DGKQ, ROCK2, TRIO, MCF2, PLEKHG2, ARHGDIG, MCF2L, BCR, PLXNB1, SMURF1, SMURF2, OTUB1, CUL3, SRGAP1, CAV1, HTR1A, MAP3K1, MDM2, PSMD10, MARK2, LRRK2, PPP1R12A, RPS27A, CLNS1A, MPV17, PON2, PRDX6, NUBP2, SLC25A5, PLIN3, CPT1A, RPL18, DDX1, BAIAP2, DIAPH3, CDKN1B, GNB2L1, RPN2, FAM65B, SMAD2, TBXA2R, BIRC2, IKBKG, KCTD13, TNFAIP1, TRIP6, IKZF3, UBC, DCUN1D1, KLHL20, MBD5, SERPINB5, TM4SF20, DIRAS3, LDB3, NFKBIA, TSC22D4, RASL10A, APOA1BP, ARHGDIB, GORASP2, PAFAH1B2, PRRC1, NUTF2, RPE, SHMT2, SLC25A12, CNKSR1, RHPN1, MED20, RPGR, LIMA1, ATP6AP2, NVL, UBE2V2, FUBP3, BAZ1A, STK39, SYNPO2, DAAM1, RASSF1, S100A4, ANLN, U2AF2, SH3GLB2, GOSR1, AGAP2, AGAP1, RHOC, PKN3, DNAL1, RABL3, AK9, IRGC, RAP2C, HDAC7, GLB1, VASH1, CTSA, FGB, LUM, PTEN, COX15, DLST, HSD17B10, PDHA1, SOD1, KRAS, NOTCH1C3orf84


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RHOA_C3orf84


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RHOA_C3orf84


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRHOAC0038356Stomach Neoplasms3CTD_human
HgeneRHOAC0020981Angioimmunoblastic Lymphadenopathy2CTD_human
HgeneRHOAC0079774Peripheral T-Cell Lymphoma2CTD_human
HgeneRHOAC0005695Bladder Neoplasm1CTD_human
HgeneRHOAC0027626Neoplasm Invasiveness1CTD_human
HgeneRHOAC0033687Proteinuria1CTD_human
HgeneRHOAC0079772T-Cell Lymphoma1CTD_human
HgeneRHOAC0079773Lymphoma, T-Cell, Cutaneous1CTD_human
HgeneRHOAC0235833Congenital diaphragmatic hernia1CTD_human