FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31103

FusionGeneSummary for RGS12_PDZRN3

check button Fusion gene summary
Fusion gene informationFusion gene name: RGS12_PDZRN3
Fusion gene ID: 31103
HgeneTgene
Gene symbol

RGS12

PDZRN3

Gene ID

6002

23024

Gene nameregulator of G protein signaling 12PDZ domain containing ring finger 3
Synonyms-LNX3|SEMACAP3|SEMCAP3
Cytomap

4p16.3

3p13

Type of geneprotein-codingprotein-coding
Descriptionregulator of G-protein signaling 12regulator of G-protein signalling 12E3 ubiquitin-protein ligase PDZRN3RING-type E3 ubiquitin transferase PDZRN3ligand of Numb protein X 3likely ortholog of mouse semaF cytoplasmic domain associated protein 3semaphorin cytoplasmic domain-associated protein 3
Modification date2018051920180523
UniProtAcc

O14924

Q9UPQ7

Ensembl transtripts involved in fusion geneENST00000543385, ENST00000336727, 
ENST00000344733, ENST00000382788, 
ENST00000306648, ENST00000338806, 
ENST00000508158, ENST00000538395, 
ENST00000263666, ENST00000466780, 
ENST00000308537, ENST00000462146, 
ENST00000535920, ENST00000479530, 
ENST00000466348, 
Fusion gene scores* DoF score6 X 6 X 4=1442 X 4 X 2=16
# samples 84
** MAII scorelog2(8/144*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/16*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RGS12 [Title/Abstract] AND PDZRN3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCECTCGA-E6-A8L9-01ARGS12chr4

3319778

+PDZRN3chr3

73657835

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000543385ENST00000263666RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000543385ENST00000466780RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000543385ENST00000308537RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000543385ENST00000462146RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000543385ENST00000535920RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000543385ENST00000479530RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000543385ENST00000466348RGS12chr4

3319778

+PDZRN3chr3

73657835

-
In-frameENST00000336727ENST00000263666RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000336727ENST00000466780RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000336727ENST00000308537RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000336727ENST00000462146RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000336727ENST00000535920RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000336727ENST00000479530RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000336727ENST00000466348RGS12chr4

3319778

+PDZRN3chr3

73657835

-
In-frameENST00000344733ENST00000263666RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000344733ENST00000466780RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000344733ENST00000308537RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000344733ENST00000462146RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000344733ENST00000535920RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000344733ENST00000479530RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000344733ENST00000466348RGS12chr4

3319778

+PDZRN3chr3

73657835

-
In-frameENST00000382788ENST00000263666RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000382788ENST00000466780RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000382788ENST00000308537RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000382788ENST00000462146RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000382788ENST00000535920RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000382788ENST00000479530RGS12chr4

3319778

+PDZRN3chr3

73657835

-
5CDS-intronENST00000382788ENST00000466348RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-3CDSENST00000306648ENST00000263666RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000306648ENST00000466780RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000306648ENST00000308537RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000306648ENST00000462146RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000306648ENST00000535920RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000306648ENST00000479530RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000306648ENST00000466348RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-3CDSENST00000338806ENST00000263666RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000338806ENST00000466780RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000338806ENST00000308537RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000338806ENST00000462146RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000338806ENST00000535920RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000338806ENST00000479530RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000338806ENST00000466348RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-3CDSENST00000508158ENST00000263666RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000508158ENST00000466780RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000508158ENST00000308537RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000508158ENST00000462146RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000508158ENST00000535920RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000508158ENST00000479530RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000508158ENST00000466348RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-3CDSENST00000538395ENST00000263666RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000538395ENST00000466780RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000538395ENST00000308537RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000538395ENST00000462146RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000538395ENST00000535920RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000538395ENST00000479530RGS12chr4

3319778

+PDZRN3chr3

73657835

-
intron-intronENST00000538395ENST00000466348RGS12chr4

3319778

+PDZRN3chr3

73657835

-

Top

FusionProtFeatures for RGS12_PDZRN3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RGS12

O14924

PDZRN3

Q9UPQ7

E3 ubiquitin-protein ligase. Plays an important role inregulating the surface level of MUSK on myotubes. Mediates theubiquitination of MUSK, promoting its endocytosis and lysosomaldegradation. Might contribute to terminal myogenicdifferentiation. {ECO:0000250|UniProtKB:Q69ZS0}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRGS12chr4:3319778chr3:73657835ENST00000336727+217228_3406271377DomainPID
HgeneRGS12chr4:3319778chr3:73657835ENST00000336727+21722_986271377DomainPDZ
HgeneRGS12chr4:3319778chr3:73657835ENST00000344733+218228_3406271448DomainPID
HgeneRGS12chr4:3319778chr3:73657835ENST00000344733+21822_986271448DomainPDZ
HgeneRGS12chr4:3319778chr3:73657835ENST00000382788+116228_3406271377DomainPID
HgeneRGS12chr4:3319778chr3:73657835ENST00000382788+11622_986271377DomainPDZ
TgenePDZRN3chr4:3319778chr3:73657835ENST00000263666-010679_7042411067Coiled coilOntology_term=ECO:0000255
TgenePDZRN3chr4:3319778chr3:73657835ENST00000263666-010975_10252411067Coiled coilOntology_term=ECO:0000255
TgenePDZRN3chr4:3319778chr3:73657835ENST00000308537-04679_704241361Coiled coilOntology_term=ECO:0000255
TgenePDZRN3chr4:3319778chr3:73657835ENST00000308537-04975_1025241361Coiled coilOntology_term=ECO:0000255
TgenePDZRN3chr4:3319778chr3:73657835ENST00000263666-010249_3392411067DomainPDZ 1
TgenePDZRN3chr4:3319778chr3:73657835ENST00000263666-010419_5032411067DomainPDZ 2
TgenePDZRN3chr4:3319778chr3:73657835ENST00000308537-04249_339241361DomainPDZ 1
TgenePDZRN3chr4:3319778chr3:73657835ENST00000308537-04419_503241361DomainPDZ 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRGS12chr4:3319778chr3:73657835ENST00000306648+1151034_1104-26556DomainRBD 2
HgeneRGS12chr4:3319778chr3:73657835ENST00000306648+1151187_1209-26556DomainGoLoco
HgeneRGS12chr4:3319778chr3:73657835ENST00000306648+115228_340-26556DomainPID
HgeneRGS12chr4:3319778chr3:73657835ENST00000306648+11522_98-26556DomainPDZ
HgeneRGS12chr4:3319778chr3:73657835ENST00000306648+115715_832-26556DomainRGS
HgeneRGS12chr4:3319778chr3:73657835ENST00000306648+115962_1032-26556DomainRBD 1
HgeneRGS12chr4:3319778chr3:73657835ENST00000336727+2171034_11046271377DomainRBD 2
HgeneRGS12chr4:3319778chr3:73657835ENST00000336727+2171187_12096271377DomainGoLoco
HgeneRGS12chr4:3319778chr3:73657835ENST00000336727+217715_8326271377DomainRGS
HgeneRGS12chr4:3319778chr3:73657835ENST00000336727+217962_10326271377DomainRBD 1
HgeneRGS12chr4:3319778chr3:73657835ENST00000338806+1161034_1104-130800DomainRBD 2
HgeneRGS12chr4:3319778chr3:73657835ENST00000338806+1161187_1209-130800DomainGoLoco
HgeneRGS12chr4:3319778chr3:73657835ENST00000338806+116228_340-130800DomainPID
HgeneRGS12chr4:3319778chr3:73657835ENST00000338806+11622_98-130800DomainPDZ
HgeneRGS12chr4:3319778chr3:73657835ENST00000338806+116715_832-130800DomainRGS
HgeneRGS12chr4:3319778chr3:73657835ENST00000338806+116962_1032-130800DomainRBD 1
HgeneRGS12chr4:3319778chr3:73657835ENST00000344733+2181034_11046271448DomainRBD 2
HgeneRGS12chr4:3319778chr3:73657835ENST00000344733+2181187_12096271448DomainGoLoco
HgeneRGS12chr4:3319778chr3:73657835ENST00000344733+218715_8326271448DomainRGS
HgeneRGS12chr4:3319778chr3:73657835ENST00000344733+218962_10326271448DomainRBD 1
HgeneRGS12chr4:3319778chr3:73657835ENST00000382788+1161034_11046271377DomainRBD 2
HgeneRGS12chr4:3319778chr3:73657835ENST00000382788+1161187_12096271377DomainGoLoco
HgeneRGS12chr4:3319778chr3:73657835ENST00000382788+116715_8326271377DomainRGS
HgeneRGS12chr4:3319778chr3:73657835ENST00000382788+116962_10326271377DomainRBD 1
TgenePDZRN3chr4:3319778chr3:73657835ENST00000263666-010100_1582411067Zinc fingerTRAF-type
TgenePDZRN3chr4:3319778chr3:73657835ENST00000263666-01018_562411067Zinc fingerRING-type%3B degenerate
TgenePDZRN3chr4:3319778chr3:73657835ENST00000308537-04100_158241361Zinc fingerTRAF-type
TgenePDZRN3chr4:3319778chr3:73657835ENST00000308537-0418_56241361Zinc fingerRING-type%3B degenerate


Top

FusionGeneSequence for RGS12_PDZRN3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RGS12_ENST00000543385_chr4_3319778_+_PDZRN3_ENST00000263666_chr3_73657835_-_1453aa
MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQILAVNEINVKKASHEDVVKLIGKCSGV
LHMVIAEGVGRFESCSSDEEGGLTEGKGWLKPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASNSEPLKLKQRSLSESAATRFD
VGHESINNPNPNMLSKEEISKVIHDDSVFSIGLESHDDFALDASILNVAMIVGYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHS
LVTMKIMHDCVQLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNSDSGIGNFHQEEKSNRVLVVDLGGSSSRH
GPGGSAWDGVGGRGAQPWGAPWTGPFCPDPEGSPPFEAAHQTDRFWDLNKHLGPASPVEVPPASLRSSVPPSKRGTVGAGCGFNQRWLPV
HVLREWQCGHTSDQDSYTDSTDGWSSINCGTLPPPMSKIPADRYRVEGSFAQPPLNAPKREWSRKAFGMQSIFGPHRNVRKTKEDKKGEE
TKSLTLVLHRDSGSLGFNIIGGRPSVDNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIEVNGRDLSRATHDQAVEAFKTAKEPIVVQ
VLRRTPRTKMFTPPSESQLVDTGTQTDITFEHIMALTKMSSPSPPVLDPTLLPEEHPSAHEYYDPNDYIGDIHQEMDREELELEEVDLYR
MNSQDKLGLTVCYRTDDEDDIGITISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTSEENKNFSLLIARPELQLDEGWMDD
DRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHDEDGGTTDTATILSNQHEKDSGVGRTDESTRNDESSEQENNGDDATASSNPLAGQR
KLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFRELLELKCQVKSATPYGLYYPSGPLDAGKSDPESVDKELELLNEELRS
IELECLSIVRAHKMQQLKEQYRESWMLHNSGFRNYNTSIDVRRHELSDITELPEKSDKDSSSAYNTGESCRSTPLTLEISPDNSLRRAAE
GISCPSSEGAVGTTEAYGPASKNLLSITEDPEVGTPTTSPSLKELDPNQPLESKERRASDGSRSPTPSQKLGSAYLPSTHHSPYKHAHIP
AHAQHYQSYMQLIQQKSAVEYAQSQMSLVSMCKDLSSPTPSEPRMEWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGMTTDDDAV
SEMKMGRYWSKEERKQHLVKAKEQRRRREFMMQSRLDCLKEQQAADDRKEMNILELSHKKMMKKRNKKIFDNWMTIQELLTHGTKSPDGT

>In-frame_RGS12_ENST00000336727_chr4_3319778_+_PDZRN3_ENST00000263666_chr3_73657835_-_1453aa
MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQILAVNEINVKKASHEDVVKLIGKCSGV
LHMVIAEGVGRFESCSSDEEGGLTEGKGWLKPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASNSEPLKLKQRSLSESAATRFD
VGHESINNPNPNMLSKEEISKVIHDDSVFSIGLESHDDFALDASILNVAMIVGYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHS
LVTMKIMHDCVQLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNSDSGIGNFHQEEKSNRVLVVDLGGSSSRH
GPGGSAWDGVGGRGAQPWGAPWTGPFCPDPEGSPPFEAAHQTDRFWDLNKHLGPASPVEVPPASLRSSVPPSKRGTVGAGCGFNQRWLPV
HVLREWQCGHTSDQDSYTDSTDGWSSINCGTLPPPMSKIPADRYRVEGSFAQPPLNAPKREWSRKAFGMQSIFGPHRNVRKTKEDKKGEE
TKSLTLVLHRDSGSLGFNIIGGRPSVDNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIEVNGRDLSRATHDQAVEAFKTAKEPIVVQ
VLRRTPRTKMFTPPSESQLVDTGTQTDITFEHIMALTKMSSPSPPVLDPTLLPEEHPSAHEYYDPNDYIGDIHQEMDREELELEEVDLYR
MNSQDKLGLTVCYRTDDEDDIGITISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTSEENKNFSLLIARPELQLDEGWMDD
DRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHDEDGGTTDTATILSNQHEKDSGVGRTDESTRNDESSEQENNGDDATASSNPLAGQR
KLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFRELLELKCQVKSATPYGLYYPSGPLDAGKSDPESVDKELELLNEELRS
IELECLSIVRAHKMQQLKEQYRESWMLHNSGFRNYNTSIDVRRHELSDITELPEKSDKDSSSAYNTGESCRSTPLTLEISPDNSLRRAAE
GISCPSSEGAVGTTEAYGPASKNLLSITEDPEVGTPTTSPSLKELDPNQPLESKERRASDGSRSPTPSQKLGSAYLPSTHHSPYKHAHIP
AHAQHYQSYMQLIQQKSAVEYAQSQMSLVSMCKDLSSPTPSEPRMEWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGMTTDDDAV
SEMKMGRYWSKEERKQHLVKAKEQRRRREFMMQSRLDCLKEQQAADDRKEMNILELSHKKMMKKRNKKIFDNWMTIQELLTHGTKSPDGT

>In-frame_RGS12_ENST00000344733_chr4_3319778_+_PDZRN3_ENST00000263666_chr3_73657835_-_1453aa
MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQILAVNEINVKKASHEDVVKLIGKCSGV
LHMVIAEGVGRFESCSSDEEGGLTEGKGWLKPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASNSEPLKLKQRSLSESAATRFD
VGHESINNPNPNMLSKEEISKVIHDDSVFSIGLESHDDFALDASILNVAMIVGYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHS
LVTMKIMHDCVQLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNSDSGIGNFHQEEKSNRVLVVDLGGSSSRH
GPGGSAWDGVGGRGAQPWGAPWTGPFCPDPEGSPPFEAAHQTDRFWDLNKHLGPASPVEVPPASLRSSVPPSKRGTVGAGCGFNQRWLPV
HVLREWQCGHTSDQDSYTDSTDGWSSINCGTLPPPMSKIPADRYRVEGSFAQPPLNAPKREWSRKAFGMQSIFGPHRNVRKTKEDKKGEE
TKSLTLVLHRDSGSLGFNIIGGRPSVDNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIEVNGRDLSRATHDQAVEAFKTAKEPIVVQ
VLRRTPRTKMFTPPSESQLVDTGTQTDITFEHIMALTKMSSPSPPVLDPTLLPEEHPSAHEYYDPNDYIGDIHQEMDREELELEEVDLYR
MNSQDKLGLTVCYRTDDEDDIGITISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTSEENKNFSLLIARPELQLDEGWMDD
DRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHDEDGGTTDTATILSNQHEKDSGVGRTDESTRNDESSEQENNGDDATASSNPLAGQR
KLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFRELLELKCQVKSATPYGLYYPSGPLDAGKSDPESVDKELELLNEELRS
IELECLSIVRAHKMQQLKEQYRESWMLHNSGFRNYNTSIDVRRHELSDITELPEKSDKDSSSAYNTGESCRSTPLTLEISPDNSLRRAAE
GISCPSSEGAVGTTEAYGPASKNLLSITEDPEVGTPTTSPSLKELDPNQPLESKERRASDGSRSPTPSQKLGSAYLPSTHHSPYKHAHIP
AHAQHYQSYMQLIQQKSAVEYAQSQMSLVSMCKDLSSPTPSEPRMEWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGMTTDDDAV
SEMKMGRYWSKEERKQHLVKAKEQRRRREFMMQSRLDCLKEQQAADDRKEMNILELSHKKMMKKRNKKIFDNWMTIQELLTHGTKSPDGT

>In-frame_RGS12_ENST00000382788_chr4_3319778_+_PDZRN3_ENST00000263666_chr3_73657835_-_1453aa
MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQILAVNEINVKKASHEDVVKLIGKCSGV
LHMVIAEGVGRFESCSSDEEGGLTEGKGWLKPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASNSEPLKLKQRSLSESAATRFD
VGHESINNPNPNMLSKEEISKVIHDDSVFSIGLESHDDFALDASILNVAMIVGYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHS
LVTMKIMHDCVQLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNSDSGIGNFHQEEKSNRVLVVDLGGSSSRH
GPGGSAWDGVGGRGAQPWGAPWTGPFCPDPEGSPPFEAAHQTDRFWDLNKHLGPASPVEVPPASLRSSVPPSKRGTVGAGCGFNQRWLPV
HVLREWQCGHTSDQDSYTDSTDGWSSINCGTLPPPMSKIPADRYRVEGSFAQPPLNAPKREWSRKAFGMQSIFGPHRNVRKTKEDKKGEE
TKSLTLVLHRDSGSLGFNIIGGRPSVDNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIEVNGRDLSRATHDQAVEAFKTAKEPIVVQ
VLRRTPRTKMFTPPSESQLVDTGTQTDITFEHIMALTKMSSPSPPVLDPTLLPEEHPSAHEYYDPNDYIGDIHQEMDREELELEEVDLYR
MNSQDKLGLTVCYRTDDEDDIGITISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTSEENKNFSLLIARPELQLDEGWMDD
DRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHDEDGGTTDTATILSNQHEKDSGVGRTDESTRNDESSEQENNGDDATASSNPLAGQR
KLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFRELLELKCQVKSATPYGLYYPSGPLDAGKSDPESVDKELELLNEELRS
IELECLSIVRAHKMQQLKEQYRESWMLHNSGFRNYNTSIDVRRHELSDITELPEKSDKDSSSAYNTGESCRSTPLTLEISPDNSLRRAAE
GISCPSSEGAVGTTEAYGPASKNLLSITEDPEVGTPTTSPSLKELDPNQPLESKERRASDGSRSPTPSQKLGSAYLPSTHHSPYKHAHIP
AHAQHYQSYMQLIQQKSAVEYAQSQMSLVSMCKDLSSPTPSEPRMEWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGMTTDDDAV
SEMKMGRYWSKEERKQHLVKAKEQRRRREFMMQSRLDCLKEQQAADDRKEMNILELSHKKMMKKRNKKIFDNWMTIQELLTHGTKSPDGT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RGS12_ENST00000543385_chr4_3319778_+_PDZRN3_ENST00000263666_chr3_73657835_-_4359nt
ATGTTTAGAGCTGGGGAGGCCTCCAAACGCCCATTGCCTGGGCCGTCGCCCCCAAGGGTGCGGAGTGTGGAGGTTGCCCGGGGGAGGGCC
GGCTACGGATTCACGCTTTCGGGACAGGCACCCTGTGTGCTCAGCTGCGTCATGAGAGGGAGCCCTGCGGATTTCGTGGGCCTCCGAGCT
GGAGACCAGATACTTGCTGTCAATGAAATCAACGTGAAAAAAGCATCTCATGAAGATGTAGTGAAATTAATTGGGAAGTGCTCTGGTGTC
CTTCACATGGTGATTGCTGAAGGCGTCGGCCGCTTCGAATCCTGTTCCAGTGATGAAGAAGGGGGACTCTATGAAGGAAAAGGCTGGCTG
AAGCCCAAGCTGGATTCTAAAGCACTAGGTATAAACAGAGCAGAGCGAGTCGTGGAGGAAATGCAGTCTGGTGGAATTTTCAATATGATT
TTTGAAAACCCGAGCCTTTGTGCGAGCAATTCAGAGCCCTTGAAATTGAAACAAAGATCCCTTTCAGAGTCGGCCGCAACTCGATTTGAT
GTTGGACATGAAAGTATAAATAATCCAAATCCCAACATGCTTTCTAAGGAGGAAATATCAAAAGTTATTCATGATGATTCGGTTTTCAGC
ATTGGACTAGAAAGTCATGACGATTTTGCATTGGATGCAAGTATTTTAAACGTGGCGATGATCGTGGGCTACTTAGGCTCCATTGAGCTT
CCTTCCACGAGCTCCAACCTGGAGTCCGACAGCTTGCAAGCCATCCGCGGCTGCATGCGGCGCCTGCGGGCAGAGCAGAAAATCCACTCG
CTGGTGACCATGAAGATCATGCACGACTGTGTGCAGCTGAGCACTGACAAGGCTGGAGTCGTGGCCGAGTACCCGGCCGAGAAGCTGGCC
TTCAGCGCCGTGTGCCCGGACGACCGGCGATTTTTCGGGTTGGTTACCATGCAGACGAATGACGACGGGAGCCTGGCCCAGGAGGAGGAG
GGCGCCCTGCGGACTTCCTGCCACGTGTTCATGGTGGACCCAGACTTGTTTAATCACAAGATCCACCAAGGCATTGCTCGGCGGTTTGGG
TTTGAGTGCACGGCCGACCCAGACACCAATGGCTGTCTGGAATTCCCGGCGTCCTCCCTCCCCGTCCTGCAGTTCATCTCTGTCCTGTAC
CGAGACATGGGTGAGCTGATTGAGGGCATGCGGGCCCGCGCCTTTCTGGACGGGGACGCCGATGCCCACCAGAACAACAGCACCAGCAGC
AACAGTGACAGCGGCATTGGGAACTTCCACCAGGAGGAGAAGAGCAACCGGGTCCTTGTGGTGGACCTGGGTGGGAGCTCGAGCAGACAC
GGCCCCGGAGGCAGCGCGTGGGACGGTGTGGGTGGGAGGGGTGCCCAGCCCTGGGGTGCTCCCTGGACTGGGCCCTTCTGTCCGGACCCC
GAAGGGAGCCCCCCATTTGAGGCCGCTCATCAGACTGACAGGTTCTGGGACCTAAACAAGCACCTAGGGCCAGCCTCTCCTGTGGAGGTG
CCCCCAGCTTCCTTGAGGAGCTCAGTCCCCCCTTCCAAGAGGGGCACCGTGGGTGCTGGCTGTGGTTTCAACCAGCGCTGGCTCCCGGTC
CACGTGCTCCGGGAGTGGCAGTGCGGACACACCAGCGACCAGGACTCTTACACAGATTCCACCGATGGCTGGTCCAGCATCAACTGCGGC
ACACTGCCCCCTCCTATGAGCAAGATCCCCGCAGACCGCTACAGGGTGGAGGGCAGCTTCGCGCAGCCCCCGCTGAATGCCCCGAAGAGG
GAGTGGTCCAGGAAGGCCTTTGGAATGCAAAGCATTTTTGGTCCCCATCGAAATGTTCGAAAGACTAAGGAAGATAAAAAGGGCGAAGAA
ACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTGGATAACCACGAT
GGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATTCATGACAGGATT
ATTGAGGTCAACGGCAGAGACTTATCCAGAGCAACTCATGACCAGGCTGTGGAAGCTTTCAAGACAGCCAAGGAGCCCATAGTGGTGCAG
GTGTTGAGAAGAACACCAAGGACCAAAATGTTCACGCCTCCATCAGAGTCTCAGCTGGTGGACACGGGAACCCAAACCGACATCACCTTT
GAACATATCATGGCCCTCACTAAGATGTCCTCTCCCAGCCCACCCGTGCTGGATCCCTATCTCTTGCCAGAGGAGCATCCCTCAGCCCAT
GAATACTACGATCCAAATGACTACATTGGAGACATCCATCAGGAGATGGACAGGGAGGAGCTGGAGCTGGAGGAAGTGGACCTCTACAGA
ATGAACAGCCAGGACAAGCTGGGCCTCACTGTGTGCTACCGGACGGACGATGAAGACGACATTGGGATTTATATCAGTGAGATTGACCCT
AACAGCATTGCAGCCAAGGATGGGCGCATCCGAGAAGGAGACCGCATTATCCAGATTAATGGGATAGAGGTGCAGAACCGTGAAGAGGCT
GTGGCTCTTCTAACCAGTGAAGAAAATAAAAACTTTTCATTGCTGATTGCAAGGCCTGAACTCCAGCTGGATGAGGGCTGGATGGATGAT
GACAGGAACGACTTTCTGGATGACCTGCACATGGACATGCTGGAGGAGCAGCACCACCAGGCCATGCAATTCACAGCTAGCGTGCTGCAG
CAGAAGAAGCACGACGAAGACGGTGGGACCACAGATACAGCCACCATCTTGTCCAACCAGCACGAGAAGGACAGCGGTGTGGGGCGGACC
GACGAGAGCACCCGTAATGACGAGAGCTCGGAGCAAGAGAACAATGGCGACGACGCCACCGCATCCTCCAACCCGCTGGCGGGGCAGAGG
AAGCTCACCTGCAGCCAGGACACCTTGGGCAGCGGCGACCTGCCCTTCAGCAACGAGTCTTTCATTTCGGCCGACTGCACGGACGCCGAC
TACCTGGGGATCCCGGTGGACGAGTGCGAGCGCTTCCGCGAGCTCCTGGAGCTCAAGTGCCAGGTGAAGAGCGCCACCCCTTACGGCCTG
TACTACCCTAGCGGCCCCCTGGACGCCGGCAAGAGTGACCCTGAGAGCGTGGACAAGGAGCTGGAGCTGCTGAACGAAGAGCTGCGCAGC
ATCGAGCTGGAGTGCCTGAGCATCGTGCGCGCCCACAAGATGCAGCAGCTCAAGGAGCAGTACCGCGAGTCCTGGATGCTGCACAACAGC
GGCTTCCGCAACTACAACACCAGCATCGACGTGCGCAGACACGAGCTCTCAGATATCACCGAGCTCCCGGAGAAATCCGACAAGGACAGC
TCGAGCGCCTACAACACAGGCGAGAGCTGCCGCAGCACCCCGCTCACCCTGGAGATCTCCCCCGACAACTCCTTGAGGAGAGCGGCGGAG
GGCATCAGCTGCCCGAGCAGCGAAGGGGCTGTGGGGACCACGGAAGCCTACGGGCCAGCCTCCAAGAATCTGCTCTCCATCACGGAAGAT
CCCGAAGTGGGCACCCCTACCTATAGCCCGTCCCTGAAGGAGCTGGACCCCAACCAGCCCCTGGAAAGCAAAGAGCGGAGAGCCAGCGAC
GGGAGCCGGAGCCCCACGCCCAGCCAGAAGCTGGGCAGCGCCTACCTGCCCTCCTATCACCACTCCCCATACAAGCACGCGCACATCCCG
GCGCACGCCCAGCACTACCAGAGCTACATGCAGCTGATCCAGCAGAAGTCGGCCGTGGAGTACGCGCAAAGCCAGATGAGCCTGGTGAGC
ATGTGCAAGGACCTGAGCTCTCCCACCCCGTCGGAGCCGCGCATGGAGTGGAAGGTGAAGATCCGCAGCGACGGGACGCGCTACATCACC
AAGAGGCCCGTGCGGGACCGCCTGCTGCGGGAGCGCGCCCTGAAGATCCGGGAAGAGCGCAGCGGCATGACCACCGACGACGACGCGGTG
AGCGAGATGAAGATGGGGCGCTACTGGAGCAAGGAGGAGAGGAAGCAGCACCTGGTGAAGGCCAAGGAGCAGCGGCGGCGGCGCGAGTTC
ATGATGCAGAGCAGGTTGGATTGTCTCAAGGAGCAGCAAGCAGCCGATGACAGGAAGGAGATGAACATTCTCGAACTGAGCCACAAAAAG
ATGATGAAGAAGAGGAATAAGAAAATCTTCGATAACTGGATGACGATCCAAGAACTCTTAACCCACGGCACAAAATCCCCGGACGGCACT

>In-frame_RGS12_ENST00000336727_chr4_3319778_+_PDZRN3_ENST00000263666_chr3_73657835_-_4359nt
ATGTTTAGAGCTGGGGAGGCCTCCAAACGCCCATTGCCTGGGCCGTCGCCCCCAAGGGTGCGGAGTGTGGAGGTTGCCCGGGGGAGGGCC
GGCTACGGATTCACGCTTTCGGGACAGGCACCCTGTGTGCTCAGCTGCGTCATGAGAGGGAGCCCTGCGGATTTCGTGGGCCTCCGAGCT
GGAGACCAGATACTTGCTGTCAATGAAATCAACGTGAAAAAAGCATCTCATGAAGATGTAGTGAAATTAATTGGGAAGTGCTCTGGTGTC
CTTCACATGGTGATTGCTGAAGGCGTCGGCCGCTTCGAATCCTGTTCCAGTGATGAAGAAGGGGGACTCTATGAAGGAAAAGGCTGGCTG
AAGCCCAAGCTGGATTCTAAAGCACTAGGTATAAACAGAGCAGAGCGAGTCGTGGAGGAAATGCAGTCTGGTGGAATTTTCAATATGATT
TTTGAAAACCCGAGCCTTTGTGCGAGCAATTCAGAGCCCTTGAAATTGAAACAAAGATCCCTTTCAGAGTCGGCCGCAACTCGATTTGAT
GTTGGACATGAAAGTATAAATAATCCAAATCCCAACATGCTTTCTAAGGAGGAAATATCAAAAGTTATTCATGATGATTCGGTTTTCAGC
ATTGGACTAGAAAGTCATGACGATTTTGCATTGGATGCAAGTATTTTAAACGTGGCGATGATCGTGGGCTACTTAGGCTCCATTGAGCTT
CCTTCCACGAGCTCCAACCTGGAGTCCGACAGCTTGCAAGCCATCCGCGGCTGCATGCGGCGCCTGCGGGCAGAGCAGAAAATCCACTCG
CTGGTGACCATGAAGATCATGCACGACTGTGTGCAGCTGAGCACTGACAAGGCTGGAGTCGTGGCCGAGTACCCGGCCGAGAAGCTGGCC
TTCAGCGCCGTGTGCCCGGACGACCGGCGATTTTTCGGGTTGGTTACCATGCAGACGAATGACGACGGGAGCCTGGCCCAGGAGGAGGAG
GGCGCCCTGCGGACTTCCTGCCACGTGTTCATGGTGGACCCAGACTTGTTTAATCACAAGATCCACCAAGGCATTGCTCGGCGGTTTGGG
TTTGAGTGCACGGCCGACCCAGACACCAATGGCTGTCTGGAATTCCCGGCGTCCTCCCTCCCCGTCCTGCAGTTCATCTCTGTCCTGTAC
CGAGACATGGGTGAGCTGATTGAGGGCATGCGGGCCCGCGCCTTTCTGGACGGGGACGCCGATGCCCACCAGAACAACAGCACCAGCAGC
AACAGTGACAGCGGCATTGGGAACTTCCACCAGGAGGAGAAGAGCAACCGGGTCCTTGTGGTGGACCTGGGTGGGAGCTCGAGCAGACAC
GGCCCCGGAGGCAGCGCGTGGGACGGTGTGGGTGGGAGGGGTGCCCAGCCCTGGGGTGCTCCCTGGACTGGGCCCTTCTGTCCGGACCCC
GAAGGGAGCCCCCCATTTGAGGCCGCTCATCAGACTGACAGGTTCTGGGACCTAAACAAGCACCTAGGGCCAGCCTCTCCTGTGGAGGTG
CCCCCAGCTTCCTTGAGGAGCTCAGTCCCCCCTTCCAAGAGGGGCACCGTGGGTGCTGGCTGTGGTTTCAACCAGCGCTGGCTCCCGGTC
CACGTGCTCCGGGAGTGGCAGTGCGGACACACCAGCGACCAGGACTCTTACACAGATTCCACCGATGGCTGGTCCAGCATCAACTGCGGC
ACACTGCCCCCTCCTATGAGCAAGATCCCCGCAGACCGCTACAGGGTGGAGGGCAGCTTCGCGCAGCCCCCGCTGAATGCCCCGAAGAGG
GAGTGGTCCAGGAAGGCCTTTGGAATGCAAAGCATTTTTGGTCCCCATCGAAATGTTCGAAAGACTAAGGAAGATAAAAAGGGCGAAGAA
ACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTGGATAACCACGAT
GGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATTCATGACAGGATT
ATTGAGGTCAACGGCAGAGACTTATCCAGAGCAACTCATGACCAGGCTGTGGAAGCTTTCAAGACAGCCAAGGAGCCCATAGTGGTGCAG
GTGTTGAGAAGAACACCAAGGACCAAAATGTTCACGCCTCCATCAGAGTCTCAGCTGGTGGACACGGGAACCCAAACCGACATCACCTTT
GAACATATCATGGCCCTCACTAAGATGTCCTCTCCCAGCCCACCCGTGCTGGATCCCTATCTCTTGCCAGAGGAGCATCCCTCAGCCCAT
GAATACTACGATCCAAATGACTACATTGGAGACATCCATCAGGAGATGGACAGGGAGGAGCTGGAGCTGGAGGAAGTGGACCTCTACAGA
ATGAACAGCCAGGACAAGCTGGGCCTCACTGTGTGCTACCGGACGGACGATGAAGACGACATTGGGATTTATATCAGTGAGATTGACCCT
AACAGCATTGCAGCCAAGGATGGGCGCATCCGAGAAGGAGACCGCATTATCCAGATTAATGGGATAGAGGTGCAGAACCGTGAAGAGGCT
GTGGCTCTTCTAACCAGTGAAGAAAATAAAAACTTTTCATTGCTGATTGCAAGGCCTGAACTCCAGCTGGATGAGGGCTGGATGGATGAT
GACAGGAACGACTTTCTGGATGACCTGCACATGGACATGCTGGAGGAGCAGCACCACCAGGCCATGCAATTCACAGCTAGCGTGCTGCAG
CAGAAGAAGCACGACGAAGACGGTGGGACCACAGATACAGCCACCATCTTGTCCAACCAGCACGAGAAGGACAGCGGTGTGGGGCGGACC
GACGAGAGCACCCGTAATGACGAGAGCTCGGAGCAAGAGAACAATGGCGACGACGCCACCGCATCCTCCAACCCGCTGGCGGGGCAGAGG
AAGCTCACCTGCAGCCAGGACACCTTGGGCAGCGGCGACCTGCCCTTCAGCAACGAGTCTTTCATTTCGGCCGACTGCACGGACGCCGAC
TACCTGGGGATCCCGGTGGACGAGTGCGAGCGCTTCCGCGAGCTCCTGGAGCTCAAGTGCCAGGTGAAGAGCGCCACCCCTTACGGCCTG
TACTACCCTAGCGGCCCCCTGGACGCCGGCAAGAGTGACCCTGAGAGCGTGGACAAGGAGCTGGAGCTGCTGAACGAAGAGCTGCGCAGC
ATCGAGCTGGAGTGCCTGAGCATCGTGCGCGCCCACAAGATGCAGCAGCTCAAGGAGCAGTACCGCGAGTCCTGGATGCTGCACAACAGC
GGCTTCCGCAACTACAACACCAGCATCGACGTGCGCAGACACGAGCTCTCAGATATCACCGAGCTCCCGGAGAAATCCGACAAGGACAGC
TCGAGCGCCTACAACACAGGCGAGAGCTGCCGCAGCACCCCGCTCACCCTGGAGATCTCCCCCGACAACTCCTTGAGGAGAGCGGCGGAG
GGCATCAGCTGCCCGAGCAGCGAAGGGGCTGTGGGGACCACGGAAGCCTACGGGCCAGCCTCCAAGAATCTGCTCTCCATCACGGAAGAT
CCCGAAGTGGGCACCCCTACCTATAGCCCGTCCCTGAAGGAGCTGGACCCCAACCAGCCCCTGGAAAGCAAAGAGCGGAGAGCCAGCGAC
GGGAGCCGGAGCCCCACGCCCAGCCAGAAGCTGGGCAGCGCCTACCTGCCCTCCTATCACCACTCCCCATACAAGCACGCGCACATCCCG
GCGCACGCCCAGCACTACCAGAGCTACATGCAGCTGATCCAGCAGAAGTCGGCCGTGGAGTACGCGCAAAGCCAGATGAGCCTGGTGAGC
ATGTGCAAGGACCTGAGCTCTCCCACCCCGTCGGAGCCGCGCATGGAGTGGAAGGTGAAGATCCGCAGCGACGGGACGCGCTACATCACC
AAGAGGCCCGTGCGGGACCGCCTGCTGCGGGAGCGCGCCCTGAAGATCCGGGAAGAGCGCAGCGGCATGACCACCGACGACGACGCGGTG
AGCGAGATGAAGATGGGGCGCTACTGGAGCAAGGAGGAGAGGAAGCAGCACCTGGTGAAGGCCAAGGAGCAGCGGCGGCGGCGCGAGTTC
ATGATGCAGAGCAGGTTGGATTGTCTCAAGGAGCAGCAAGCAGCCGATGACAGGAAGGAGATGAACATTCTCGAACTGAGCCACAAAAAG
ATGATGAAGAAGAGGAATAAGAAAATCTTCGATAACTGGATGACGATCCAAGAACTCTTAACCCACGGCACAAAATCCCCGGACGGCACT

>In-frame_RGS12_ENST00000344733_chr4_3319778_+_PDZRN3_ENST00000263666_chr3_73657835_-_4359nt
ATGTTTAGAGCTGGGGAGGCCTCCAAACGCCCATTGCCTGGGCCGTCGCCCCCAAGGGTGCGGAGTGTGGAGGTTGCCCGGGGGAGGGCC
GGCTACGGATTCACGCTTTCGGGACAGGCACCCTGTGTGCTCAGCTGCGTCATGAGAGGGAGCCCTGCGGATTTCGTGGGCCTCCGAGCT
GGAGACCAGATACTTGCTGTCAATGAAATCAACGTGAAAAAAGCATCTCATGAAGATGTAGTGAAATTAATTGGGAAGTGCTCTGGTGTC
CTTCACATGGTGATTGCTGAAGGCGTCGGCCGCTTCGAATCCTGTTCCAGTGATGAAGAAGGGGGACTCTATGAAGGAAAAGGCTGGCTG
AAGCCCAAGCTGGATTCTAAAGCACTAGGTATAAACAGAGCAGAGCGAGTCGTGGAGGAAATGCAGTCTGGTGGAATTTTCAATATGATT
TTTGAAAACCCGAGCCTTTGTGCGAGCAATTCAGAGCCCTTGAAATTGAAACAAAGATCCCTTTCAGAGTCGGCCGCAACTCGATTTGAT
GTTGGACATGAAAGTATAAATAATCCAAATCCCAACATGCTTTCTAAGGAGGAAATATCAAAAGTTATTCATGATGATTCGGTTTTCAGC
ATTGGACTAGAAAGTCATGACGATTTTGCATTGGATGCAAGTATTTTAAACGTGGCGATGATCGTGGGCTACTTAGGCTCCATTGAGCTT
CCTTCCACGAGCTCCAACCTGGAGTCCGACAGCTTGCAAGCCATCCGCGGCTGCATGCGGCGCCTGCGGGCAGAGCAGAAAATCCACTCG
CTGGTGACCATGAAGATCATGCACGACTGTGTGCAGCTGAGCACTGACAAGGCTGGAGTCGTGGCCGAGTACCCGGCCGAGAAGCTGGCC
TTCAGCGCCGTGTGCCCGGACGACCGGCGATTTTTCGGGTTGGTTACCATGCAGACGAATGACGACGGGAGCCTGGCCCAGGAGGAGGAG
GGCGCCCTGCGGACTTCCTGCCACGTGTTCATGGTGGACCCAGACTTGTTTAATCACAAGATCCACCAAGGCATTGCTCGGCGGTTTGGG
TTTGAGTGCACGGCCGACCCAGACACCAATGGCTGTCTGGAATTCCCGGCGTCCTCCCTCCCCGTCCTGCAGTTCATCTCTGTCCTGTAC
CGAGACATGGGTGAGCTGATTGAGGGCATGCGGGCCCGCGCCTTTCTGGACGGGGACGCCGATGCCCACCAGAACAACAGCACCAGCAGC
AACAGTGACAGCGGCATTGGGAACTTCCACCAGGAGGAGAAGAGCAACCGGGTCCTTGTGGTGGACCTGGGTGGGAGCTCGAGCAGACAC
GGCCCCGGAGGCAGCGCGTGGGACGGTGTGGGTGGGAGGGGTGCCCAGCCCTGGGGTGCTCCCTGGACTGGGCCCTTCTGTCCGGACCCC
GAAGGGAGCCCCCCATTTGAGGCCGCTCATCAGACTGACAGGTTCTGGGACCTAAACAAGCACCTAGGGCCAGCCTCTCCTGTGGAGGTG
CCCCCAGCTTCCTTGAGGAGCTCAGTCCCCCCTTCCAAGAGGGGCACCGTGGGTGCTGGCTGTGGTTTCAACCAGCGCTGGCTCCCGGTC
CACGTGCTCCGGGAGTGGCAGTGCGGACACACCAGCGACCAGGACTCTTACACAGATTCCACCGATGGCTGGTCCAGCATCAACTGCGGC
ACACTGCCCCCTCCTATGAGCAAGATCCCCGCAGACCGCTACAGGGTGGAGGGCAGCTTCGCGCAGCCCCCGCTGAATGCCCCGAAGAGG
GAGTGGTCCAGGAAGGCCTTTGGAATGCAAAGCATTTTTGGTCCCCATCGAAATGTTCGAAAGACTAAGGAAGATAAAAAGGGCGAAGAA
ACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTGGATAACCACGAT
GGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATTCATGACAGGATT
ATTGAGGTCAACGGCAGAGACTTATCCAGAGCAACTCATGACCAGGCTGTGGAAGCTTTCAAGACAGCCAAGGAGCCCATAGTGGTGCAG
GTGTTGAGAAGAACACCAAGGACCAAAATGTTCACGCCTCCATCAGAGTCTCAGCTGGTGGACACGGGAACCCAAACCGACATCACCTTT
GAACATATCATGGCCCTCACTAAGATGTCCTCTCCCAGCCCACCCGTGCTGGATCCCTATCTCTTGCCAGAGGAGCATCCCTCAGCCCAT
GAATACTACGATCCAAATGACTACATTGGAGACATCCATCAGGAGATGGACAGGGAGGAGCTGGAGCTGGAGGAAGTGGACCTCTACAGA
ATGAACAGCCAGGACAAGCTGGGCCTCACTGTGTGCTACCGGACGGACGATGAAGACGACATTGGGATTTATATCAGTGAGATTGACCCT
AACAGCATTGCAGCCAAGGATGGGCGCATCCGAGAAGGAGACCGCATTATCCAGATTAATGGGATAGAGGTGCAGAACCGTGAAGAGGCT
GTGGCTCTTCTAACCAGTGAAGAAAATAAAAACTTTTCATTGCTGATTGCAAGGCCTGAACTCCAGCTGGATGAGGGCTGGATGGATGAT
GACAGGAACGACTTTCTGGATGACCTGCACATGGACATGCTGGAGGAGCAGCACCACCAGGCCATGCAATTCACAGCTAGCGTGCTGCAG
CAGAAGAAGCACGACGAAGACGGTGGGACCACAGATACAGCCACCATCTTGTCCAACCAGCACGAGAAGGACAGCGGTGTGGGGCGGACC
GACGAGAGCACCCGTAATGACGAGAGCTCGGAGCAAGAGAACAATGGCGACGACGCCACCGCATCCTCCAACCCGCTGGCGGGGCAGAGG
AAGCTCACCTGCAGCCAGGACACCTTGGGCAGCGGCGACCTGCCCTTCAGCAACGAGTCTTTCATTTCGGCCGACTGCACGGACGCCGAC
TACCTGGGGATCCCGGTGGACGAGTGCGAGCGCTTCCGCGAGCTCCTGGAGCTCAAGTGCCAGGTGAAGAGCGCCACCCCTTACGGCCTG
TACTACCCTAGCGGCCCCCTGGACGCCGGCAAGAGTGACCCTGAGAGCGTGGACAAGGAGCTGGAGCTGCTGAACGAAGAGCTGCGCAGC
ATCGAGCTGGAGTGCCTGAGCATCGTGCGCGCCCACAAGATGCAGCAGCTCAAGGAGCAGTACCGCGAGTCCTGGATGCTGCACAACAGC
GGCTTCCGCAACTACAACACCAGCATCGACGTGCGCAGACACGAGCTCTCAGATATCACCGAGCTCCCGGAGAAATCCGACAAGGACAGC
TCGAGCGCCTACAACACAGGCGAGAGCTGCCGCAGCACCCCGCTCACCCTGGAGATCTCCCCCGACAACTCCTTGAGGAGAGCGGCGGAG
GGCATCAGCTGCCCGAGCAGCGAAGGGGCTGTGGGGACCACGGAAGCCTACGGGCCAGCCTCCAAGAATCTGCTCTCCATCACGGAAGAT
CCCGAAGTGGGCACCCCTACCTATAGCCCGTCCCTGAAGGAGCTGGACCCCAACCAGCCCCTGGAAAGCAAAGAGCGGAGAGCCAGCGAC
GGGAGCCGGAGCCCCACGCCCAGCCAGAAGCTGGGCAGCGCCTACCTGCCCTCCTATCACCACTCCCCATACAAGCACGCGCACATCCCG
GCGCACGCCCAGCACTACCAGAGCTACATGCAGCTGATCCAGCAGAAGTCGGCCGTGGAGTACGCGCAAAGCCAGATGAGCCTGGTGAGC
ATGTGCAAGGACCTGAGCTCTCCCACCCCGTCGGAGCCGCGCATGGAGTGGAAGGTGAAGATCCGCAGCGACGGGACGCGCTACATCACC
AAGAGGCCCGTGCGGGACCGCCTGCTGCGGGAGCGCGCCCTGAAGATCCGGGAAGAGCGCAGCGGCATGACCACCGACGACGACGCGGTG
AGCGAGATGAAGATGGGGCGCTACTGGAGCAAGGAGGAGAGGAAGCAGCACCTGGTGAAGGCCAAGGAGCAGCGGCGGCGGCGCGAGTTC
ATGATGCAGAGCAGGTTGGATTGTCTCAAGGAGCAGCAAGCAGCCGATGACAGGAAGGAGATGAACATTCTCGAACTGAGCCACAAAAAG
ATGATGAAGAAGAGGAATAAGAAAATCTTCGATAACTGGATGACGATCCAAGAACTCTTAACCCACGGCACAAAATCCCCGGACGGCACT

>In-frame_RGS12_ENST00000382788_chr4_3319778_+_PDZRN3_ENST00000263666_chr3_73657835_-_4359nt
ATGTTTAGAGCTGGGGAGGCCTCCAAACGCCCATTGCCTGGGCCGTCGCCCCCAAGGGTGCGGAGTGTGGAGGTTGCCCGGGGGAGGGCC
GGCTACGGATTCACGCTTTCGGGACAGGCACCCTGTGTGCTCAGCTGCGTCATGAGAGGGAGCCCTGCGGATTTCGTGGGCCTCCGAGCT
GGAGACCAGATACTTGCTGTCAATGAAATCAACGTGAAAAAAGCATCTCATGAAGATGTAGTGAAATTAATTGGGAAGTGCTCTGGTGTC
CTTCACATGGTGATTGCTGAAGGCGTCGGCCGCTTCGAATCCTGTTCCAGTGATGAAGAAGGGGGACTCTATGAAGGAAAAGGCTGGCTG
AAGCCCAAGCTGGATTCTAAAGCACTAGGTATAAACAGAGCAGAGCGAGTCGTGGAGGAAATGCAGTCTGGTGGAATTTTCAATATGATT
TTTGAAAACCCGAGCCTTTGTGCGAGCAATTCAGAGCCCTTGAAATTGAAACAAAGATCCCTTTCAGAGTCGGCCGCAACTCGATTTGAT
GTTGGACATGAAAGTATAAATAATCCAAATCCCAACATGCTTTCTAAGGAGGAAATATCAAAAGTTATTCATGATGATTCGGTTTTCAGC
ATTGGACTAGAAAGTCATGACGATTTTGCATTGGATGCAAGTATTTTAAACGTGGCGATGATCGTGGGCTACTTAGGCTCCATTGAGCTT
CCTTCCACGAGCTCCAACCTGGAGTCCGACAGCTTGCAAGCCATCCGCGGCTGCATGCGGCGCCTGCGGGCAGAGCAGAAAATCCACTCG
CTGGTGACCATGAAGATCATGCACGACTGTGTGCAGCTGAGCACTGACAAGGCTGGAGTCGTGGCCGAGTACCCGGCCGAGAAGCTGGCC
TTCAGCGCCGTGTGCCCGGACGACCGGCGATTTTTCGGGTTGGTTACCATGCAGACGAATGACGACGGGAGCCTGGCCCAGGAGGAGGAG
GGCGCCCTGCGGACTTCCTGCCACGTGTTCATGGTGGACCCAGACTTGTTTAATCACAAGATCCACCAAGGCATTGCTCGGCGGTTTGGG
TTTGAGTGCACGGCCGACCCAGACACCAATGGCTGTCTGGAATTCCCGGCGTCCTCCCTCCCCGTCCTGCAGTTCATCTCTGTCCTGTAC
CGAGACATGGGTGAGCTGATTGAGGGCATGCGGGCCCGCGCCTTTCTGGACGGGGACGCCGATGCCCACCAGAACAACAGCACCAGCAGC
AACAGTGACAGCGGCATTGGGAACTTCCACCAGGAGGAGAAGAGCAACCGGGTCCTTGTGGTGGACCTGGGTGGGAGCTCGAGCAGACAC
GGCCCCGGAGGCAGCGCGTGGGACGGTGTGGGTGGGAGGGGTGCCCAGCCCTGGGGTGCTCCCTGGACTGGGCCCTTCTGTCCGGACCCC
GAAGGGAGCCCCCCATTTGAGGCCGCTCATCAGACTGACAGGTTCTGGGACCTAAACAAGCACCTAGGGCCAGCCTCTCCTGTGGAGGTG
CCCCCAGCTTCCTTGAGGAGCTCAGTCCCCCCTTCCAAGAGGGGCACCGTGGGTGCTGGCTGTGGTTTCAACCAGCGCTGGCTCCCGGTC
CACGTGCTCCGGGAGTGGCAGTGCGGACACACCAGCGACCAGGACTCTTACACAGATTCCACCGATGGCTGGTCCAGCATCAACTGCGGC
ACACTGCCCCCTCCTATGAGCAAGATCCCCGCAGACCGCTACAGGGTGGAGGGCAGCTTCGCGCAGCCCCCGCTGAATGCCCCGAAGAGG
GAGTGGTCCAGGAAGGCCTTTGGAATGCAAAGCATTTTTGGTCCCCATCGAAATGTTCGAAAGACTAAGGAAGATAAAAAGGGCGAAGAA
ACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTGGATAACCACGAT
GGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATTCATGACAGGATT
ATTGAGGTCAACGGCAGAGACTTATCCAGAGCAACTCATGACCAGGCTGTGGAAGCTTTCAAGACAGCCAAGGAGCCCATAGTGGTGCAG
GTGTTGAGAAGAACACCAAGGACCAAAATGTTCACGCCTCCATCAGAGTCTCAGCTGGTGGACACGGGAACCCAAACCGACATCACCTTT
GAACATATCATGGCCCTCACTAAGATGTCCTCTCCCAGCCCACCCGTGCTGGATCCCTATCTCTTGCCAGAGGAGCATCCCTCAGCCCAT
GAATACTACGATCCAAATGACTACATTGGAGACATCCATCAGGAGATGGACAGGGAGGAGCTGGAGCTGGAGGAAGTGGACCTCTACAGA
ATGAACAGCCAGGACAAGCTGGGCCTCACTGTGTGCTACCGGACGGACGATGAAGACGACATTGGGATTTATATCAGTGAGATTGACCCT
AACAGCATTGCAGCCAAGGATGGGCGCATCCGAGAAGGAGACCGCATTATCCAGATTAATGGGATAGAGGTGCAGAACCGTGAAGAGGCT
GTGGCTCTTCTAACCAGTGAAGAAAATAAAAACTTTTCATTGCTGATTGCAAGGCCTGAACTCCAGCTGGATGAGGGCTGGATGGATGAT
GACAGGAACGACTTTCTGGATGACCTGCACATGGACATGCTGGAGGAGCAGCACCACCAGGCCATGCAATTCACAGCTAGCGTGCTGCAG
CAGAAGAAGCACGACGAAGACGGTGGGACCACAGATACAGCCACCATCTTGTCCAACCAGCACGAGAAGGACAGCGGTGTGGGGCGGACC
GACGAGAGCACCCGTAATGACGAGAGCTCGGAGCAAGAGAACAATGGCGACGACGCCACCGCATCCTCCAACCCGCTGGCGGGGCAGAGG
AAGCTCACCTGCAGCCAGGACACCTTGGGCAGCGGCGACCTGCCCTTCAGCAACGAGTCTTTCATTTCGGCCGACTGCACGGACGCCGAC
TACCTGGGGATCCCGGTGGACGAGTGCGAGCGCTTCCGCGAGCTCCTGGAGCTCAAGTGCCAGGTGAAGAGCGCCACCCCTTACGGCCTG
TACTACCCTAGCGGCCCCCTGGACGCCGGCAAGAGTGACCCTGAGAGCGTGGACAAGGAGCTGGAGCTGCTGAACGAAGAGCTGCGCAGC
ATCGAGCTGGAGTGCCTGAGCATCGTGCGCGCCCACAAGATGCAGCAGCTCAAGGAGCAGTACCGCGAGTCCTGGATGCTGCACAACAGC
GGCTTCCGCAACTACAACACCAGCATCGACGTGCGCAGACACGAGCTCTCAGATATCACCGAGCTCCCGGAGAAATCCGACAAGGACAGC
TCGAGCGCCTACAACACAGGCGAGAGCTGCCGCAGCACCCCGCTCACCCTGGAGATCTCCCCCGACAACTCCTTGAGGAGAGCGGCGGAG
GGCATCAGCTGCCCGAGCAGCGAAGGGGCTGTGGGGACCACGGAAGCCTACGGGCCAGCCTCCAAGAATCTGCTCTCCATCACGGAAGAT
CCCGAAGTGGGCACCCCTACCTATAGCCCGTCCCTGAAGGAGCTGGACCCCAACCAGCCCCTGGAAAGCAAAGAGCGGAGAGCCAGCGAC
GGGAGCCGGAGCCCCACGCCCAGCCAGAAGCTGGGCAGCGCCTACCTGCCCTCCTATCACCACTCCCCATACAAGCACGCGCACATCCCG
GCGCACGCCCAGCACTACCAGAGCTACATGCAGCTGATCCAGCAGAAGTCGGCCGTGGAGTACGCGCAAAGCCAGATGAGCCTGGTGAGC
ATGTGCAAGGACCTGAGCTCTCCCACCCCGTCGGAGCCGCGCATGGAGTGGAAGGTGAAGATCCGCAGCGACGGGACGCGCTACATCACC
AAGAGGCCCGTGCGGGACCGCCTGCTGCGGGAGCGCGCCCTGAAGATCCGGGAAGAGCGCAGCGGCATGACCACCGACGACGACGCGGTG
AGCGAGATGAAGATGGGGCGCTACTGGAGCAAGGAGGAGAGGAAGCAGCACCTGGTGAAGGCCAAGGAGCAGCGGCGGCGGCGCGAGTTC
ATGATGCAGAGCAGGTTGGATTGTCTCAAGGAGCAGCAAGCAGCCGATGACAGGAAGGAGATGAACATTCTCGAACTGAGCCACAAAAAG
ATGATGAAGAAGAGGAATAAGAAAATCTTCGATAACTGGATGACGATCCAAGAACTCTTAACCCACGGCACAAAATCCCCGGACGGCACT


* Fusion transcript sequences (Full-length transcript).
>In-frame_RGS12_ENST00000543385_chr4_3319778_+_PDZRN3_ENST00000263666_chr3_73657835_-_5447nt
AGGTGTCCTCTGAGGAGAGCTGAGCAGGAGAGGAGCTGGGACTCGGGAATGGCAGGGCACTGTTTGAAGAAGCAAACATGGTAGCATCAA
GCATTCCTTGAAATATGGCTCCAAGGGAACAATGAGACGTGCTCTTGGTCTTGGAAGCTCATCAGAATGTTTAGAGCTGGGGAGGCCTCC
AAACGCCCATTGCCTGGGCCGTCGCCCCCAAGGGTGCGGAGTGTGGAGGTTGCCCGGGGGAGGGCCGGCTACGGATTCACGCTTTCGGGA
CAGGCACCCTGTGTGCTCAGCTGCGTCATGAGAGGGAGCCCTGCGGATTTCGTGGGCCTCCGAGCTGGAGACCAGATACTTGCTGTCAAT
GAAATCAACGTGAAAAAAGCATCTCATGAAGATGTAGTGAAATTAATTGGGAAGTGCTCTGGTGTCCTTCACATGGTGATTGCTGAAGGC
GTCGGCCGCTTCGAATCCTGTTCCAGTGATGAAGAAGGGGGACTCTATGAAGGAAAAGGCTGGCTGAAGCCCAAGCTGGATTCTAAAGCA
CTAGGTATAAACAGAGCAGAGCGAGTCGTGGAGGAAATGCAGTCTGGTGGAATTTTCAATATGATTTTTGAAAACCCGAGCCTTTGTGCG
AGCAATTCAGAGCCCTTGAAATTGAAACAAAGATCCCTTTCAGAGTCGGCCGCAACTCGATTTGATGTTGGACATGAAAGTATAAATAAT
CCAAATCCCAACATGCTTTCTAAGGAGGAAATATCAAAAGTTATTCATGATGATTCGGTTTTCAGCATTGGACTAGAAAGTCATGACGAT
TTTGCATTGGATGCAAGTATTTTAAACGTGGCGATGATCGTGGGCTACTTAGGCTCCATTGAGCTTCCTTCCACGAGCTCCAACCTGGAG
TCCGACAGCTTGCAAGCCATCCGCGGCTGCATGCGGCGCCTGCGGGCAGAGCAGAAAATCCACTCGCTGGTGACCATGAAGATCATGCAC
GACTGTGTGCAGCTGAGCACTGACAAGGCTGGAGTCGTGGCCGAGTACCCGGCCGAGAAGCTGGCCTTCAGCGCCGTGTGCCCGGACGAC
CGGCGATTTTTCGGGTTGGTTACCATGCAGACGAATGACGACGGGAGCCTGGCCCAGGAGGAGGAGGGCGCCCTGCGGACTTCCTGCCAC
GTGTTCATGGTGGACCCAGACTTGTTTAATCACAAGATCCACCAAGGCATTGCTCGGCGGTTTGGGTTTGAGTGCACGGCCGACCCAGAC
ACCAATGGCTGTCTGGAATTCCCGGCGTCCTCCCTCCCCGTCCTGCAGTTCATCTCTGTCCTGTACCGAGACATGGGTGAGCTGATTGAG
GGCATGCGGGCCCGCGCCTTTCTGGACGGGGACGCCGATGCCCACCAGAACAACAGCACCAGCAGCAACAGTGACAGCGGCATTGGGAAC
TTCCACCAGGAGGAGAAGAGCAACCGGGTCCTTGTGGTGGACCTGGGTGGGAGCTCGAGCAGACACGGCCCCGGAGGCAGCGCGTGGGAC
GGTGTGGGTGGGAGGGGTGCCCAGCCCTGGGGTGCTCCCTGGACTGGGCCCTTCTGTCCGGACCCCGAAGGGAGCCCCCCATTTGAGGCC
GCTCATCAGACTGACAGGTTCTGGGACCTAAACAAGCACCTAGGGCCAGCCTCTCCTGTGGAGGTGCCCCCAGCTTCCTTGAGGAGCTCA
GTCCCCCCTTCCAAGAGGGGCACCGTGGGTGCTGGCTGTGGTTTCAACCAGCGCTGGCTCCCGGTCCACGTGCTCCGGGAGTGGCAGTGC
GGACACACCAGCGACCAGGACTCTTACACAGATTCCACCGATGGCTGGTCCAGCATCAACTGCGGCACACTGCCCCCTCCTATGAGCAAG
ATCCCCGCAGACCGCTACAGGGTGGAGGGCAGCTTCGCGCAGCCCCCGCTGAATGCCCCGAAGAGGGAGTGGTCCAGGAAGGCCTTTGGA
ATGCAAAGCATTTTTGGTCCCCATCGAAATGTTCGAAAGACTAAGGAAGATAAAAAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTG
CATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTGGATAACCACGATGGATCATCCAGTGAAGGAATCTTT
GTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATTCATGACAGGATTATTGAGGTCAACGGCAGAGACTTA
TCCAGAGCAACTCATGACCAGGCTGTGGAAGCTTTCAAGACAGCCAAGGAGCCCATAGTGGTGCAGGTGTTGAGAAGAACACCAAGGACC
AAAATGTTCACGCCTCCATCAGAGTCTCAGCTGGTGGACACGGGAACCCAAACCGACATCACCTTTGAACATATCATGGCCCTCACTAAG
ATGTCCTCTCCCAGCCCACCCGTGCTGGATCCCTATCTCTTGCCAGAGGAGCATCCCTCAGCCCATGAATACTACGATCCAAATGACTAC
ATTGGAGACATCCATCAGGAGATGGACAGGGAGGAGCTGGAGCTGGAGGAAGTGGACCTCTACAGAATGAACAGCCAGGACAAGCTGGGC
CTCACTGTGTGCTACCGGACGGACGATGAAGACGACATTGGGATTTATATCAGTGAGATTGACCCTAACAGCATTGCAGCCAAGGATGGG
CGCATCCGAGAAGGAGACCGCATTATCCAGATTAATGGGATAGAGGTGCAGAACCGTGAAGAGGCTGTGGCTCTTCTAACCAGTGAAGAA
AATAAAAACTTTTCATTGCTGATTGCAAGGCCTGAACTCCAGCTGGATGAGGGCTGGATGGATGATGACAGGAACGACTTTCTGGATGAC
CTGCACATGGACATGCTGGAGGAGCAGCACCACCAGGCCATGCAATTCACAGCTAGCGTGCTGCAGCAGAAGAAGCACGACGAAGACGGT
GGGACCACAGATACAGCCACCATCTTGTCCAACCAGCACGAGAAGGACAGCGGTGTGGGGCGGACCGACGAGAGCACCCGTAATGACGAG
AGCTCGGAGCAAGAGAACAATGGCGACGACGCCACCGCATCCTCCAACCCGCTGGCGGGGCAGAGGAAGCTCACCTGCAGCCAGGACACC
TTGGGCAGCGGCGACCTGCCCTTCAGCAACGAGTCTTTCATTTCGGCCGACTGCACGGACGCCGACTACCTGGGGATCCCGGTGGACGAG
TGCGAGCGCTTCCGCGAGCTCCTGGAGCTCAAGTGCCAGGTGAAGAGCGCCACCCCTTACGGCCTGTACTACCCTAGCGGCCCCCTGGAC
GCCGGCAAGAGTGACCCTGAGAGCGTGGACAAGGAGCTGGAGCTGCTGAACGAAGAGCTGCGCAGCATCGAGCTGGAGTGCCTGAGCATC
GTGCGCGCCCACAAGATGCAGCAGCTCAAGGAGCAGTACCGCGAGTCCTGGATGCTGCACAACAGCGGCTTCCGCAACTACAACACCAGC
ATCGACGTGCGCAGACACGAGCTCTCAGATATCACCGAGCTCCCGGAGAAATCCGACAAGGACAGCTCGAGCGCCTACAACACAGGCGAG
AGCTGCCGCAGCACCCCGCTCACCCTGGAGATCTCCCCCGACAACTCCTTGAGGAGAGCGGCGGAGGGCATCAGCTGCCCGAGCAGCGAA
GGGGCTGTGGGGACCACGGAAGCCTACGGGCCAGCCTCCAAGAATCTGCTCTCCATCACGGAAGATCCCGAAGTGGGCACCCCTACCTAT
AGCCCGTCCCTGAAGGAGCTGGACCCCAACCAGCCCCTGGAAAGCAAAGAGCGGAGAGCCAGCGACGGGAGCCGGAGCCCCACGCCCAGC
CAGAAGCTGGGCAGCGCCTACCTGCCCTCCTATCACCACTCCCCATACAAGCACGCGCACATCCCGGCGCACGCCCAGCACTACCAGAGC
TACATGCAGCTGATCCAGCAGAAGTCGGCCGTGGAGTACGCGCAAAGCCAGATGAGCCTGGTGAGCATGTGCAAGGACCTGAGCTCTCCC
ACCCCGTCGGAGCCGCGCATGGAGTGGAAGGTGAAGATCCGCAGCGACGGGACGCGCTACATCACCAAGAGGCCCGTGCGGGACCGCCTG
CTGCGGGAGCGCGCCCTGAAGATCCGGGAAGAGCGCAGCGGCATGACCACCGACGACGACGCGGTGAGCGAGATGAAGATGGGGCGCTAC
TGGAGCAAGGAGGAGAGGAAGCAGCACCTGGTGAAGGCCAAGGAGCAGCGGCGGCGGCGCGAGTTCATGATGCAGAGCAGGTTGGATTGT
CTCAAGGAGCAGCAAGCAGCCGATGACAGGAAGGAGATGAACATTCTCGAACTGAGCCACAAAAAGATGATGAAGAAGAGGAATAAGAAA
ATCTTCGATAACTGGATGACGATCCAAGAACTCTTAACCCACGGCACAAAATCCCCGGACGGCACTAGAGTATACAATTCCTTCCTATCG
GTGACTACTGTATAATTTTCACTTCTGCATTATGTACATAAAGGAGACCACTACCACTGGGGTAGAAATTCCTGCCTCGTTCAATGCGGC
AAGTTTTTGTATATAAGATAAGTACGGTCTTCATGTTTATAGTCCAAATTTGCAAACCCTACAACTCTGGGTGTCATAGGTCTATTTTAA
GGGAAGAGAGAGAAAAACACCCTTACTATCTTGGAAGGCAATATTAACAAACAGAGCTTTTTTCAAATAGCAATTGTACTTTTCTACCTG
TACCCTTTTACATAAAGTGTTTAAATTTCAGAAAGATCTTTTATTAAGCATACTTTCACAGAATAACTTGTTTAAACTATATTCATATAA
AAAAGTTAAACACGCTTTTTTTCCTGCCTAAAACACAAATACAACTGCCAGTATGTATTTTTAATGGAACCCTATTTTATAATGGTACGT
TACTGAATGTGTTTCATATGCGTGACCGTTAAGATATTATCATTTAGGTGAAGGTTTCAACTCAAAACCACCCAACCCGGTGGTTAACGA
TTTAATACATATAACCAAACCGGCAGCGTTTAGAGTTGGGATATACATTTAAACATTTTCCTGGTTAAGGTTCCCAAGAGAGTGTAAAGG
TTTTAGCAGAAAGCAAAATATCTTGCATCTTTATGGAAGTTTAAAGCATGTTTGCAAATATTGCAGCCCATTGAAAGAATTTGCATGTAC
AGGAAAGTTGTGGATGGAGACGGTTTGTGGAATTTTAAGTGCTCATTGTAGTAAACTTTTGCTTTGTAGATTTGAAGGTACAGACTTATA
CAGGCAAGTTCACAAAATCATGATTAGTTACAAACAGTAAAATGAAGTTAAAATAAATTATTATTTTCTATTTGATATGTTTTGATGTGA

>In-frame_RGS12_ENST00000336727_chr4_3319778_+_PDZRN3_ENST00000263666_chr3_73657835_-_6195nt
ATTTATATTCATTTTTTACTCTTTTCCATCAAAACATAATTTTACTAAGTACGCATGTTCTGTGTCCGTGTTTTGTCATCACTGAAGCCA
CTTTTGGAGTCACCTAGTAATAGCCTTTCCACTCTATCTAGTTCTGTAGCTTTTATGTGTGTAAATTACTTCAAATCTGTTTATGATCCT
ATTGCTGGAAACTTTATCCCAAGACACAAAAATCTTTTCTATTAGAAGTTATTAACTTTAAAACAATTATTTATTTTATTTTATTTTATT
TTTTGAGACAGAGTCTCGCTTTGTCACCCAGGCTGGAGTGCAGTGGCACGATCTCGGCTCACTGCAAGCTCCACCTCCCGAGTTCATGCC
ATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGGACTACGGGCGTCCGCCACCATGCCCAGCTAATTTTTTTTGTATTTTTGGTAGAGACAA
GGTTTCACCGTGTTAGCCAGGATGGTCTTGATCTCCTGACCTCGTGGTCCACCTGCCTCGGCCTCCCAAAGCGCTGGGATTATAGGCGTG
AGCCACCGCACCTGGCCTAAAACAATTATTTCTTTAAAAAAACATACCCTCTATTCTATTTTGTGTCTTCACAACACAATCACTTACTGT
ATTGCTTTTTAAAGTGATCTTTAAAGAGTCTTGCAGAAGAGACTACACAGCAGGCCCGAGACCATCCTGAGAGGCCTGTGTGCAAGGCTG
GCCCCCCGCTGGTGTCAGGACGGTGCCCACCACCCTCAATGAAGAGGGGCTCCCTGTGCTTAGCTGCTTGTGTGGGGAACAAGGGCACTG
TTTGAAGAAGCAAACATGGTAGCATCAAGCATTCCTTGAAATATGGCTCCAAGGGAACAATGAGACGTGCTCTTGGTCTTGGAAGCTCAT
CAGAATGTTTAGAGCTGGGGAGGCCTCCAAACGCCCATTGCCTGGGCCGTCGCCCCCAAGGGTGCGGAGTGTGGAGGTTGCCCGGGGGAG
GGCCGGCTACGGATTCACGCTTTCGGGACAGGCACCCTGTGTGCTCAGCTGCGTCATGAGAGGGAGCCCTGCGGATTTCGTGGGCCTCCG
AGCTGGAGACCAGATACTTGCTGTCAATGAAATCAACGTGAAAAAAGCATCTCATGAAGATGTAGTGAAATTAATTGGGAAGTGCTCTGG
TGTCCTTCACATGGTGATTGCTGAAGGCGTCGGCCGCTTCGAATCCTGTTCCAGTGATGAAGAAGGGGGACTCTATGAAGGAAAAGGCTG
GCTGAAGCCCAAGCTGGATTCTAAAGCACTAGGTATAAACAGAGCAGAGCGAGTCGTGGAGGAAATGCAGTCTGGTGGAATTTTCAATAT
GATTTTTGAAAACCCGAGCCTTTGTGCGAGCAATTCAGAGCCCTTGAAATTGAAACAAAGATCCCTTTCAGAGTCGGCCGCAACTCGATT
TGATGTTGGACATGAAAGTATAAATAATCCAAATCCCAACATGCTTTCTAAGGAGGAAATATCAAAAGTTATTCATGATGATTCGGTTTT
CAGCATTGGACTAGAAAGTCATGACGATTTTGCATTGGATGCAAGTATTTTAAACGTGGCGATGATCGTGGGCTACTTAGGCTCCATTGA
GCTTCCTTCCACGAGCTCCAACCTGGAGTCCGACAGCTTGCAAGCCATCCGCGGCTGCATGCGGCGCCTGCGGGCAGAGCAGAAAATCCA
CTCGCTGGTGACCATGAAGATCATGCACGACTGTGTGCAGCTGAGCACTGACAAGGCTGGAGTCGTGGCCGAGTACCCGGCCGAGAAGCT
GGCCTTCAGCGCCGTGTGCCCGGACGACCGGCGATTTTTCGGGTTGGTTACCATGCAGACGAATGACGACGGGAGCCTGGCCCAGGAGGA
GGAGGGCGCCCTGCGGACTTCCTGCCACGTGTTCATGGTGGACCCAGACTTGTTTAATCACAAGATCCACCAAGGCATTGCTCGGCGGTT
TGGGTTTGAGTGCACGGCCGACCCAGACACCAATGGCTGTCTGGAATTCCCGGCGTCCTCCCTCCCCGTCCTGCAGTTCATCTCTGTCCT
GTACCGAGACATGGGTGAGCTGATTGAGGGCATGCGGGCCCGCGCCTTTCTGGACGGGGACGCCGATGCCCACCAGAACAACAGCACCAG
CAGCAACAGTGACAGCGGCATTGGGAACTTCCACCAGGAGGAGAAGAGCAACCGGGTCCTTGTGGTGGACCTGGGTGGGAGCTCGAGCAG
ACACGGCCCCGGAGGCAGCGCGTGGGACGGTGTGGGTGGGAGGGGTGCCCAGCCCTGGGGTGCTCCCTGGACTGGGCCCTTCTGTCCGGA
CCCCGAAGGGAGCCCCCCATTTGAGGCCGCTCATCAGACTGACAGGTTCTGGGACCTAAACAAGCACCTAGGGCCAGCCTCTCCTGTGGA
GGTGCCCCCAGCTTCCTTGAGGAGCTCAGTCCCCCCTTCCAAGAGGGGCACCGTGGGTGCTGGCTGTGGTTTCAACCAGCGCTGGCTCCC
GGTCCACGTGCTCCGGGAGTGGCAGTGCGGACACACCAGCGACCAGGACTCTTACACAGATTCCACCGATGGCTGGTCCAGCATCAACTG
CGGCACACTGCCCCCTCCTATGAGCAAGATCCCCGCAGACCGCTACAGGGTGGAGGGCAGCTTCGCGCAGCCCCCGCTGAATGCCCCGAA
GAGGGAGTGGTCCAGGAAGGCCTTTGGAATGCAAAGCATTTTTGGTCCCCATCGAAATGTTCGAAAGACTAAGGAAGATAAAAAGGGCGA
AGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTGGATAACCA
CGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATTCATGACAG
GATTATTGAGGTCAACGGCAGAGACTTATCCAGAGCAACTCATGACCAGGCTGTGGAAGCTTTCAAGACAGCCAAGGAGCCCATAGTGGT
GCAGGTGTTGAGAAGAACACCAAGGACCAAAATGTTCACGCCTCCATCAGAGTCTCAGCTGGTGGACACGGGAACCCAAACCGACATCAC
CTTTGAACATATCATGGCCCTCACTAAGATGTCCTCTCCCAGCCCACCCGTGCTGGATCCCTATCTCTTGCCAGAGGAGCATCCCTCAGC
CCATGAATACTACGATCCAAATGACTACATTGGAGACATCCATCAGGAGATGGACAGGGAGGAGCTGGAGCTGGAGGAAGTGGACCTCTA
CAGAATGAACAGCCAGGACAAGCTGGGCCTCACTGTGTGCTACCGGACGGACGATGAAGACGACATTGGGATTTATATCAGTGAGATTGA
CCCTAACAGCATTGCAGCCAAGGATGGGCGCATCCGAGAAGGAGACCGCATTATCCAGATTAATGGGATAGAGGTGCAGAACCGTGAAGA
GGCTGTGGCTCTTCTAACCAGTGAAGAAAATAAAAACTTTTCATTGCTGATTGCAAGGCCTGAACTCCAGCTGGATGAGGGCTGGATGGA
TGATGACAGGAACGACTTTCTGGATGACCTGCACATGGACATGCTGGAGGAGCAGCACCACCAGGCCATGCAATTCACAGCTAGCGTGCT
GCAGCAGAAGAAGCACGACGAAGACGGTGGGACCACAGATACAGCCACCATCTTGTCCAACCAGCACGAGAAGGACAGCGGTGTGGGGCG
GACCGACGAGAGCACCCGTAATGACGAGAGCTCGGAGCAAGAGAACAATGGCGACGACGCCACCGCATCCTCCAACCCGCTGGCGGGGCA
GAGGAAGCTCACCTGCAGCCAGGACACCTTGGGCAGCGGCGACCTGCCCTTCAGCAACGAGTCTTTCATTTCGGCCGACTGCACGGACGC
CGACTACCTGGGGATCCCGGTGGACGAGTGCGAGCGCTTCCGCGAGCTCCTGGAGCTCAAGTGCCAGGTGAAGAGCGCCACCCCTTACGG
CCTGTACTACCCTAGCGGCCCCCTGGACGCCGGCAAGAGTGACCCTGAGAGCGTGGACAAGGAGCTGGAGCTGCTGAACGAAGAGCTGCG
CAGCATCGAGCTGGAGTGCCTGAGCATCGTGCGCGCCCACAAGATGCAGCAGCTCAAGGAGCAGTACCGCGAGTCCTGGATGCTGCACAA
CAGCGGCTTCCGCAACTACAACACCAGCATCGACGTGCGCAGACACGAGCTCTCAGATATCACCGAGCTCCCGGAGAAATCCGACAAGGA
CAGCTCGAGCGCCTACAACACAGGCGAGAGCTGCCGCAGCACCCCGCTCACCCTGGAGATCTCCCCCGACAACTCCTTGAGGAGAGCGGC
GGAGGGCATCAGCTGCCCGAGCAGCGAAGGGGCTGTGGGGACCACGGAAGCCTACGGGCCAGCCTCCAAGAATCTGCTCTCCATCACGGA
AGATCCCGAAGTGGGCACCCCTACCTATAGCCCGTCCCTGAAGGAGCTGGACCCCAACCAGCCCCTGGAAAGCAAAGAGCGGAGAGCCAG
CGACGGGAGCCGGAGCCCCACGCCCAGCCAGAAGCTGGGCAGCGCCTACCTGCCCTCCTATCACCACTCCCCATACAAGCACGCGCACAT
CCCGGCGCACGCCCAGCACTACCAGAGCTACATGCAGCTGATCCAGCAGAAGTCGGCCGTGGAGTACGCGCAAAGCCAGATGAGCCTGGT
GAGCATGTGCAAGGACCTGAGCTCTCCCACCCCGTCGGAGCCGCGCATGGAGTGGAAGGTGAAGATCCGCAGCGACGGGACGCGCTACAT
CACCAAGAGGCCCGTGCGGGACCGCCTGCTGCGGGAGCGCGCCCTGAAGATCCGGGAAGAGCGCAGCGGCATGACCACCGACGACGACGC
GGTGAGCGAGATGAAGATGGGGCGCTACTGGAGCAAGGAGGAGAGGAAGCAGCACCTGGTGAAGGCCAAGGAGCAGCGGCGGCGGCGCGA
GTTCATGATGCAGAGCAGGTTGGATTGTCTCAAGGAGCAGCAAGCAGCCGATGACAGGAAGGAGATGAACATTCTCGAACTGAGCCACAA
AAAGATGATGAAGAAGAGGAATAAGAAAATCTTCGATAACTGGATGACGATCCAAGAACTCTTAACCCACGGCACAAAATCCCCGGACGG
CACTAGAGTATACAATTCCTTCCTATCGGTGACTACTGTATAATTTTCACTTCTGCATTATGTACATAAAGGAGACCACTACCACTGGGG
TAGAAATTCCTGCCTCGTTCAATGCGGCAAGTTTTTGTATATAAGATAAGTACGGTCTTCATGTTTATAGTCCAAATTTGCAAACCCTAC
AACTCTGGGTGTCATAGGTCTATTTTAAGGGAAGAGAGAGAAAAACACCCTTACTATCTTGGAAGGCAATATTAACAAACAGAGCTTTTT
TCAAATAGCAATTGTACTTTTCTACCTGTACCCTTTTACATAAAGTGTTTAAATTTCAGAAAGATCTTTTATTAAGCATACTTTCACAGA
ATAACTTGTTTAAACTATATTCATATAAAAAAGTTAAACACGCTTTTTTTCCTGCCTAAAACACAAATACAACTGCCAGTATGTATTTTT
AATGGAACCCTATTTTATAATGGTACGTTACTGAATGTGTTTCATATGCGTGACCGTTAAGATATTATCATTTAGGTGAAGGTTTCAACT
CAAAACCACCCAACCCGGTGGTTAACGATTTAATACATATAACCAAACCGGCAGCGTTTAGAGTTGGGATATACATTTAAACATTTTCCT
GGTTAAGGTTCCCAAGAGAGTGTAAAGGTTTTAGCAGAAAGCAAAATATCTTGCATCTTTATGGAAGTTTAAAGCATGTTTGCAAATATT
GCAGCCCATTGAAAGAATTTGCATGTACAGGAAAGTTGTGGATGGAGACGGTTTGTGGAATTTTAAGTGCTCATTGTAGTAAACTTTTGC
TTTGTAGATTTGAAGGTACAGACTTATACAGGCAAGTTCACAAAATCATGATTAGTTACAAACAGTAAAATGAAGTTAAAATAAATTATT

>In-frame_RGS12_ENST00000344733_chr4_3319778_+_PDZRN3_ENST00000263666_chr3_73657835_-_6195nt
ATTTATATTCATTTTTTACTCTTTTCCATCAAAACATAATTTTACTAAGTACGCATGTTCTGTGTCCGTGTTTTGTCATCACTGAAGCCA
CTTTTGGAGTCACCTAGTAATAGCCTTTCCACTCTATCTAGTTCTGTAGCTTTTATGTGTGTAAATTACTTCAAATCTGTTTATGATCCT
ATTGCTGGAAACTTTATCCCAAGACACAAAAATCTTTTCTATTAGAAGTTATTAACTTTAAAACAATTATTTATTTTATTTTATTTTATT
TTTTGAGACAGAGTCTCGCTTTGTCACCCAGGCTGGAGTGCAGTGGCACGATCTCGGCTCACTGCAAGCTCCACCTCCCGAGTTCATGCC
ATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGGACTACGGGCGTCCGCCACCATGCCCAGCTAATTTTTTTTGTATTTTTGGTAGAGACAA
GGTTTCACCGTGTTAGCCAGGATGGTCTTGATCTCCTGACCTCGTGGTCCACCTGCCTCGGCCTCCCAAAGCGCTGGGATTATAGGCGTG
AGCCACCGCACCTGGCCTAAAACAATTATTTCTTTAAAAAAACATACCCTCTATTCTATTTTGTGTCTTCACAACACAATCACTTACTGT
ATTGCTTTTTAAAGTGATCTTTAAAGAGTCTTGCAGAAGAGACTACACAGCAGGCCCGAGACCATCCTGAGAGGCCTGTGTGCAAGGCTG
GCCCCCCGCTGGTGTCAGGACGGTGCCCACCACCCTCAATGAAGAGGGGCTCCCTGTGCTTAGCTGCTTGTGTGGGGAACAAGGGCACTG
TTTGAAGAAGCAAACATGGTAGCATCAAGCATTCCTTGAAATATGGCTCCAAGGGAACAATGAGACGTGCTCTTGGTCTTGGAAGCTCAT
CAGAATGTTTAGAGCTGGGGAGGCCTCCAAACGCCCATTGCCTGGGCCGTCGCCCCCAAGGGTGCGGAGTGTGGAGGTTGCCCGGGGGAG
GGCCGGCTACGGATTCACGCTTTCGGGACAGGCACCCTGTGTGCTCAGCTGCGTCATGAGAGGGAGCCCTGCGGATTTCGTGGGCCTCCG
AGCTGGAGACCAGATACTTGCTGTCAATGAAATCAACGTGAAAAAAGCATCTCATGAAGATGTAGTGAAATTAATTGGGAAGTGCTCTGG
TGTCCTTCACATGGTGATTGCTGAAGGCGTCGGCCGCTTCGAATCCTGTTCCAGTGATGAAGAAGGGGGACTCTATGAAGGAAAAGGCTG
GCTGAAGCCCAAGCTGGATTCTAAAGCACTAGGTATAAACAGAGCAGAGCGAGTCGTGGAGGAAATGCAGTCTGGTGGAATTTTCAATAT
GATTTTTGAAAACCCGAGCCTTTGTGCGAGCAATTCAGAGCCCTTGAAATTGAAACAAAGATCCCTTTCAGAGTCGGCCGCAACTCGATT
TGATGTTGGACATGAAAGTATAAATAATCCAAATCCCAACATGCTTTCTAAGGAGGAAATATCAAAAGTTATTCATGATGATTCGGTTTT
CAGCATTGGACTAGAAAGTCATGACGATTTTGCATTGGATGCAAGTATTTTAAACGTGGCGATGATCGTGGGCTACTTAGGCTCCATTGA
GCTTCCTTCCACGAGCTCCAACCTGGAGTCCGACAGCTTGCAAGCCATCCGCGGCTGCATGCGGCGCCTGCGGGCAGAGCAGAAAATCCA
CTCGCTGGTGACCATGAAGATCATGCACGACTGTGTGCAGCTGAGCACTGACAAGGCTGGAGTCGTGGCCGAGTACCCGGCCGAGAAGCT
GGCCTTCAGCGCCGTGTGCCCGGACGACCGGCGATTTTTCGGGTTGGTTACCATGCAGACGAATGACGACGGGAGCCTGGCCCAGGAGGA
GGAGGGCGCCCTGCGGACTTCCTGCCACGTGTTCATGGTGGACCCAGACTTGTTTAATCACAAGATCCACCAAGGCATTGCTCGGCGGTT
TGGGTTTGAGTGCACGGCCGACCCAGACACCAATGGCTGTCTGGAATTCCCGGCGTCCTCCCTCCCCGTCCTGCAGTTCATCTCTGTCCT
GTACCGAGACATGGGTGAGCTGATTGAGGGCATGCGGGCCCGCGCCTTTCTGGACGGGGACGCCGATGCCCACCAGAACAACAGCACCAG
CAGCAACAGTGACAGCGGCATTGGGAACTTCCACCAGGAGGAGAAGAGCAACCGGGTCCTTGTGGTGGACCTGGGTGGGAGCTCGAGCAG
ACACGGCCCCGGAGGCAGCGCGTGGGACGGTGTGGGTGGGAGGGGTGCCCAGCCCTGGGGTGCTCCCTGGACTGGGCCCTTCTGTCCGGA
CCCCGAAGGGAGCCCCCCATTTGAGGCCGCTCATCAGACTGACAGGTTCTGGGACCTAAACAAGCACCTAGGGCCAGCCTCTCCTGTGGA
GGTGCCCCCAGCTTCCTTGAGGAGCTCAGTCCCCCCTTCCAAGAGGGGCACCGTGGGTGCTGGCTGTGGTTTCAACCAGCGCTGGCTCCC
GGTCCACGTGCTCCGGGAGTGGCAGTGCGGACACACCAGCGACCAGGACTCTTACACAGATTCCACCGATGGCTGGTCCAGCATCAACTG
CGGCACACTGCCCCCTCCTATGAGCAAGATCCCCGCAGACCGCTACAGGGTGGAGGGCAGCTTCGCGCAGCCCCCGCTGAATGCCCCGAA
GAGGGAGTGGTCCAGGAAGGCCTTTGGAATGCAAAGCATTTTTGGTCCCCATCGAAATGTTCGAAAGACTAAGGAAGATAAAAAGGGCGA
AGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTGGATAACCA
CGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATTCATGACAG
GATTATTGAGGTCAACGGCAGAGACTTATCCAGAGCAACTCATGACCAGGCTGTGGAAGCTTTCAAGACAGCCAAGGAGCCCATAGTGGT
GCAGGTGTTGAGAAGAACACCAAGGACCAAAATGTTCACGCCTCCATCAGAGTCTCAGCTGGTGGACACGGGAACCCAAACCGACATCAC
CTTTGAACATATCATGGCCCTCACTAAGATGTCCTCTCCCAGCCCACCCGTGCTGGATCCCTATCTCTTGCCAGAGGAGCATCCCTCAGC
CCATGAATACTACGATCCAAATGACTACATTGGAGACATCCATCAGGAGATGGACAGGGAGGAGCTGGAGCTGGAGGAAGTGGACCTCTA
CAGAATGAACAGCCAGGACAAGCTGGGCCTCACTGTGTGCTACCGGACGGACGATGAAGACGACATTGGGATTTATATCAGTGAGATTGA
CCCTAACAGCATTGCAGCCAAGGATGGGCGCATCCGAGAAGGAGACCGCATTATCCAGATTAATGGGATAGAGGTGCAGAACCGTGAAGA
GGCTGTGGCTCTTCTAACCAGTGAAGAAAATAAAAACTTTTCATTGCTGATTGCAAGGCCTGAACTCCAGCTGGATGAGGGCTGGATGGA
TGATGACAGGAACGACTTTCTGGATGACCTGCACATGGACATGCTGGAGGAGCAGCACCACCAGGCCATGCAATTCACAGCTAGCGTGCT
GCAGCAGAAGAAGCACGACGAAGACGGTGGGACCACAGATACAGCCACCATCTTGTCCAACCAGCACGAGAAGGACAGCGGTGTGGGGCG
GACCGACGAGAGCACCCGTAATGACGAGAGCTCGGAGCAAGAGAACAATGGCGACGACGCCACCGCATCCTCCAACCCGCTGGCGGGGCA
GAGGAAGCTCACCTGCAGCCAGGACACCTTGGGCAGCGGCGACCTGCCCTTCAGCAACGAGTCTTTCATTTCGGCCGACTGCACGGACGC
CGACTACCTGGGGATCCCGGTGGACGAGTGCGAGCGCTTCCGCGAGCTCCTGGAGCTCAAGTGCCAGGTGAAGAGCGCCACCCCTTACGG
CCTGTACTACCCTAGCGGCCCCCTGGACGCCGGCAAGAGTGACCCTGAGAGCGTGGACAAGGAGCTGGAGCTGCTGAACGAAGAGCTGCG
CAGCATCGAGCTGGAGTGCCTGAGCATCGTGCGCGCCCACAAGATGCAGCAGCTCAAGGAGCAGTACCGCGAGTCCTGGATGCTGCACAA
CAGCGGCTTCCGCAACTACAACACCAGCATCGACGTGCGCAGACACGAGCTCTCAGATATCACCGAGCTCCCGGAGAAATCCGACAAGGA
CAGCTCGAGCGCCTACAACACAGGCGAGAGCTGCCGCAGCACCCCGCTCACCCTGGAGATCTCCCCCGACAACTCCTTGAGGAGAGCGGC
GGAGGGCATCAGCTGCCCGAGCAGCGAAGGGGCTGTGGGGACCACGGAAGCCTACGGGCCAGCCTCCAAGAATCTGCTCTCCATCACGGA
AGATCCCGAAGTGGGCACCCCTACCTATAGCCCGTCCCTGAAGGAGCTGGACCCCAACCAGCCCCTGGAAAGCAAAGAGCGGAGAGCCAG
CGACGGGAGCCGGAGCCCCACGCCCAGCCAGAAGCTGGGCAGCGCCTACCTGCCCTCCTATCACCACTCCCCATACAAGCACGCGCACAT
CCCGGCGCACGCCCAGCACTACCAGAGCTACATGCAGCTGATCCAGCAGAAGTCGGCCGTGGAGTACGCGCAAAGCCAGATGAGCCTGGT
GAGCATGTGCAAGGACCTGAGCTCTCCCACCCCGTCGGAGCCGCGCATGGAGTGGAAGGTGAAGATCCGCAGCGACGGGACGCGCTACAT
CACCAAGAGGCCCGTGCGGGACCGCCTGCTGCGGGAGCGCGCCCTGAAGATCCGGGAAGAGCGCAGCGGCATGACCACCGACGACGACGC
GGTGAGCGAGATGAAGATGGGGCGCTACTGGAGCAAGGAGGAGAGGAAGCAGCACCTGGTGAAGGCCAAGGAGCAGCGGCGGCGGCGCGA
GTTCATGATGCAGAGCAGGTTGGATTGTCTCAAGGAGCAGCAAGCAGCCGATGACAGGAAGGAGATGAACATTCTCGAACTGAGCCACAA
AAAGATGATGAAGAAGAGGAATAAGAAAATCTTCGATAACTGGATGACGATCCAAGAACTCTTAACCCACGGCACAAAATCCCCGGACGG
CACTAGAGTATACAATTCCTTCCTATCGGTGACTACTGTATAATTTTCACTTCTGCATTATGTACATAAAGGAGACCACTACCACTGGGG
TAGAAATTCCTGCCTCGTTCAATGCGGCAAGTTTTTGTATATAAGATAAGTACGGTCTTCATGTTTATAGTCCAAATTTGCAAACCCTAC
AACTCTGGGTGTCATAGGTCTATTTTAAGGGAAGAGAGAGAAAAACACCCTTACTATCTTGGAAGGCAATATTAACAAACAGAGCTTTTT
TCAAATAGCAATTGTACTTTTCTACCTGTACCCTTTTACATAAAGTGTTTAAATTTCAGAAAGATCTTTTATTAAGCATACTTTCACAGA
ATAACTTGTTTAAACTATATTCATATAAAAAAGTTAAACACGCTTTTTTTCCTGCCTAAAACACAAATACAACTGCCAGTATGTATTTTT
AATGGAACCCTATTTTATAATGGTACGTTACTGAATGTGTTTCATATGCGTGACCGTTAAGATATTATCATTTAGGTGAAGGTTTCAACT
CAAAACCACCCAACCCGGTGGTTAACGATTTAATACATATAACCAAACCGGCAGCGTTTAGAGTTGGGATATACATTTAAACATTTTCCT
GGTTAAGGTTCCCAAGAGAGTGTAAAGGTTTTAGCAGAAAGCAAAATATCTTGCATCTTTATGGAAGTTTAAAGCATGTTTGCAAATATT
GCAGCCCATTGAAAGAATTTGCATGTACAGGAAAGTTGTGGATGGAGACGGTTTGTGGAATTTTAAGTGCTCATTGTAGTAAACTTTTGC
TTTGTAGATTTGAAGGTACAGACTTATACAGGCAAGTTCACAAAATCATGATTAGTTACAAACAGTAAAATGAAGTTAAAATAAATTATT

>In-frame_RGS12_ENST00000382788_chr4_3319778_+_PDZRN3_ENST00000263666_chr3_73657835_-_5394nt
AGGGCACTGTTTGAAGAAGCAAACATGGTAGCATCAAGCATTCCTTGAAATATGGCTCCAAGGGAACAATGAGACGTGCTCTTGGTCTTG
GAAGCTCATCAGAATGTTTAGAGCTGGGGAGGCCTCCAAACGCCCATTGCCTGGGCCGTCGCCCCCAAGGGTGCGGAGTGTGGAGGTTGC
CCGGGGGAGGGCCGGCTACGGATTCACGCTTTCGGGACAGGCACCCTGTGTGCTCAGCTGCGTCATGAGAGGGAGCCCTGCGGATTTCGT
GGGCCTCCGAGCTGGAGACCAGATACTTGCTGTCAATGAAATCAACGTGAAAAAAGCATCTCATGAAGATGTAGTGAAATTAATTGGGAA
GTGCTCTGGTGTCCTTCACATGGTGATTGCTGAAGGCGTCGGCCGCTTCGAATCCTGTTCCAGTGATGAAGAAGGGGGACTCTATGAAGG
AAAAGGCTGGCTGAAGCCCAAGCTGGATTCTAAAGCACTAGGTATAAACAGAGCAGAGCGAGTCGTGGAGGAAATGCAGTCTGGTGGAAT
TTTCAATATGATTTTTGAAAACCCGAGCCTTTGTGCGAGCAATTCAGAGCCCTTGAAATTGAAACAAAGATCCCTTTCAGAGTCGGCCGC
AACTCGATTTGATGTTGGACATGAAAGTATAAATAATCCAAATCCCAACATGCTTTCTAAGGAGGAAATATCAAAAGTTATTCATGATGA
TTCGGTTTTCAGCATTGGACTAGAAAGTCATGACGATTTTGCATTGGATGCAAGTATTTTAAACGTGGCGATGATCGTGGGCTACTTAGG
CTCCATTGAGCTTCCTTCCACGAGCTCCAACCTGGAGTCCGACAGCTTGCAAGCCATCCGCGGCTGCATGCGGCGCCTGCGGGCAGAGCA
GAAAATCCACTCGCTGGTGACCATGAAGATCATGCACGACTGTGTGCAGCTGAGCACTGACAAGGCTGGAGTCGTGGCCGAGTACCCGGC
CGAGAAGCTGGCCTTCAGCGCCGTGTGCCCGGACGACCGGCGATTTTTCGGGTTGGTTACCATGCAGACGAATGACGACGGGAGCCTGGC
CCAGGAGGAGGAGGGCGCCCTGCGGACTTCCTGCCACGTGTTCATGGTGGACCCAGACTTGTTTAATCACAAGATCCACCAAGGCATTGC
TCGGCGGTTTGGGTTTGAGTGCACGGCCGACCCAGACACCAATGGCTGTCTGGAATTCCCGGCGTCCTCCCTCCCCGTCCTGCAGTTCAT
CTCTGTCCTGTACCGAGACATGGGTGAGCTGATTGAGGGCATGCGGGCCCGCGCCTTTCTGGACGGGGACGCCGATGCCCACCAGAACAA
CAGCACCAGCAGCAACAGTGACAGCGGCATTGGGAACTTCCACCAGGAGGAGAAGAGCAACCGGGTCCTTGTGGTGGACCTGGGTGGGAG
CTCGAGCAGACACGGCCCCGGAGGCAGCGCGTGGGACGGTGTGGGTGGGAGGGGTGCCCAGCCCTGGGGTGCTCCCTGGACTGGGCCCTT
CTGTCCGGACCCCGAAGGGAGCCCCCCATTTGAGGCCGCTCATCAGACTGACAGGTTCTGGGACCTAAACAAGCACCTAGGGCCAGCCTC
TCCTGTGGAGGTGCCCCCAGCTTCCTTGAGGAGCTCAGTCCCCCCTTCCAAGAGGGGCACCGTGGGTGCTGGCTGTGGTTTCAACCAGCG
CTGGCTCCCGGTCCACGTGCTCCGGGAGTGGCAGTGCGGACACACCAGCGACCAGGACTCTTACACAGATTCCACCGATGGCTGGTCCAG
CATCAACTGCGGCACACTGCCCCCTCCTATGAGCAAGATCCCCGCAGACCGCTACAGGGTGGAGGGCAGCTTCGCGCAGCCCCCGCTGAA
TGCCCCGAAGAGGGAGTGGTCCAGGAAGGCCTTTGGAATGCAAAGCATTTTTGGTCCCCATCGAAATGTTCGAAAGACTAAGGAAGATAA
AAAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGT
GGATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAAT
TCATGACAGGATTATTGAGGTCAACGGCAGAGACTTATCCAGAGCAACTCATGACCAGGCTGTGGAAGCTTTCAAGACAGCCAAGGAGCC
CATAGTGGTGCAGGTGTTGAGAAGAACACCAAGGACCAAAATGTTCACGCCTCCATCAGAGTCTCAGCTGGTGGACACGGGAACCCAAAC
CGACATCACCTTTGAACATATCATGGCCCTCACTAAGATGTCCTCTCCCAGCCCACCCGTGCTGGATCCCTATCTCTTGCCAGAGGAGCA
TCCCTCAGCCCATGAATACTACGATCCAAATGACTACATTGGAGACATCCATCAGGAGATGGACAGGGAGGAGCTGGAGCTGGAGGAAGT
GGACCTCTACAGAATGAACAGCCAGGACAAGCTGGGCCTCACTGTGTGCTACCGGACGGACGATGAAGACGACATTGGGATTTATATCAG
TGAGATTGACCCTAACAGCATTGCAGCCAAGGATGGGCGCATCCGAGAAGGAGACCGCATTATCCAGATTAATGGGATAGAGGTGCAGAA
CCGTGAAGAGGCTGTGGCTCTTCTAACCAGTGAAGAAAATAAAAACTTTTCATTGCTGATTGCAAGGCCTGAACTCCAGCTGGATGAGGG
CTGGATGGATGATGACAGGAACGACTTTCTGGATGACCTGCACATGGACATGCTGGAGGAGCAGCACCACCAGGCCATGCAATTCACAGC
TAGCGTGCTGCAGCAGAAGAAGCACGACGAAGACGGTGGGACCACAGATACAGCCACCATCTTGTCCAACCAGCACGAGAAGGACAGCGG
TGTGGGGCGGACCGACGAGAGCACCCGTAATGACGAGAGCTCGGAGCAAGAGAACAATGGCGACGACGCCACCGCATCCTCCAACCCGCT
GGCGGGGCAGAGGAAGCTCACCTGCAGCCAGGACACCTTGGGCAGCGGCGACCTGCCCTTCAGCAACGAGTCTTTCATTTCGGCCGACTG
CACGGACGCCGACTACCTGGGGATCCCGGTGGACGAGTGCGAGCGCTTCCGCGAGCTCCTGGAGCTCAAGTGCCAGGTGAAGAGCGCCAC
CCCTTACGGCCTGTACTACCCTAGCGGCCCCCTGGACGCCGGCAAGAGTGACCCTGAGAGCGTGGACAAGGAGCTGGAGCTGCTGAACGA
AGAGCTGCGCAGCATCGAGCTGGAGTGCCTGAGCATCGTGCGCGCCCACAAGATGCAGCAGCTCAAGGAGCAGTACCGCGAGTCCTGGAT
GCTGCACAACAGCGGCTTCCGCAACTACAACACCAGCATCGACGTGCGCAGACACGAGCTCTCAGATATCACCGAGCTCCCGGAGAAATC
CGACAAGGACAGCTCGAGCGCCTACAACACAGGCGAGAGCTGCCGCAGCACCCCGCTCACCCTGGAGATCTCCCCCGACAACTCCTTGAG
GAGAGCGGCGGAGGGCATCAGCTGCCCGAGCAGCGAAGGGGCTGTGGGGACCACGGAAGCCTACGGGCCAGCCTCCAAGAATCTGCTCTC
CATCACGGAAGATCCCGAAGTGGGCACCCCTACCTATAGCCCGTCCCTGAAGGAGCTGGACCCCAACCAGCCCCTGGAAAGCAAAGAGCG
GAGAGCCAGCGACGGGAGCCGGAGCCCCACGCCCAGCCAGAAGCTGGGCAGCGCCTACCTGCCCTCCTATCACCACTCCCCATACAAGCA
CGCGCACATCCCGGCGCACGCCCAGCACTACCAGAGCTACATGCAGCTGATCCAGCAGAAGTCGGCCGTGGAGTACGCGCAAAGCCAGAT
GAGCCTGGTGAGCATGTGCAAGGACCTGAGCTCTCCCACCCCGTCGGAGCCGCGCATGGAGTGGAAGGTGAAGATCCGCAGCGACGGGAC
GCGCTACATCACCAAGAGGCCCGTGCGGGACCGCCTGCTGCGGGAGCGCGCCCTGAAGATCCGGGAAGAGCGCAGCGGCATGACCACCGA
CGACGACGCGGTGAGCGAGATGAAGATGGGGCGCTACTGGAGCAAGGAGGAGAGGAAGCAGCACCTGGTGAAGGCCAAGGAGCAGCGGCG
GCGGCGCGAGTTCATGATGCAGAGCAGGTTGGATTGTCTCAAGGAGCAGCAAGCAGCCGATGACAGGAAGGAGATGAACATTCTCGAACT
GAGCCACAAAAAGATGATGAAGAAGAGGAATAAGAAAATCTTCGATAACTGGATGACGATCCAAGAACTCTTAACCCACGGCACAAAATC
CCCGGACGGCACTAGAGTATACAATTCCTTCCTATCGGTGACTACTGTATAATTTTCACTTCTGCATTATGTACATAAAGGAGACCACTA
CCACTGGGGTAGAAATTCCTGCCTCGTTCAATGCGGCAAGTTTTTGTATATAAGATAAGTACGGTCTTCATGTTTATAGTCCAAATTTGC
AAACCCTACAACTCTGGGTGTCATAGGTCTATTTTAAGGGAAGAGAGAGAAAAACACCCTTACTATCTTGGAAGGCAATATTAACAAACA
GAGCTTTTTTCAAATAGCAATTGTACTTTTCTACCTGTACCCTTTTACATAAAGTGTTTAAATTTCAGAAAGATCTTTTATTAAGCATAC
TTTCACAGAATAACTTGTTTAAACTATATTCATATAAAAAAGTTAAACACGCTTTTTTTCCTGCCTAAAACACAAATACAACTGCCAGTA
TGTATTTTTAATGGAACCCTATTTTATAATGGTACGTTACTGAATGTGTTTCATATGCGTGACCGTTAAGATATTATCATTTAGGTGAAG
GTTTCAACTCAAAACCACCCAACCCGGTGGTTAACGATTTAATACATATAACCAAACCGGCAGCGTTTAGAGTTGGGATATACATTTAAA
CATTTTCCTGGTTAAGGTTCCCAAGAGAGTGTAAAGGTTTTAGCAGAAAGCAAAATATCTTGCATCTTTATGGAAGTTTAAAGCATGTTT
GCAAATATTGCAGCCCATTGAAAGAATTTGCATGTACAGGAAAGTTGTGGATGGAGACGGTTTGTGGAATTTTAAGTGCTCATTGTAGTA
AACTTTTGCTTTGTAGATTTGAAGGTACAGACTTATACAGGCAAGTTCACAAAATCATGATTAGTTACAAACAGTAAAATGAAGTTAAAA


Top

FusionGenePPI for RGS12_PDZRN3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RGS12GNAI1, GNAI3, GNAI2, CUL4A, EEF1A1, ARL4C, MTNR1APDZRN3MUSK, UBE2D2, LNX1, LNX2, OIP5, FAM13C, OFD1, SDHA, ZNF785, STX11, POTEB3, FZD4


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RGS12_PDZRN3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RGS12_PDZRN3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRGS12C0036341Schizophrenia1CTD_human
TgenePDZRN3C0023893Liver Cirrhosis, Experimental1CTD_human