FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31098

FusionGeneSummary for RGPD5_NBEA

check button Fusion gene summary
Fusion gene informationFusion gene name: RGPD5_NBEA
Fusion gene ID: 31098
HgeneTgene
Gene symbol

RGPD5

NBEA

Gene ID

84220

26960

Gene nameRANBP2-like and GRIP domain containing 5neurobeachin
SynonymsBS-63|BS63|HEL161|RGP5BCL8B|LYST2
Cytomap

2q13

13q13.3

Type of geneprotein-codingprotein-coding
DescriptionRANBP2-like and GRIP domain-containing protein 5/6RANBP2-like and GRIP domain-containing protein 5epididymis luminal protein 161ran-binding protein 2-like 1ran-binding protein 2-like 1/2ranBP2-like 1ranBP2-like 1/2ranBP2L1sperm membrane protein BSneurobeachinlysosomal-trafficking regulator 2
Modification date2018052320180519
UniProtAcc

Q99666

Q8NFP9

Ensembl transtripts involved in fusion geneENST00000393283, ENST00000272454, 
ENST00000016946, ENST00000495582, 
ENST00000540320, ENST00000400445, 
ENST00000310336, ENST00000379939, 
ENST00000537702, ENST00000379922, 
ENST00000461581, 
Fusion gene scores* DoF score3 X 3 X 2=186 X 6 X 3=108
# samples 36
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(6/108*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RGPD5 [Title/Abstract] AND NBEA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-D8-A27R-01ARGPD5chr2

110565981

+NBEAchr13

36158035

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393283ENST00000540320RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000393283ENST00000400445RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000393283ENST00000310336RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000393283ENST00000379939RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000393283ENST00000537702RGPD5chr2

110565981

+NBEAchr13

36158035

+
5CDS-intronENST00000393283ENST00000379922RGPD5chr2

110565981

+NBEAchr13

36158035

+
5CDS-intronENST00000393283ENST00000461581RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000272454ENST00000540320RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000272454ENST00000400445RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000272454ENST00000310336RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000272454ENST00000379939RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000272454ENST00000537702RGPD5chr2

110565981

+NBEAchr13

36158035

+
5CDS-intronENST00000272454ENST00000379922RGPD5chr2

110565981

+NBEAchr13

36158035

+
5CDS-intronENST00000272454ENST00000461581RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000016946ENST00000540320RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000016946ENST00000400445RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000016946ENST00000310336RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000016946ENST00000379939RGPD5chr2

110565981

+NBEAchr13

36158035

+
In-frameENST00000016946ENST00000537702RGPD5chr2

110565981

+NBEAchr13

36158035

+
5CDS-intronENST00000016946ENST00000379922RGPD5chr2

110565981

+NBEAchr13

36158035

+
5CDS-intronENST00000016946ENST00000461581RGPD5chr2

110565981

+NBEAchr13

36158035

+
intron-3CDSENST00000495582ENST00000540320RGPD5chr2

110565981

+NBEAchr13

36158035

+
intron-3CDSENST00000495582ENST00000400445RGPD5chr2

110565981

+NBEAchr13

36158035

+
intron-3CDSENST00000495582ENST00000310336RGPD5chr2

110565981

+NBEAchr13

36158035

+
intron-3CDSENST00000495582ENST00000379939RGPD5chr2

110565981

+NBEAchr13

36158035

+
intron-3CDSENST00000495582ENST00000537702RGPD5chr2

110565981

+NBEAchr13

36158035

+
intron-intronENST00000495582ENST00000379922RGPD5chr2

110565981

+NBEAchr13

36158035

+
intron-intronENST00000495582ENST00000461581RGPD5chr2

110565981

+NBEAchr13

36158035

+

Top

FusionProtFeatures for RGPD5_NBEA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RGPD5

Q99666

NBEA

Q8NFP9

Binds to type II regulatory subunits of protein kinase Aand anchors/targets them to the membrane. May anchor the kinase tocytoskeletal and/or organelle-associated proteins (By similarity).{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRGPD5chr2:110565981chr13:36158035ENST00000016946+52326_592121766RepeatNote=TPR 1
HgeneRGPD5chr2:110565981chr13:36158035ENST00000016946+52360_932121766RepeatNote=TPR 2
HgeneRGPD5chr2:110565981chr13:36158035ENST00000272454+51926_59212905RepeatNote=TPR 1
HgeneRGPD5chr2:110565981chr13:36158035ENST00000272454+51960_93212905RepeatNote=TPR 2
HgeneRGPD5chr2:110565981chr13:36158035ENST00000393283+62026_59212905RepeatNote=TPR 1
HgeneRGPD5chr2:110565981chr13:36158035ENST00000393283+62060_93212905RepeatNote=TPR 2
TgeneNBEAchr2:110565981chr13:36158035ENST00000379922+0132147_2255-159525DomainBEACH-type PH
TgeneNBEAchr2:110565981chr13:36158035ENST00000379922+0132274_2563-159525DomainBEACH
TgeneNBEAchr2:110565981chr13:36158035ENST00000537702+4182147_2255138740DomainBEACH-type PH
TgeneNBEAchr2:110565981chr13:36158035ENST00000537702+4182274_2563138740DomainBEACH
TgeneNBEAchr2:110565981chr13:36158035ENST00000379922+0131326_1368-159525RepeatWD 1
TgeneNBEAchr2:110565981chr13:36158035ENST00000379922+0132718_2761-159525RepeatWD 2
TgeneNBEAchr2:110565981chr13:36158035ENST00000379922+0132778_2818-159525RepeatWD 3
TgeneNBEAchr2:110565981chr13:36158035ENST00000379922+0132860_2899-159525RepeatWD 4
TgeneNBEAchr2:110565981chr13:36158035ENST00000379922+0132902_2941-159525RepeatWD 5
TgeneNBEAchr2:110565981chr13:36158035ENST00000400445+44582718_276123452947RepeatWD 2
TgeneNBEAchr2:110565981chr13:36158035ENST00000400445+44582778_281823452947RepeatWD 3
TgeneNBEAchr2:110565981chr13:36158035ENST00000400445+44582860_289923452947RepeatWD 4
TgeneNBEAchr2:110565981chr13:36158035ENST00000400445+44582902_294123452947RepeatWD 5
TgeneNBEAchr2:110565981chr13:36158035ENST00000537702+4181326_1368138740RepeatWD 1
TgeneNBEAchr2:110565981chr13:36158035ENST00000537702+4182718_2761138740RepeatWD 2
TgeneNBEAchr2:110565981chr13:36158035ENST00000537702+4182778_2818138740RepeatWD 3
TgeneNBEAchr2:110565981chr13:36158035ENST00000537702+4182860_2899138740RepeatWD 4
TgeneNBEAchr2:110565981chr13:36158035ENST00000537702+4182902_2941138740RepeatWD 5

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRGPD5chr2:110565981chr13:36158035ENST00000016946+5231261_12662121766Compositional biasNote=Poly-Ser
HgeneRGPD5chr2:110565981chr13:36158035ENST00000272454+5191261_1266212905Compositional biasNote=Poly-Ser
HgeneRGPD5chr2:110565981chr13:36158035ENST00000393283+6201261_1266212905Compositional biasNote=Poly-Ser
HgeneRGPD5chr2:110565981chr13:36158035ENST00000016946+5231036_11722121766DomainRanBD1 1
HgeneRGPD5chr2:110565981chr13:36158035ENST00000016946+5231333_14692121766DomainRanBD1 2
HgeneRGPD5chr2:110565981chr13:36158035ENST00000016946+5231702_17522121766DomainGRIP
HgeneRGPD5chr2:110565981chr13:36158035ENST00000272454+5191036_1172212905DomainRanBD1 1
HgeneRGPD5chr2:110565981chr13:36158035ENST00000272454+5191333_1469212905DomainRanBD1 2
HgeneRGPD5chr2:110565981chr13:36158035ENST00000272454+5191702_1752212905DomainGRIP
HgeneRGPD5chr2:110565981chr13:36158035ENST00000393283+6201036_1172212905DomainRanBD1 1
HgeneRGPD5chr2:110565981chr13:36158035ENST00000393283+6201333_1469212905DomainRanBD1 2
HgeneRGPD5chr2:110565981chr13:36158035ENST00000393283+6201702_1752212905DomainGRIP
HgeneRGPD5chr2:110565981chr13:36158035ENST00000016946+523648_6812121766RepeatNote=TPR 3
HgeneRGPD5chr2:110565981chr13:36158035ENST00000272454+519648_681212905RepeatNote=TPR 3
HgeneRGPD5chr2:110565981chr13:36158035ENST00000393283+620648_681212905RepeatNote=TPR 3
TgeneNBEAchr2:110565981chr13:36158035ENST00000400445+44582147_225523452947DomainBEACH-type PH
TgeneNBEAchr2:110565981chr13:36158035ENST00000400445+44582274_256323452947DomainBEACH
TgeneNBEAchr2:110565981chr13:36158035ENST00000400445+44581326_136823452947RepeatWD 1


Top

FusionGeneSequence for RGPD5_NBEA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000540320_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000400445_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000310336_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000379939_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000537702_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000540320_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000400445_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000310336_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000379939_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000537702_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000540320_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000400445_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000310336_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000379939_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000537702_chr13_36158035_+_814aa
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELN
PTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQ
LHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSING
KLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000540320_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000400445_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000310336_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000379939_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000537702_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000540320_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000400445_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000310336_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000379939_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000537702_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000540320_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000400445_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000310336_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000379939_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000537702_chr13_36158035_+_2442nt
ATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTC
TATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAAC
CCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGA
GCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTT
TTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACC
CTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTAC
CATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAAT
GATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAA
CTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAAT
GATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAA
CTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTAT
GAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCT
CAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATG
CAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCC
GCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTG
GATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGAC
CAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGA
GTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATT
GGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAAC
CCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGG
CTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGC
TTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGG
AAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAAT
GGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCC
CATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000540320_chr13_36158035_+_4719nt
ATAAACCCCAGGGCTCATTCTTGAGCTGCTCCTGCATAGATCTCGTCCTGTTCAACACACCAAAGATTGACAGCTGAACTGAGAGACCAT
CACCCACAGACACAACTGGCCACTGGGTGGTGCACAAGTCAGACAGAACTGAATAGTCCTGTGAAGACTCTGGACACTGAACTGACTTTG
GAACCAGACTGCAGAATGGAGGGGTGGGAACTTGTGGCTTGAACCTAATCAGGTTTCATTAAGGTTTTCTATAGATAAGATCATGTCAAG
ACACCCTCAGACCACAGGGCGGCGCCACGAGCCCGGCCGAGTGCAGCTGGAGCGCCGACGTCGCCGAGGATACACAGTGCTGAGGCAGAA
CGCAGGTTCGTCACAGTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACGCCGCTGCTTCAGTGGCTTG
CAGGCACTTTCCTCTTGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAGGTTGGCGGCGCGATGAGGC
GCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTCTATTTTG
CAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCCAAAGCTC
ACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAACCCAACAC
AAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGAGCAGCAA
AACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTTTTTGACT
TGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGATTGAAGG
ATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACCCTTAAGC
CAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATA
ATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAA
AATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTC
CAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTG
ATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATC
AGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCT
CTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGC
TTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGG
ATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGG
TGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAG
CCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTA
TACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATT
CTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGG
ACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACA
GCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTA
TCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCC
CACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTT
TGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAG
TAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACC
AGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGAT
ACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCG
TCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCA
CGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTG
TTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTT
GAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCT
TATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTGCATGTT
CCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAGGGTTGA
ATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAAATTTGC
TCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTTGAAGAC
ACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACTTCCCAG
CACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTTCTCTTT
GGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGAAATTCT
CACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGTACTGAT
CAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATATTGTGT
CGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAACAAGAT
AATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTACTAGTAA
GTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTATTCATC
ACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTGAGATCA
TGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTGTGAGTT

>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000400445_chr13_36158035_+_4719nt
ATAAACCCCAGGGCTCATTCTTGAGCTGCTCCTGCATAGATCTCGTCCTGTTCAACACACCAAAGATTGACAGCTGAACTGAGAGACCAT
CACCCACAGACACAACTGGCCACTGGGTGGTGCACAAGTCAGACAGAACTGAATAGTCCTGTGAAGACTCTGGACACTGAACTGACTTTG
GAACCAGACTGCAGAATGGAGGGGTGGGAACTTGTGGCTTGAACCTAATCAGGTTTCATTAAGGTTTTCTATAGATAAGATCATGTCAAG
ACACCCTCAGACCACAGGGCGGCGCCACGAGCCCGGCCGAGTGCAGCTGGAGCGCCGACGTCGCCGAGGATACACAGTGCTGAGGCAGAA
CGCAGGTTCGTCACAGTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACGCCGCTGCTTCAGTGGCTTG
CAGGCACTTTCCTCTTGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAGGTTGGCGGCGCGATGAGGC
GCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTCTATTTTG
CAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCCAAAGCTC
ACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAACCCAACAC
AAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGAGCAGCAA
AACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTTTTTGACT
TGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGATTGAAGG
ATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACCCTTAAGC
CAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATA
ATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAA
AATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTC
CAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTG
ATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATC
AGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCT
CTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGC
TTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGG
ATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGG
TGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAG
CCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTA
TACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATT
CTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGG
ACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACA
GCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTA
TCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCC
CACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTT
TGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAG
TAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACC
AGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGAT
ACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCG
TCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCA
CGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTG
TTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTT
GAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCT
TATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTGCATGTT
CCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAGGGTTGA
ATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAAATTTGC
TCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTTGAAGAC
ACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACTTCCCAG
CACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTTCTCTTT
GGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGAAATTCT
CACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGTACTGAT
CAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATATTGTGT
CGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAACAAGAT
AATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTACTAGTAA
GTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTATTCATC
ACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTGAGATCA
TGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTGTGAGTT

>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000310336_chr13_36158035_+_4719nt
ATAAACCCCAGGGCTCATTCTTGAGCTGCTCCTGCATAGATCTCGTCCTGTTCAACACACCAAAGATTGACAGCTGAACTGAGAGACCAT
CACCCACAGACACAACTGGCCACTGGGTGGTGCACAAGTCAGACAGAACTGAATAGTCCTGTGAAGACTCTGGACACTGAACTGACTTTG
GAACCAGACTGCAGAATGGAGGGGTGGGAACTTGTGGCTTGAACCTAATCAGGTTTCATTAAGGTTTTCTATAGATAAGATCATGTCAAG
ACACCCTCAGACCACAGGGCGGCGCCACGAGCCCGGCCGAGTGCAGCTGGAGCGCCGACGTCGCCGAGGATACACAGTGCTGAGGCAGAA
CGCAGGTTCGTCACAGTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACGCCGCTGCTTCAGTGGCTTG
CAGGCACTTTCCTCTTGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAGGTTGGCGGCGCGATGAGGC
GCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTCTATTTTG
CAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCCAAAGCTC
ACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAACCCAACAC
AAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGAGCAGCAA
AACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTTTTTGACT
TGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGATTGAAGG
ATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACCCTTAAGC
CAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATA
ATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAA
AATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTC
CAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTG
ATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATC
AGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCT
CTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGC
TTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGG
ATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGG
TGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAG
CCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTA
TACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATT
CTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGG
ACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACA
GCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTA
TCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCC
CACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTT
TGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAG
TAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACC
AGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGAT
ACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCG
TCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCA
CGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTG
TTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTT
GAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCT
TATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTGCATGTT
CCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAGGGTTGA
ATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAAATTTGC
TCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTTGAAGAC
ACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACTTCCCAG
CACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTTCTCTTT
GGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGAAATTCT
CACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGTACTGAT
CAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATATTGTGT
CGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAACAAGAT
AATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTACTAGTAA
GTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTATTCATC
ACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTGAGATCA
TGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTGTGAGTT

>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000379939_chr13_36158035_+_4720nt
ATAAACCCCAGGGCTCATTCTTGAGCTGCTCCTGCATAGATCTCGTCCTGTTCAACACACCAAAGATTGACAGCTGAACTGAGAGACCAT
CACCCACAGACACAACTGGCCACTGGGTGGTGCACAAGTCAGACAGAACTGAATAGTCCTGTGAAGACTCTGGACACTGAACTGACTTTG
GAACCAGACTGCAGAATGGAGGGGTGGGAACTTGTGGCTTGAACCTAATCAGGTTTCATTAAGGTTTTCTATAGATAAGATCATGTCAAG
ACACCCTCAGACCACAGGGCGGCGCCACGAGCCCGGCCGAGTGCAGCTGGAGCGCCGACGTCGCCGAGGATACACAGTGCTGAGGCAGAA
CGCAGGTTCGTCACAGTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACGCCGCTGCTTCAGTGGCTTG
CAGGCACTTTCCTCTTGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAGGTTGGCGGCGCGATGAGGC
GCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTCTATTTTG
CAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCCAAAGCTC
ACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAACCCAACAC
AAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGAGCAGCAA
AACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTTTTTGACT
TGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGATTGAAGG
ATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACCCTTAAGC
CAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATA
ATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAA
AATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTC
CAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTG
ATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATC
AGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCT
CTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGC
TTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGG
ATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGG
TGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAG
CCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTA
TACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATT
CTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGG
ACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACA
GCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTA
TCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCC
CACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTT
TGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAG
TAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACC
AGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGAT
ACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCG
TCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCA
CGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTG
TTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTT
GAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCT
TATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTGCATGTT
CCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAGGGTTGA
ATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAAATTTGC
TCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTTGAAGAC
ACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACTTCCCAG
CACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTTCTCTTT
GGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGAAATTCT
CACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGTACTGAT
CAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATATTGTGT
CGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAACAAGAT
AATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTACTAGTAA
GTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTATTCATC
ACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTGAGATCA
TGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTGTGAGTT

>In-frame_RGPD5_ENST00000393283_chr2_110565981_+_NBEA_ENST00000537702_chr13_36158035_+_3518nt
ATAAACCCCAGGGCTCATTCTTGAGCTGCTCCTGCATAGATCTCGTCCTGTTCAACACACCAAAGATTGACAGCTGAACTGAGAGACCAT
CACCCACAGACACAACTGGCCACTGGGTGGTGCACAAGTCAGACAGAACTGAATAGTCCTGTGAAGACTCTGGACACTGAACTGACTTTG
GAACCAGACTGCAGAATGGAGGGGTGGGAACTTGTGGCTTGAACCTAATCAGGTTTCATTAAGGTTTTCTATAGATAAGATCATGTCAAG
ACACCCTCAGACCACAGGGCGGCGCCACGAGCCCGGCCGAGTGCAGCTGGAGCGCCGACGTCGCCGAGGATACACAGTGCTGAGGCAGAA
CGCAGGTTCGTCACAGTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACGCCGCTGCTTCAGTGGCTTG
CAGGCACTTTCCTCTTGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAGGTTGGCGGCGCGATGAGGC
GCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTCTATTTTG
CAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCCAAAGCTC
ACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAACCCAACAC
AAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGAGCAGCAA
AACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTTTTTGACT
TGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGATTGAAGG
ATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACCCTTAAGC
CAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATA
ATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAA
AATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTC
CAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTG
ATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATC
AGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCT
CTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGC
TTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGG
ATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGG
TGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAG
CCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTA
TACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATT
CTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGG
ACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACA
GCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTA
TCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCC
CACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTT
TGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAG
TAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACC
AGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGAT
ACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCG
TCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCA
CGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTG
TTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTT
GAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCT
TATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTGCATGTT

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000540320_chr13_36158035_+_4378nt
ACACAGTGCTGAGGCAGAACGCAGGTTCGTCACAGTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACG
CCGCTGCTTCAGTGGCTTGCAGGCACTTTCCTCTTGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAG
GTTGGCGGCGCGATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCA
ATGAAAGGATTCTATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAA
GAGAGGGATCCCAAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCA
GTGGAATTAAACCCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATAC
TGGGTCGAAAGAGCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGA
TGGAATAAACTTTTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGC
TCAACTAAAAGATTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGT
GTTGTACAGACCCTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAA
AGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTC
CTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCT
GATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAA
GTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTT
GTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCAC
TACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGA
CAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTT
AAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCAC
TTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCA
GGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACA
GACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGAT
AAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCC
GAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATC
ATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGT
GCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGA
CCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTC
AGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACC
GGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCA
ATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCAT
TATGAGCATCAGAACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATAT
CTCTGGTGGAAAAAACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTT
TACTTTGTGTGTTTTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTA
ATTATTTCATATATTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTT
GTTACAAAGTTTAAGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACT
TTGTACATCAGATGCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTG
GAGTTACAACTTGCATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACA
GCTTGTATGAAAGGGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATC
CCTTCTGAGTGAAATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTA
CCCTGCATAATTTGAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTC
TGTAGTAATAACTTCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGC
TAACTTTTTTTTTCTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTT
TAGGTTCTCGTGAAATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATT
TTCCATACATTGTACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTC
ATAGATGTACATATTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATT
TAAAAAGATAAAACAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTT
ATCCACCTTGTACTAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGT
AATGATTAAGTTATTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGT
TCATTTCATCTTGAGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATA

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000400445_chr13_36158035_+_4378nt
ACACAGTGCTGAGGCAGAACGCAGGTTCGTCACAGTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACG
CCGCTGCTTCAGTGGCTTGCAGGCACTTTCCTCTTGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAG
GTTGGCGGCGCGATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCA
ATGAAAGGATTCTATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAA
GAGAGGGATCCCAAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCA
GTGGAATTAAACCCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATAC
TGGGTCGAAAGAGCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGA
TGGAATAAACTTTTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGC
TCAACTAAAAGATTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGT
GTTGTACAGACCCTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAA
AGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTC
CTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCT
GATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAA
GTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTT
GTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCAC
TACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGA
CAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTT
AAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCAC
TTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCA
GGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACA
GACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGAT
AAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCC
GAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATC
ATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGT
GCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGA
CCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTC
AGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACC
GGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCA
ATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCAT
TATGAGCATCAGAACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATAT
CTCTGGTGGAAAAAACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTT
TACTTTGTGTGTTTTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTA
ATTATTTCATATATTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTT
GTTACAAAGTTTAAGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACT
TTGTACATCAGATGCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTG
GAGTTACAACTTGCATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACA
GCTTGTATGAAAGGGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATC
CCTTCTGAGTGAAATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTA
CCCTGCATAATTTGAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTC
TGTAGTAATAACTTCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGC
TAACTTTTTTTTTCTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTT
TAGGTTCTCGTGAAATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATT
TTCCATACATTGTACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTC
ATAGATGTACATATTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATT
TAAAAAGATAAAACAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTT
ATCCACCTTGTACTAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGT
AATGATTAAGTTATTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGT
TCATTTCATCTTGAGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATA

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000310336_chr13_36158035_+_4378nt
ACACAGTGCTGAGGCAGAACGCAGGTTCGTCACAGTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACG
CCGCTGCTTCAGTGGCTTGCAGGCACTTTCCTCTTGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAG
GTTGGCGGCGCGATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCA
ATGAAAGGATTCTATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAA
GAGAGGGATCCCAAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCA
GTGGAATTAAACCCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATAC
TGGGTCGAAAGAGCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGA
TGGAATAAACTTTTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGC
TCAACTAAAAGATTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGT
GTTGTACAGACCCTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAA
AGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTC
CTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCT
GATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAA
GTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTT
GTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCAC
TACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGA
CAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTT
AAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCAC
TTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCA
GGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACA
GACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGAT
AAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCC
GAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATC
ATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGT
GCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGA
CCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTC
AGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACC
GGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCA
ATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCAT
TATGAGCATCAGAACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATAT
CTCTGGTGGAAAAAACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTT
TACTTTGTGTGTTTTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTA
ATTATTTCATATATTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTT
GTTACAAAGTTTAAGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACT
TTGTACATCAGATGCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTG
GAGTTACAACTTGCATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACA
GCTTGTATGAAAGGGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATC
CCTTCTGAGTGAAATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTA
CCCTGCATAATTTGAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTC
TGTAGTAATAACTTCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGC
TAACTTTTTTTTTCTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTT
TAGGTTCTCGTGAAATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATT
TTCCATACATTGTACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTC
ATAGATGTACATATTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATT
TAAAAAGATAAAACAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTT
ATCCACCTTGTACTAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGT
AATGATTAAGTTATTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGT
TCATTTCATCTTGAGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATA

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000379939_chr13_36158035_+_4379nt
ACACAGTGCTGAGGCAGAACGCAGGTTCGTCACAGTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACG
CCGCTGCTTCAGTGGCTTGCAGGCACTTTCCTCTTGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAG
GTTGGCGGCGCGATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCA
ATGAAAGGATTCTATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAA
GAGAGGGATCCCAAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCA
GTGGAATTAAACCCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATAC
TGGGTCGAAAGAGCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGA
TGGAATAAACTTTTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGC
TCAACTAAAAGATTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGT
GTTGTACAGACCCTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAA
AGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTC
CTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCT
GATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAA
GTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTT
GTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCAC
TACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGA
CAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTT
AAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCAC
TTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCA
GGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACA
GACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGAT
AAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCC
GAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATC
ATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGT
GCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGA
CCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTC
AGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACC
GGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCA
ATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCAT
TATGAGCATCAGAACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATAT
CTCTGGTGGAAAAAACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTT
TACTTTGTGTGTTTTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTA
ATTATTTCATATATTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTT
GTTACAAAGTTTAAGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACT
TTGTACATCAGATGCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTG
GAGTTACAACTTGCATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACA
GCTTGTATGAAAGGGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATC
CCTTCTGAGTGAAATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTA
CCCTGCATAATTTGAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTC
TGTAGTAATAACTTCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGC
TAACTTTTTTTTTCTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTT
TAGGTTCTCGTGAAATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATT
TTCCATACATTGTACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTC
ATAGATGTACATATTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATT
TAAAAAGATAAAACAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTT
ATCCACCTTGTACTAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGT
AATGATTAAGTTATTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGT
TCATTTCATCTTGAGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATA

>In-frame_RGPD5_ENST00000272454_chr2_110565981_+_NBEA_ENST00000537702_chr13_36158035_+_3177nt
ACACAGTGCTGAGGCAGAACGCAGGTTCGTCACAGTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACG
CCGCTGCTTCAGTGGCTTGCAGGCACTTTCCTCTTGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAG
GTTGGCGGCGCGATGAGGCGCAGCAAGGCCGATGTGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCA
ATGAAAGGATTCTATTTTGCAAAGCTGTATTATGAAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAA
GAGAGGGATCCCAAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCA
GTGGAATTAAACCCAACACAAAAAGATCTTGTGTTGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATAC
TGGGTCGAAAGAGCAGCAAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGA
TGGAATAAACTTTTTGACTTGATTCAGTCAGAACTTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGC
TCAACTAAAAGATTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGT
GTTGTACAGACCCTTAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAA
AGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTC
CTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCT
GATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAA
GTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTT
GTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCAC
TACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGA
CAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTT
AAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCAC
TTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCA
GGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACA
GACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGAT
AAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCC
GAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATC
ATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGT
GCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGA
CCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTC
AGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACC
GGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCA
ATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCAT
TATGAGCATCAGAACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATAT
CTCTGGTGGAAAAAACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTT
TACTTTGTGTGTTTTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTA
ATTATTTCATATATTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTT
GTTACAAAGTTTAAGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACT
TTGTACATCAGATGCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTG

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000540320_chr13_36158035_+_4344nt
GTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACGCCGCTGCTTCAGTGGCTTGCAGGCACTTTCCTCT
TGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAGGTTGGCGGCGCGATGAGGCGCAGCAAGGCCGATG
TGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTCTATTTTGCAAAGCTGTATTATG
AAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCCAAAGCTCACAGATTTCTGGGTC
TTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAACCCAACACAAAAAGATCTTGTGT
TGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGAGCAGCAAAACTTTTCCCAGGAA
GTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTTTTTGACTTGATTCAGTCAGAAC
TTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGATTGAAGGATGCTGTGGCCCACT
GCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACCCTTAAGCCAATTGGTGCTTTGA
ACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAA
CAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAG
ATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACC
TACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGG
CAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTA
TATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATA
GTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATC
CGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGC
TGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCA
GCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCA
TTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCAC
ATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGA
AATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGT
CCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGG
CACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAG
AGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTG
TCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGA
TCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGG
CCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCA
CTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGATACTGAAGATAAAGGA
AGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCGTCTACATCGACCTCC
GTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCACGACTGAACACCAGC
TGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTGTTTATTGAGAAAAGG
TTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTTGAACCTAACCTGCAT
CCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCTTATTTAAAAGGGATA
CTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTGCATGTTCCTTACTCCTGTTGG
CTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAGGGTTGAATTTGGGCTCCATCA
GTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAAATTTGCTCATAAAGCATTTGG
ATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTTGAAGACACAGCAGAAAGGGGG
CTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACTTCCCAGCACCTGGACATCTCT
TCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTTCTCTTTGGTTCTTGAATAGCT
TAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGAAATTCTCACTGAAAGCCACAT
TCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGTACTGATCAAGTTATACACCCA
GGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATATTGTGTCGGTAGGGCTATGAG
GCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAACAAGATAATGGGTTCTTTGTA
TTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTACTAGTAAGTTTTAGCACTGAAT
TCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTATTCATCACCAGGCTGTAAGCA
ATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTGAGATCATGGTGAAATATTTTG
GATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTGTGAGTTGGAAATCAAAAAAAG

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000400445_chr13_36158035_+_4344nt
GTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACGCCGCTGCTTCAGTGGCTTGCAGGCACTTTCCTCT
TGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAGGTTGGCGGCGCGATGAGGCGCAGCAAGGCCGATG
TGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTCTATTTTGCAAAGCTGTATTATG
AAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCCAAAGCTCACAGATTTCTGGGTC
TTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAACCCAACACAAAAAGATCTTGTGT
TGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGAGCAGCAAAACTTTTCCCAGGAA
GTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTTTTTGACTTGATTCAGTCAGAAC
TTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGATTGAAGGATGCTGTGGCCCACT
GCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACCCTTAAGCCAATTGGTGCTTTGA
ACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAA
CAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAG
ATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACC
TACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGG
CAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTA
TATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATA
GTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATC
CGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGC
TGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCA
GCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCA
TTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCAC
ATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGA
AATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGT
CCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGG
CACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAG
AGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTG
TCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGA
TCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGG
CCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCA
CTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGATACTGAAGATAAAGGA
AGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCGTCTACATCGACCTCC
GTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCACGACTGAACACCAGC
TGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTGTTTATTGAGAAAAGG
TTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTTGAACCTAACCTGCAT
CCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCTTATTTAAAAGGGATA
CTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTGCATGTTCCTTACTCCTGTTGG
CTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAGGGTTGAATTTGGGCTCCATCA
GTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAAATTTGCTCATAAAGCATTTGG
ATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTTGAAGACACAGCAGAAAGGGGG
CTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACTTCCCAGCACCTGGACATCTCT
TCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTTCTCTTTGGTTCTTGAATAGCT
TAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGAAATTCTCACTGAAAGCCACAT
TCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGTACTGATCAAGTTATACACCCA
GGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATATTGTGTCGGTAGGGCTATGAG
GCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAACAAGATAATGGGTTCTTTGTA
TTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTACTAGTAAGTTTTAGCACTGAAT
TCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTATTCATCACCAGGCTGTAAGCA
ATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTGAGATCATGGTGAAATATTTTG
GATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTGTGAGTTGGAAATCAAAAAAAG

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000310336_chr13_36158035_+_4344nt
GTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACGCCGCTGCTTCAGTGGCTTGCAGGCACTTTCCTCT
TGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAGGTTGGCGGCGCGATGAGGCGCAGCAAGGCCGATG
TGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTCTATTTTGCAAAGCTGTATTATG
AAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCCAAAGCTCACAGATTTCTGGGTC
TTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAACCCAACACAAAAAGATCTTGTGT
TGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGAGCAGCAAAACTTTTCCCAGGAA
GTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTTTTTGACTTGATTCAGTCAGAAC
TTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGATTGAAGGATGCTGTGGCCCACT
GCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACCCTTAAGCCAATTGGTGCTTTGA
ACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAA
CAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAG
ATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACC
TACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGG
CAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTA
TATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATA
GTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATC
CGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGC
TGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCA
GCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCA
TTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCAC
ATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGA
AATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGT
CCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGG
CACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAG
AGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTG
TCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGA
TCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGG
CCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCA
CTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGATACTGAAGATAAAGGA
AGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCGTCTACATCGACCTCC
GTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCACGACTGAACACCAGC
TGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTGTTTATTGAGAAAAGG
TTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTTGAACCTAACCTGCAT
CCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCTTATTTAAAAGGGATA
CTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTGCATGTTCCTTACTCCTGTTGG
CTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAGGGTTGAATTTGGGCTCCATCA
GTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAAATTTGCTCATAAAGCATTTGG
ATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTTGAAGACACAGCAGAAAGGGGG
CTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACTTCCCAGCACCTGGACATCTCT
TCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTTCTCTTTGGTTCTTGAATAGCT
TAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGAAATTCTCACTGAAAGCCACAT
TCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGTACTGATCAAGTTATACACCCA
GGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATATTGTGTCGGTAGGGCTATGAG
GCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAACAAGATAATGGGTTCTTTGTA
TTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTACTAGTAAGTTTTAGCACTGAAT
TCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTATTCATCACCAGGCTGTAAGCA
ATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTGAGATCATGGTGAAATATTTTG
GATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTGTGAGTTGGAAATCAAAAAAAG

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000379939_chr13_36158035_+_4345nt
GTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACGCCGCTGCTTCAGTGGCTTGCAGGCACTTTCCTCT
TGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAGGTTGGCGGCGCGATGAGGCGCAGCAAGGCCGATG
TGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTCTATTTTGCAAAGCTGTATTATG
AAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCCAAAGCTCACAGATTTCTGGGTC
TTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAACCCAACACAAAAAGATCTTGTGT
TGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGAGCAGCAAAACTTTTCCCAGGAA
GTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTTTTTGACTTGATTCAGTCAGAAC
TTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGATTGAAGGATGCTGTGGCCCACT
GCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACCCTTAAGCCAATTGGTGCTTTGA
ACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAA
CAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAG
ATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACC
TACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGG
CAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTA
TATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATA
GTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATC
CGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGC
TGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCA
GCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCA
TTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCAC
ATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGA
AATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGT
CCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGG
CACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAG
AGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTG
TCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGA
TCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGG
CCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCA
CTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGATACTGAAGATAAAGGA
AGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCGTCTACATCGACCTCC
GTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCACGACTGAACACCAGC
TGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTGTTTATTGAGAAAAGG
TTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTTGAACCTAACCTGCAT
CCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCTTATTTAAAAGGGATA
CTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTGCATGTTCCTTACTCCTGTTGG
CTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAGGGTTGAATTTGGGCTCCATCA
GTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAAATTTGCTCATAAAGCATTTGG
ATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTTGAAGACACAGCAGAAAGGGGG
CTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACTTCCCAGCACCTGGACATCTCT
TCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTTCTCTTTGGTTCTTGAATAGCT
TAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGAAATTCTCACTGAAAGCCACAT
TCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGTACTGATCAAGTTATACACCCA
GGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATATTGTGTCGGTAGGGCTATGAG
GCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAACAAGATAATGGGTTCTTTGTA
TTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTACTAGTAAGTTTTAGCACTGAAT
TCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTATTCATCACCAGGCTGTAAGCA
ATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTGAGATCATGGTGAAATATTTTG
GATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTGTGAGTTGGAAATCAAAAAAAG

>In-frame_RGPD5_ENST00000016946_chr2_110565981_+_NBEA_ENST00000537702_chr13_36158035_+_3143nt
GTGGGCCTCCGTGGGCGGCGCCGCACGCTCGTCACAGTGGGCCTCCGCCGGCTACGCCGCTGCTTCAGTGGCTTGCAGGCACTTTCCTCT
TGGAAGTGGCGACTGCTGCGGGGCTGAGCGGTGCTCGCACGCGTCTCGGGAGCCAGGTTGGCGGCGCGATGAGGCGCAGCAAGGCCGATG
TGGAGCGGTACGTCGCCTCGGTGCTGGGTCTCACCCCGTCGCCTCGACAGAAGTCAATGAAAGGATTCTATTTTGCAAAGCTGTATTATG
AAGCTAAAGAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCCAAAGCTCACAGATTTCTGGGTC
TTCTTTATGAATTGGAAGAAAACACAGAGAAAGCCGTTGAATGTTACAGGCGTTCAGTGGAATTAAACCCAACACAAAAAGATCTTGTGT
TGAAGATTGCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGGTCGAAAGAGCAGCAAAACTTTTCCCAGGAA
GTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGATTGTGAAGGTGAAGATGGATGGAATAAACTTTTTGACTTGATTCAGTCAGAAC
TTTATGTAAGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGTTGTATCGCTCAACTAAAAGATTGAAGGATGCTGTGGCCCACT
GCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGTTTAGAGTGGAATTCGTGTGTTGTACAGACCCTTAAGCCAATTGGTGCTTTGA
ACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAA
CAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAG
ATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACC
TACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGG
CAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTA
TATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATA
GTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATC
CGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGC
TGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCA
GCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCA
TTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCAC
ATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGA
AATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGT
CCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGG
CACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAG
AGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTG
TCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGA
TCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGG
CCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCA
CTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGATACTGAAGATAAAGGA
AGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCGTCTACATCGACCTCC
GTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCACGACTGAACACCAGC
TGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTGTTTATTGAGAAAAGG
TTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTTGAACCTAACCTGCAT
CCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCTTATTTAAAAGGGATA


Top

FusionGenePPI for RGPD5_NBEA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RGPD5TNPO1, USP14, USP20, RAN, COMTD1, MLF1, TSNAX, CCDC74B, FKBP6, PSMD7, UCHL5, SDF4, NR2E1, RCC1, CLEC11A, CCDC151, VPS28, ZBTB46, RANGAP1, MCM2, B2M, ESRP1, TMEM194A, PSMC5, TRAF3IP3, FAM136A, AKIRIN2, TSKS, CTAGE5, NXF2, NCAPH2, CPNE4, ABI2, EXOC3, NXF1, KPNA2, CCDC136, SIRT6, TRIM25NBEASTRN4, DTNBP1, NOTCH1, VCP, FOSL2, RD3, TMEM17, PTPRH, ALOXE3, SHC4, RBM48, MRPL21, NAB2, STRADB


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RGPD5_NBEA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RGPD5_NBEA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneNBEAC0004352Autistic Disorder2CTD_human
TgeneNBEAC0023893Liver Cirrhosis, Experimental1CTD_human