FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30946

FusionGeneSummary for REL_MVP

check button Fusion gene summary
Fusion gene informationFusion gene name: REL_MVP
Fusion gene ID: 30946
HgeneTgene
Gene symbol

REL

MVP

Gene ID

5966

9961

Gene nameREL proto-oncogene, NF-kB subunitmajor vault protein
SynonymsC-RelLRP|VAULT1
Cytomap

2p16.1

16p11.2

Type of geneprotein-codingprotein-coding
Descriptionproto-oncogene c-Reloncogene REL, avian reticuloendotheliosisv-rel avian reticuloendotheliosis viral oncogene homologmajor vault proteinlung resistance-related proteintesticular secretory protein Li 30
Modification date2018052320180523
UniProtAcc

Q04864

Q14764

Ensembl transtripts involved in fusion geneENST00000295025, ENST00000394479, 
ENST00000357402, ENST00000452209, 
ENST00000395353, ENST00000566554, 
Fusion gene scores* DoF score5 X 5 X 4=1002 X 2 X 2=8
# samples 52
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: REL [Title/Abstract] AND MVP [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneREL

GO:0010629

negative regulation of gene expression

22065573

HgeneREL

GO:0032688

negative regulation of interferon-beta production

22065573

HgeneREL

GO:0045944

positive regulation of transcription by RNA polymerase II

1406630

TgeneMVP

GO:0023057

negative regulation of signaling

16441665

TgeneMVP

GO:0031953

negative regulation of protein autophosphorylation

16441665

TgeneMVP

GO:0038127

ERBB signaling pathway

15133037

TgeneMVP

GO:0061099

negative regulation of protein tyrosine kinase activity

16441665


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-49-6743-01ARELchr2

61144152

+MVPchr16

29847025

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000295025ENST00000357402RELchr2

61144152

+MVPchr16

29847025

+
5CDS-intronENST00000295025ENST00000452209RELchr2

61144152

+MVPchr16

29847025

+
5CDS-intronENST00000295025ENST00000395353RELchr2

61144152

+MVPchr16

29847025

+
5CDS-intronENST00000295025ENST00000566554RELchr2

61144152

+MVPchr16

29847025

+
In-frameENST00000394479ENST00000357402RELchr2

61144152

+MVPchr16

29847025

+
5CDS-intronENST00000394479ENST00000452209RELchr2

61144152

+MVPchr16

29847025

+
5CDS-intronENST00000394479ENST00000395353RELchr2

61144152

+MVPchr16

29847025

+
5CDS-intronENST00000394479ENST00000566554RELchr2

61144152

+MVPchr16

29847025

+

Top

FusionProtFeatures for REL_MVP


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
REL

Q04864

MVP

Q14764

Proto-oncogene that may play a role in differentiationand lymphopoiesis. NF-kappa-B is a pleiotropic transcriptionfactor which is present in almost all cell types and is involvedin many biological processed such as inflammation, immunity,differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-likedomain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50,REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA oftheir target genes and the individual dimers have distinctpreferences for different kappa-B sites that they can bind withdistinguishable affinity and specificity. Different dimercombinations act as transcriptional activators or repressors,respectively. NF-kappa-B is controlled by various mechanisms ofpost-translational modification and subcellularcompartmentalization as well as by interactions with othercofactors or corepressors. NF-kappa-B complexes are held in thecytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activationpathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs)in response to different activators, subsequently degraded thusliberating the active NF-kappa-B complex which translocates to thenucleus. The NF-kappa-B heterodimer RELA/p65-c-Rel is atranscriptional activator. Required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involvedin signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. Down-regulates IFNG-mediated STAT1signaling and subsequent activation of JAK. Down-regulates SRCactivity and signaling through MAP kinases.{ECO:0000269|PubMed:15133037, ECO:0000269|PubMed:16418217,ECO:0000269|PubMed:16441665}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMVPchr2:61144152chr16:29847025ENST00000357402+415218_272192894RepeatNote=MVP 5
TgeneMVPchr2:61144152chr16:29847025ENST00000357402+415273_323192894RepeatNote=MVP 6
TgeneMVPchr2:61144152chr16:29847025ENST00000357402+415324_379192894RepeatNote=MVP 7
TgeneMVPchr2:61144152chr16:29847025ENST00000357402+415380_457192894RepeatNote=MVP 8
TgeneMVPchr2:61144152chr16:29847025ENST00000357402+415458_520192894RepeatNote=MVP 9
TgeneMVPchr2:61144152chr16:29847025ENST00000395353+415218_272192894RepeatNote=MVP 5
TgeneMVPchr2:61144152chr16:29847025ENST00000395353+415273_323192894RepeatNote=MVP 6
TgeneMVPchr2:61144152chr16:29847025ENST00000395353+415324_379192894RepeatNote=MVP 7
TgeneMVPchr2:61144152chr16:29847025ENST00000395353+415380_457192894RepeatNote=MVP 8
TgeneMVPchr2:61144152chr16:29847025ENST00000395353+415458_520192894RepeatNote=MVP 9

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRELchr2:61144152chr16:29847025ENST00000295025+5118_297178620DomainRHD
HgeneRELchr2:61144152chr16:29847025ENST00000295025+511290_295178620MotifNuclear localization signal
TgeneMVPchr2:61144152chr16:29847025ENST00000357402+415112_164192894RepeatNote=MVP 3
TgeneMVPchr2:61144152chr16:29847025ENST00000357402+415165_217192894RepeatNote=MVP 4
TgeneMVPchr2:61144152chr16:29847025ENST00000357402+4152_56192894RepeatNote=MVP 1
TgeneMVPchr2:61144152chr16:29847025ENST00000357402+41557_111192894RepeatNote=MVP 2
TgeneMVPchr2:61144152chr16:29847025ENST00000395353+415112_164192894RepeatNote=MVP 3
TgeneMVPchr2:61144152chr16:29847025ENST00000395353+415165_217192894RepeatNote=MVP 4
TgeneMVPchr2:61144152chr16:29847025ENST00000395353+4152_56192894RepeatNote=MVP 1
TgeneMVPchr2:61144152chr16:29847025ENST00000395353+41557_111192894RepeatNote=MVP 2


Top

FusionGeneSequence for REL_MVP


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_REL_ENST00000295025_chr2_61144152_+_MVP_ENST00000357402_chr16_29847025_+_880aa
MASGATNPTIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNTTGKGKVRITLVTKNDPTKPHPHDLVGKDCRDGYTE
AEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPITDNRE
EWLVTTVGAYLPAVFEEVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVI
LDPVGPDGKNQLGQKRVVKGEKSFFLQPGEQLEQGIQDVTVLSEQQGLLLRALQPLEEGEDEEKVSHQAGDHWLIRGPLETVPSAKVEVV
EERQAIPLDENEGITVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLADRGEKDTAKSLQPLAPRNKTRVVSYRVPH
NAAVQVYDYREKRARVVFGPELVSLGPEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFEVNDRKD
PQETAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIRTAVFGFETSEAKGPDGMALPRPRDQAVFPQNGLVVSSVDVQSVE
PVDQRTRDALQRSVQLAIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAEKARKELLELEALSMAVESTGTAKAEAESRAEAAR
IEGEGSVLQAKLKAQALAIETEAELQRVQKVRELELVTARAQLELEVSKAQQLAEVEVKKFKQMTEAIGPSTIRDLAVAGPEMQVKLLQS

>In-frame_REL_ENST00000394479_chr2_61144152_+_MVP_ENST00000357402_chr16_29847025_+_880aa
MASGATNPTIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNTTGKGKVRITLVTKNDPTKPHPHDLVGKDCRDGYTE
AEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPITDNRE
EWLVTTVGAYLPAVFEEVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVI
LDPVGPDGKNQLGQKRVVKGEKSFFLQPGEQLEQGIQDVTVLSEQQGLLLRALQPLEEGEDEEKVSHQAGDHWLIRGPLETVPSAKVEVV
EERQAIPLDENEGITVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLADRGEKDTAKSLQPLAPRNKTRVVSYRVPH
NAAVQVYDYREKRARVVFGPELVSLGPEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFEVNDRKD
PQETAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIRTAVFGFETSEAKGPDGMALPRPRDQAVFPQNGLVVSSVDVQSVE
PVDQRTRDALQRSVQLAIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAEKARKELLELEALSMAVESTGTAKAEAESRAEAAR
IEGEGSVLQAKLKAQALAIETEAELQRVQKVRELELVTARAQLELEVSKAQQLAEVEVKKFKQMTEAIGPSTIRDLAVAGPEMQVKLLQS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_REL_ENST00000295025_chr2_61144152_+_MVP_ENST00000357402_chr16_29847025_+_2640nt
ATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGA
TCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAA
GTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAA
GCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATT
ACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTG
TGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGGGAA
GAATGGCTGGTCACCACAGTAGGGGCGTACCTCCCAGCGGTGTTTGAGGAGGTTCTGGATTTGGTGGACGCCGTCATCCTTACGGAAAAG
ACAGCCCTGCACCTCCGGGCTCGGCGGAACTTCCGGGACTTCAGGGGAGTGTCCCGCCGCACTGGGGAGGAGTGGCTGGTAACAGTGCAG
GACACAGAGGCCCACGTGCCAGATGTCCACGAGGAGGTGCTGGGGGTTGTGCCCATCACCACCCTGGGCCCCCACAACTACTGCGTGATT
CTCGACCCTGTCGGACCGGATGGCAAGAATCAGCTGGGGCAGAAGCGCGTGGTCAAGGGAGAGAAGTCTTTTTTCCTCCAGCCAGGAGAG
CAGCTGGAACAAGGCATCCAGGATGTGTATGTGCTGTCGGAGCAGCAGGGGCTGCTGCTGAGGGCCCTGCAGCCCCTGGAGGAGGGGGAG
GATGAGGAGAAGGTCTCACACCAGGCTGGGGACCACTGGCTCATCCGCGGACCCCTGGAGTATGTGCCATCTGCCAAAGTGGAGGTGGTG
GAGGAGCGCCAGGCCATCCCTCTAGACGAGAACGAGGGCATCTATGTGCAGGATGTCAAGACCGGAAAGGTGCGCGCTGTGATTGGAAGC
ACCTACATGCTGACCCAGGACGAAGTCCTGTGGGAGAAAGAGCTGCCTCCCGGGGTGGAGGAGCTGCTGAACAAGGGGCAGGACCCTCTG
GCAGACAGGGGTGAGAAGGACACAGCTAAGAGCCTCCAGCCCTTGGCGCCCCGGAACAAGACCCGTGTGGTCAGCTACCGCGTGCCCCAC
AACGCTGCGGTGCAGGTGTACGACTACCGAGAGAAGCGAGCCCGCGTGGTCTTCGGGCCTGAGCTGGTGTCGCTGGGTCCTGAGGAGCAG
TTCACAGTGTTGTCCCTCTCAGCTGGGCGGCCCAAGCGTCCCCATGCCCGCCGTGCGCTCTGCCTGCTGCTGGGGCCTGACTTCTTCACA
GACGTCATCACCATCGAAACGGCGGATCATGCCAGGCTGCAACTGCAGCTGGCCTACAACTGGCACTTTGAGGTGAATGACCGGAAGGAC
CCCCAAGAGACGGCCAAGCTCTTTTCAGTGCCAGACTTTGTAGGTGATGCCTGCAAAGCCATCGCATCCCGGGTGCGGGGGGCCGTGGCC
TCTGTCACTTTCGATGACTTCCATAAGAACTCAGCCCGCATCATTCGCACTGCTGTCTTTGGCTTTGAGACCTCGGAAGCGAAGGGCCCC
GATGGCATGGCCCTGCCCAGGCCCCGGGACCAGGCTGTCTTCCCCCAAAACGGGCTGGTGGTCAGCAGTGTGGACGTGCAGTCAGTGGAG
CCTGTGGATCAGAGGACCCGGGACGCCCTGCAACGCAGCGTCCAGCTGGCCATCGAGATCACCACCAACTCCCAGGAAGCGGCGGCCAAG
CATGAGGCTCAGAGACTGGAGCAGGAAGCCCGCGGCCGGCTTGAGCGGCAGAAGATCCTGGACCAGTCAGAAGCCGAGAAAGCTCGCAAG
GAACTTTTGGAGCTGGAGGCTCTGAGCATGGCCGTGGAGAGCACCGGGACTGCCAAGGCGGAGGCCGAGTCCCGTGCGGAGGCAGCCCGG
ATTGAGGGAGAAGGGTCCGTGCTGCAGGCCAAGCTAAAAGCACAGGCCTTGGCCATTGAAACGGAGGCTGAGCTCCAGAGGGTCCAGAAG
GTCCGAGAGCTGGAACTGGTCTATGCCCGGGCCCAGCTGGAGCTGGAGGTGAGCAAGGCTCAGCAGCTGGCTGAGGTGGAGGTGAAGAAG
TTCAAGCAGATGACAGAGGCCATAGGCCCCAGCACCATCAGGGACCTTGCTGTGGCTGGGCCTGAGATGCAGGTAAAACTGCTCCAGTCC
CTGGGCCTGAAATCAACCCTCATCACCGATGGCTCCACTCCCATCAACCTCTTCAACACAGCCTTTGGGCTGCTGGGGATGGGGCCCGAG
GGTCAGCCCCTGGGCAGAAGGGTGGCCAGTGGGCCCAGCCCTGGGGAGGGGATATCCCCCCAGTCTGCTCAGGCCCCTCAAGCTCCTGGA

>In-frame_REL_ENST00000394479_chr2_61144152_+_MVP_ENST00000357402_chr16_29847025_+_2640nt
ATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGA
TCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAA
GTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAA
GCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATT
ACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTG
TGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGGGAA
GAATGGCTGGTCACCACAGTAGGGGCGTACCTCCCAGCGGTGTTTGAGGAGGTTCTGGATTTGGTGGACGCCGTCATCCTTACGGAAAAG
ACAGCCCTGCACCTCCGGGCTCGGCGGAACTTCCGGGACTTCAGGGGAGTGTCCCGCCGCACTGGGGAGGAGTGGCTGGTAACAGTGCAG
GACACAGAGGCCCACGTGCCAGATGTCCACGAGGAGGTGCTGGGGGTTGTGCCCATCACCACCCTGGGCCCCCACAACTACTGCGTGATT
CTCGACCCTGTCGGACCGGATGGCAAGAATCAGCTGGGGCAGAAGCGCGTGGTCAAGGGAGAGAAGTCTTTTTTCCTCCAGCCAGGAGAG
CAGCTGGAACAAGGCATCCAGGATGTGTATGTGCTGTCGGAGCAGCAGGGGCTGCTGCTGAGGGCCCTGCAGCCCCTGGAGGAGGGGGAG
GATGAGGAGAAGGTCTCACACCAGGCTGGGGACCACTGGCTCATCCGCGGACCCCTGGAGTATGTGCCATCTGCCAAAGTGGAGGTGGTG
GAGGAGCGCCAGGCCATCCCTCTAGACGAGAACGAGGGCATCTATGTGCAGGATGTCAAGACCGGAAAGGTGCGCGCTGTGATTGGAAGC
ACCTACATGCTGACCCAGGACGAAGTCCTGTGGGAGAAAGAGCTGCCTCCCGGGGTGGAGGAGCTGCTGAACAAGGGGCAGGACCCTCTG
GCAGACAGGGGTGAGAAGGACACAGCTAAGAGCCTCCAGCCCTTGGCGCCCCGGAACAAGACCCGTGTGGTCAGCTACCGCGTGCCCCAC
AACGCTGCGGTGCAGGTGTACGACTACCGAGAGAAGCGAGCCCGCGTGGTCTTCGGGCCTGAGCTGGTGTCGCTGGGTCCTGAGGAGCAG
TTCACAGTGTTGTCCCTCTCAGCTGGGCGGCCCAAGCGTCCCCATGCCCGCCGTGCGCTCTGCCTGCTGCTGGGGCCTGACTTCTTCACA
GACGTCATCACCATCGAAACGGCGGATCATGCCAGGCTGCAACTGCAGCTGGCCTACAACTGGCACTTTGAGGTGAATGACCGGAAGGAC
CCCCAAGAGACGGCCAAGCTCTTTTCAGTGCCAGACTTTGTAGGTGATGCCTGCAAAGCCATCGCATCCCGGGTGCGGGGGGCCGTGGCC
TCTGTCACTTTCGATGACTTCCATAAGAACTCAGCCCGCATCATTCGCACTGCTGTCTTTGGCTTTGAGACCTCGGAAGCGAAGGGCCCC
GATGGCATGGCCCTGCCCAGGCCCCGGGACCAGGCTGTCTTCCCCCAAAACGGGCTGGTGGTCAGCAGTGTGGACGTGCAGTCAGTGGAG
CCTGTGGATCAGAGGACCCGGGACGCCCTGCAACGCAGCGTCCAGCTGGCCATCGAGATCACCACCAACTCCCAGGAAGCGGCGGCCAAG
CATGAGGCTCAGAGACTGGAGCAGGAAGCCCGCGGCCGGCTTGAGCGGCAGAAGATCCTGGACCAGTCAGAAGCCGAGAAAGCTCGCAAG
GAACTTTTGGAGCTGGAGGCTCTGAGCATGGCCGTGGAGAGCACCGGGACTGCCAAGGCGGAGGCCGAGTCCCGTGCGGAGGCAGCCCGG
ATTGAGGGAGAAGGGTCCGTGCTGCAGGCCAAGCTAAAAGCACAGGCCTTGGCCATTGAAACGGAGGCTGAGCTCCAGAGGGTCCAGAAG
GTCCGAGAGCTGGAACTGGTCTATGCCCGGGCCCAGCTGGAGCTGGAGGTGAGCAAGGCTCAGCAGCTGGCTGAGGTGGAGGTGAAGAAG
TTCAAGCAGATGACAGAGGCCATAGGCCCCAGCACCATCAGGGACCTTGCTGTGGCTGGGCCTGAGATGCAGGTAAAACTGCTCCAGTCC
CTGGGCCTGAAATCAACCCTCATCACCGATGGCTCCACTCCCATCAACCTCTTCAACACAGCCTTTGGGCTGCTGGGGATGGGGCCCGAG
GGTCAGCCCCTGGGCAGAAGGGTGGCCAGTGGGCCCAGCCCTGGGGAGGGGATATCCCCCCAGTCTGCTCAGGCCCCTCAAGCTCCTGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_REL_ENST00000295025_chr2_61144152_+_MVP_ENST00000357402_chr16_29847025_+_3005nt
AGCCGCGGGAAATTCCCCTCCCGCCAGGCTGCTCGCCTCTCGGCTGGGCCAGCACTCGGCTCTCCCCGCTCCGCCCCCTGCCCCTGGCTC
CCGTACGGTGGACGGCGACGCTGGGTGACCCGGGGTGCAAGAATTCAGGGGTTGGGAAGGTGTGAGCCGCAAACCCAGCGGAGGGCGGGA
AGAAGGAGGAGGCCTCTAGGGTGGTCGGGGGACTGGGGGCCCCGCCGGCAGAGGTCCCTCGGCCTCCTGACTGACTGACTGCGGCCGCCT
CCGGCCAGGACGCTGGGAGCTGCCTGCGGGAAGGTGCGGGGAGCGGAGCCATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTG
AACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGATCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACA
ACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAAGTGAGAATTACATTAGTAACAAAGAATGACCCATATAAAC
CTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAAGCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAA
ATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATTACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTG
AAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTGTGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGA
CGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGGGAAGAATGGCTGGTCACCACAGTAGGGGCGTACCTCCCAGCGG
TGTTTGAGGAGGTTCTGGATTTGGTGGACGCCGTCATCCTTACGGAAAAGACAGCCCTGCACCTCCGGGCTCGGCGGAACTTCCGGGACT
TCAGGGGAGTGTCCCGCCGCACTGGGGAGGAGTGGCTGGTAACAGTGCAGGACACAGAGGCCCACGTGCCAGATGTCCACGAGGAGGTGC
TGGGGGTTGTGCCCATCACCACCCTGGGCCCCCACAACTACTGCGTGATTCTCGACCCTGTCGGACCGGATGGCAAGAATCAGCTGGGGC
AGAAGCGCGTGGTCAAGGGAGAGAAGTCTTTTTTCCTCCAGCCAGGAGAGCAGCTGGAACAAGGCATCCAGGATGTGTATGTGCTGTCGG
AGCAGCAGGGGCTGCTGCTGAGGGCCCTGCAGCCCCTGGAGGAGGGGGAGGATGAGGAGAAGGTCTCACACCAGGCTGGGGACCACTGGC
TCATCCGCGGACCCCTGGAGTATGTGCCATCTGCCAAAGTGGAGGTGGTGGAGGAGCGCCAGGCCATCCCTCTAGACGAGAACGAGGGCA
TCTATGTGCAGGATGTCAAGACCGGAAAGGTGCGCGCTGTGATTGGAAGCACCTACATGCTGACCCAGGACGAAGTCCTGTGGGAGAAAG
AGCTGCCTCCCGGGGTGGAGGAGCTGCTGAACAAGGGGCAGGACCCTCTGGCAGACAGGGGTGAGAAGGACACAGCTAAGAGCCTCCAGC
CCTTGGCGCCCCGGAACAAGACCCGTGTGGTCAGCTACCGCGTGCCCCACAACGCTGCGGTGCAGGTGTACGACTACCGAGAGAAGCGAG
CCCGCGTGGTCTTCGGGCCTGAGCTGGTGTCGCTGGGTCCTGAGGAGCAGTTCACAGTGTTGTCCCTCTCAGCTGGGCGGCCCAAGCGTC
CCCATGCCCGCCGTGCGCTCTGCCTGCTGCTGGGGCCTGACTTCTTCACAGACGTCATCACCATCGAAACGGCGGATCATGCCAGGCTGC
AACTGCAGCTGGCCTACAACTGGCACTTTGAGGTGAATGACCGGAAGGACCCCCAAGAGACGGCCAAGCTCTTTTCAGTGCCAGACTTTG
TAGGTGATGCCTGCAAAGCCATCGCATCCCGGGTGCGGGGGGCCGTGGCCTCTGTCACTTTCGATGACTTCCATAAGAACTCAGCCCGCA
TCATTCGCACTGCTGTCTTTGGCTTTGAGACCTCGGAAGCGAAGGGCCCCGATGGCATGGCCCTGCCCAGGCCCCGGGACCAGGCTGTCT
TCCCCCAAAACGGGCTGGTGGTCAGCAGTGTGGACGTGCAGTCAGTGGAGCCTGTGGATCAGAGGACCCGGGACGCCCTGCAACGCAGCG
TCCAGCTGGCCATCGAGATCACCACCAACTCCCAGGAAGCGGCGGCCAAGCATGAGGCTCAGAGACTGGAGCAGGAAGCCCGCGGCCGGC
TTGAGCGGCAGAAGATCCTGGACCAGTCAGAAGCCGAGAAAGCTCGCAAGGAACTTTTGGAGCTGGAGGCTCTGAGCATGGCCGTGGAGA
GCACCGGGACTGCCAAGGCGGAGGCCGAGTCCCGTGCGGAGGCAGCCCGGATTGAGGGAGAAGGGTCCGTGCTGCAGGCCAAGCTAAAAG
CACAGGCCTTGGCCATTGAAACGGAGGCTGAGCTCCAGAGGGTCCAGAAGGTCCGAGAGCTGGAACTGGTCTATGCCCGGGCCCAGCTGG
AGCTGGAGGTGAGCAAGGCTCAGCAGCTGGCTGAGGTGGAGGTGAAGAAGTTCAAGCAGATGACAGAGGCCATAGGCCCCAGCACCATCA
GGGACCTTGCTGTGGCTGGGCCTGAGATGCAGGTAAAACTGCTCCAGTCCCTGGGCCTGAAATCAACCCTCATCACCGATGGCTCCACTC
CCATCAACCTCTTCAACACAGCCTTTGGGCTGCTGGGGATGGGGCCCGAGGGTCAGCCCCTGGGCAGAAGGGTGGCCAGTGGGCCCAGCC
CTGGGGAGGGGATATCCCCCCAGTCTGCTCAGGCCCCTCAAGCTCCTGGAGACAACCACGTGGTGCCTGTACTGCGCTAACTCCTGATTA

>In-frame_REL_ENST00000394479_chr2_61144152_+_MVP_ENST00000357402_chr16_29847025_+_2870nt
CAGGGGTTGGGAAGGTGTGAGCCGCAAACCCAGCGGAGGGCGGGAAGAAGGAGGAGGCCTCTAGGGTGGTCGGGGGACTGGGGGCCCCGC
CGGCAGAGGTCCCTCGGCCTCCTGACTGACTGACTGCGGCCGCCTCCGGCCAGGACGCTGGGAGCTGCCTGCGGGAAGGTGCGGGGAGCG
GAGCCATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAG
GGCGATCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAG
GAAAAGTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACT
ATGAAGCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTA
TTATTACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGA
GACTGTGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACC
GGGAAGAATGGCTGGTCACCACAGTAGGGGCGTACCTCCCAGCGGTGTTTGAGGAGGTTCTGGATTTGGTGGACGCCGTCATCCTTACGG
AAAAGACAGCCCTGCACCTCCGGGCTCGGCGGAACTTCCGGGACTTCAGGGGAGTGTCCCGCCGCACTGGGGAGGAGTGGCTGGTAACAG
TGCAGGACACAGAGGCCCACGTGCCAGATGTCCACGAGGAGGTGCTGGGGGTTGTGCCCATCACCACCCTGGGCCCCCACAACTACTGCG
TGATTCTCGACCCTGTCGGACCGGATGGCAAGAATCAGCTGGGGCAGAAGCGCGTGGTCAAGGGAGAGAAGTCTTTTTTCCTCCAGCCAG
GAGAGCAGCTGGAACAAGGCATCCAGGATGTGTATGTGCTGTCGGAGCAGCAGGGGCTGCTGCTGAGGGCCCTGCAGCCCCTGGAGGAGG
GGGAGGATGAGGAGAAGGTCTCACACCAGGCTGGGGACCACTGGCTCATCCGCGGACCCCTGGAGTATGTGCCATCTGCCAAAGTGGAGG
TGGTGGAGGAGCGCCAGGCCATCCCTCTAGACGAGAACGAGGGCATCTATGTGCAGGATGTCAAGACCGGAAAGGTGCGCGCTGTGATTG
GAAGCACCTACATGCTGACCCAGGACGAAGTCCTGTGGGAGAAAGAGCTGCCTCCCGGGGTGGAGGAGCTGCTGAACAAGGGGCAGGACC
CTCTGGCAGACAGGGGTGAGAAGGACACAGCTAAGAGCCTCCAGCCCTTGGCGCCCCGGAACAAGACCCGTGTGGTCAGCTACCGCGTGC
CCCACAACGCTGCGGTGCAGGTGTACGACTACCGAGAGAAGCGAGCCCGCGTGGTCTTCGGGCCTGAGCTGGTGTCGCTGGGTCCTGAGG
AGCAGTTCACAGTGTTGTCCCTCTCAGCTGGGCGGCCCAAGCGTCCCCATGCCCGCCGTGCGCTCTGCCTGCTGCTGGGGCCTGACTTCT
TCACAGACGTCATCACCATCGAAACGGCGGATCATGCCAGGCTGCAACTGCAGCTGGCCTACAACTGGCACTTTGAGGTGAATGACCGGA
AGGACCCCCAAGAGACGGCCAAGCTCTTTTCAGTGCCAGACTTTGTAGGTGATGCCTGCAAAGCCATCGCATCCCGGGTGCGGGGGGCCG
TGGCCTCTGTCACTTTCGATGACTTCCATAAGAACTCAGCCCGCATCATTCGCACTGCTGTCTTTGGCTTTGAGACCTCGGAAGCGAAGG
GCCCCGATGGCATGGCCCTGCCCAGGCCCCGGGACCAGGCTGTCTTCCCCCAAAACGGGCTGGTGGTCAGCAGTGTGGACGTGCAGTCAG
TGGAGCCTGTGGATCAGAGGACCCGGGACGCCCTGCAACGCAGCGTCCAGCTGGCCATCGAGATCACCACCAACTCCCAGGAAGCGGCGG
CCAAGCATGAGGCTCAGAGACTGGAGCAGGAAGCCCGCGGCCGGCTTGAGCGGCAGAAGATCCTGGACCAGTCAGAAGCCGAGAAAGCTC
GCAAGGAACTTTTGGAGCTGGAGGCTCTGAGCATGGCCGTGGAGAGCACCGGGACTGCCAAGGCGGAGGCCGAGTCCCGTGCGGAGGCAG
CCCGGATTGAGGGAGAAGGGTCCGTGCTGCAGGCCAAGCTAAAAGCACAGGCCTTGGCCATTGAAACGGAGGCTGAGCTCCAGAGGGTCC
AGAAGGTCCGAGAGCTGGAACTGGTCTATGCCCGGGCCCAGCTGGAGCTGGAGGTGAGCAAGGCTCAGCAGCTGGCTGAGGTGGAGGTGA
AGAAGTTCAAGCAGATGACAGAGGCCATAGGCCCCAGCACCATCAGGGACCTTGCTGTGGCTGGGCCTGAGATGCAGGTAAAACTGCTCC
AGTCCCTGGGCCTGAAATCAACCCTCATCACCGATGGCTCCACTCCCATCAACCTCTTCAACACAGCCTTTGGGCTGCTGGGGATGGGGC
CCGAGGGTCAGCCCCTGGGCAGAAGGGTGGCCAGTGGGCCCAGCCCTGGGGAGGGGATATCCCCCCAGTCTGCTCAGGCCCCTCAAGCTC


Top

FusionGenePPI for REL_MVP


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RELPPP4C, MAP3K8, PAPOLA, RELA, NFKB1, NFKB2, TBK1, TNIP2, NFKBIE, ELF1, SRF, TBP, GTF2B, SP1, NKRF, MTPN, MAPK8, NFKBIA, NFKBIB, CDK2, CREBBP, EP300, FOXP3, DPF2, HSPA4, COMMD1, SOCS3, CXCL14, AAAS, CLIC4, TMEM165, C9orf91, AR, ADRB2, ADSL, ARNT2, BZRAP1, DGCR6, FHIT, MVP, NDE1, PARK2, PRKAB2, TDO2, ACTN3, AES, ALOX5, BID, SEPT7, CDKN2C, CKS1B, COL8A1, DHPS, DNTT, EIF4EBP1, EIF5A, EPHB6, FHL2, FKBP1B, FLNA, GRB2, HIP1, UBE2K, HLA-DOA, LASP1, LMO1, LMO2, LNPEP, FOXO4, NEDD9, NUCB1, PLCB4, POLE2, POLR2L, PSMA1, PTGER3, PTK6, RABIF, SAT1, ATXN1, SDCBP, SLC6A12, RECK, NCK2, HAT1, CGGBP1, STK16, EIF3A, EIF3D, EIF4E2, RBM39, KIAA0100, EPM2AIP1, ACOT8, CHAF1A, TSSC4, ARIH2, MAD2L2, GADD45G, MORF4L1, EXOSC8, R3HDM2, SEC31A, SZT2, TENC1, DAAM2, EML2, POLR1A, NDUFAF3, NECAP1, IL36RN, OSTF1, HSPB7, RSPH14, CPSF1, NME7, OSGIN1, A1CF, NEUROG3, EXOSC1, MEMO1, CHCHD2, DYNC1LI1, POP5, CINP, HDAC7, OAZ3, TRAPPC2L, UBASH3A, OTUD4, TTC19, SLC41A3, C1orf109, TXNL4B, MAGOHB, NAGK, ASAP3, NXT2, CABP5, EIF5A2, LGALS14, AGPAT4, MAP3K7CL, EXOSC5, PRDM10, CTNNBIP1, COL20A1, RNF213, LSM2, NGB, DMRT3, TMEM8A, PARVG, UBE2Z, OTUB2, C20orf195, ATG9A, CCNJL, SNRNP25, NOL9, FLAD1, TSSK3, RASSF5, C11orf68, PLEKHN1, MIEN1, VPS25, CEP19, KRTAP9-4, BMF, SLC39A13, ATPAF2, ZNF765, RIPPLY1, EGLN3, EFHC1, KLHL32, CIB3, PIH1D2, MRPL10, NR2C2AP, KLHL40, GLYCTK, ZNF572, ZNF417, TSTD2, PATE1, ZNF550, ZNF564, FUT11, TTC21A, STRA13, C9orf72, CPNE2, NEIL2, ZDHHC24, NUDT14, SEC14L4, BARHL2, RAB41, TRIM74, C12orf75, REXO1L6P, BTRC, RELB, TSR3, AURKA, XPO1, BIRC3, RGS3, HIF1AN, NFKBIDMVPPARP4, ESR1, PTEN, SIRT7, SLC2A4, RFWD2, TEP1, DHX9, CHMP4B, NNT, EPHX2, HP, KPNA2, CYTB, PLSCR1, GIT2, MVP, CKAP4, POT1, BAG3, HSP90AB1, NCBP1, VAT1, PSAP, BZRAP1, DISC1, DLX2, ADAMTSL4, AES, BANP, C1orf94, CALCOCO2, CAMK2B, CCDC36, FAM154A, FAM46C, GOLGA2, KCTD9, KPNA3, MDFI, MEOX1, MEOX2, MID2, MKL1, NOTCH2NL, OBFC1, PIH1D2, PSTPIP1, RAB3IP, RBPMS, REL, RHOXF2, RIMBP3, RNF111, SERTAD1, SKIL, TCF4, TFCP2, TP53, TRAF2, TRIM27, TRIM42, TRIP13, TRIP6, VAC14, ZBTB32, ZMIZ2, DDX19B, KRAS, CLTC, LGALS3BP, PTPN1, STAT5B, TGM2, GTSE1, SKI, MCM2, NF2, SNW1, CDC5L, U2AF2, GOPC, RCOR3, HSPA8, UBC, CYLD, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for REL_MVP


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for REL_MVP


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRELC0003873Rheumatoid Arthritis3CTD_human
HgeneRELC0018843Heat Stroke1CTD_human
HgeneRELC0019829Hodgkin Disease1CTD_human
HgeneRELC0025261Memory Disorders1CTD_human
HgeneRELC0033860Psoriasis1CTD_human
TgeneMVPC0023893Liver Cirrhosis, Experimental1CTD_human
TgeneMVPC0029408Degenerative polyarthritis1CTD_human