FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30753

FusionGeneSummary for RBM39_VMP1

check button Fusion gene summary
Fusion gene informationFusion gene name: RBM39_VMP1
Fusion gene ID: 30753
HgeneTgene
Gene symbol

RBM39

VMP1

Gene ID

9584

81671

Gene nameRNA binding motif protein 39vacuole membrane protein 1
SynonymsCAPER|CAPERalpha|FSAP59|HCC1|RNPC2EPG3|TANGO5|TMEM49
Cytomap

20q11.22

17q23.1

Type of geneprotein-codingprotein-coding
DescriptionRNA-binding protein 39CAPER alphaRNA-binding region (RNP1, RRM) containing 2coactivator of activating protein-1 and estrogen receptorsfunctional spliceosome-associated protein 59hepatocellular carcinoma protein 1splicing factor HCC1vacuole membrane protein 1ectopic P-granules autophagy protein 3 homologtransmembrane protein 49transport and golgi organization 5 homolog
Modification date2018051920180523
UniProtAcc

Q14498

Q96GC9

Ensembl transtripts involved in fusion geneENST00000253363, ENST00000361162, 
ENST00000528062, ENST00000407261, 
ENST00000397370, ENST00000463098, 
ENST00000262291, ENST00000537567, 
ENST00000539763, ENST00000536180, 
ENST00000545362, ENST00000588617, 
Fusion gene scores* DoF score13 X 11 X 8=114424 X 11 X 12=3168
# samples 1527
** MAII scorelog2(15/1144*10)=-2.93105264628251
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(27/3168*10)=-3.55254102302878
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RBM39 [Title/Abstract] AND VMP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-AC-A62V-01ARBM39chr20

34309662

-VMP1chr17

57842332

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000253363ENST00000262291RBM39chr20

34309662

-VMP1chr17

57842332

+
In-frameENST00000253363ENST00000537567RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-5UTRENST00000253363ENST00000539763RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-5UTRENST00000253363ENST00000536180RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-intronENST00000253363ENST00000545362RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-intronENST00000253363ENST00000588617RBM39chr20

34309662

-VMP1chr17

57842332

+
In-frameENST00000361162ENST00000262291RBM39chr20

34309662

-VMP1chr17

57842332

+
In-frameENST00000361162ENST00000537567RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-5UTRENST00000361162ENST00000539763RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-5UTRENST00000361162ENST00000536180RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-intronENST00000361162ENST00000545362RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-intronENST00000361162ENST00000588617RBM39chr20

34309662

-VMP1chr17

57842332

+
In-frameENST00000528062ENST00000262291RBM39chr20

34309662

-VMP1chr17

57842332

+
In-frameENST00000528062ENST00000537567RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-5UTRENST00000528062ENST00000539763RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-5UTRENST00000528062ENST00000536180RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-intronENST00000528062ENST00000545362RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-intronENST00000528062ENST00000588617RBM39chr20

34309662

-VMP1chr17

57842332

+
In-frameENST00000407261ENST00000262291RBM39chr20

34309662

-VMP1chr17

57842332

+
In-frameENST00000407261ENST00000537567RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-5UTRENST00000407261ENST00000539763RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-5UTRENST00000407261ENST00000536180RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-intronENST00000407261ENST00000545362RBM39chr20

34309662

-VMP1chr17

57842332

+
5CDS-intronENST00000407261ENST00000588617RBM39chr20

34309662

-VMP1chr17

57842332

+
intron-3CDSENST00000397370ENST00000262291RBM39chr20

34309662

-VMP1chr17

57842332

+
intron-3CDSENST00000397370ENST00000537567RBM39chr20

34309662

-VMP1chr17

57842332

+
intron-5UTRENST00000397370ENST00000539763RBM39chr20

34309662

-VMP1chr17

57842332

+
intron-5UTRENST00000397370ENST00000536180RBM39chr20

34309662

-VMP1chr17

57842332

+
intron-intronENST00000397370ENST00000545362RBM39chr20

34309662

-VMP1chr17

57842332

+
intron-intronENST00000397370ENST00000588617RBM39chr20

34309662

-VMP1chr17

57842332

+
intron-3CDSENST00000463098ENST00000262291RBM39chr20

34309662

-VMP1chr17

57842332

+
intron-3CDSENST00000463098ENST00000537567RBM39chr20

34309662

-VMP1chr17

57842332

+
intron-5UTRENST00000463098ENST00000539763RBM39chr20

34309662

-VMP1chr17

57842332

+
intron-5UTRENST00000463098ENST00000536180RBM39chr20

34309662

-VMP1chr17

57842332

+
intron-intronENST00000463098ENST00000545362RBM39chr20

34309662

-VMP1chr17

57842332

+
intron-intronENST00000463098ENST00000588617RBM39chr20

34309662

-VMP1chr17

57842332

+

Top

FusionProtFeatures for RBM39_VMP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RBM39

Q14498

VMP1

Q96GC9

Transcriptional coactivator for steroid nuclearreceptors ESR1/ER-alpha and ESR2/ER-beta, and JUN/AP-1 (Bysimilarity). May be involved in pre-mRNA splicing process.{ECO:0000250}. Stress-induced protein that, when overexpressed,promotes formation of intracellular vacuoles followed by celldeath. May be involved in the cytoplasmic vacuolization of acinarcells during the early stage of acute pancreatitis. Plays a rolein the initial stages of the autophagic process through itsinteraction with BECN1 (By similarity). Involved in cell-celladhesion. Plays an essential role in formation of cell junctions.{ECO:0000250, ECO:0000269|PubMed:17724469}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRBM39chr20:34309662chr17:57842332ENST00000253363-91741_90275531Compositional biasNote=Arg/Ser-rich (RS domain)
HgeneRBM39chr20:34309662chr17:57842332ENST00000361162-91741_90275525Compositional biasNote=Arg/Ser-rich (RS domain)
HgeneRBM39chr20:34309662chr17:57842332ENST00000528062-81641_90253509Compositional biasNote=Arg/Ser-rich (RS domain)
HgeneRBM39chr20:34309662chr17:57842332ENST00000253363-917153_230275531DomainRRM 1
HgeneRBM39chr20:34309662chr17:57842332ENST00000361162-917153_230275525DomainRRM 1
HgeneRBM39chr20:34309662chr17:57842332ENST00000528062-816153_230253509DomainRRM 1
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+412272_273138407Topological domainCytoplasmic
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+412295_305138407Topological domainExtracellular
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+412327_363138407Topological domainCytoplasmic
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+412385_406138407Topological domainExtracellular
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+412251_271138407TransmembraneHelical
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+412274_294138407TransmembraneHelical
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+412306_326138407TransmembraneHelical
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+412364_384138407TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRBM39chr20:34309662chr17:57842332ENST00000253363-917409_416275531Compositional biasNote=Poly-Ala
HgeneRBM39chr20:34309662chr17:57842332ENST00000361162-917409_416275525Compositional biasNote=Poly-Ala
HgeneRBM39chr20:34309662chr17:57842332ENST00000528062-816409_416253509Compositional biasNote=Poly-Ala
HgeneRBM39chr20:34309662chr17:57842332ENST00000253363-917250_328275531DomainRRM 2
HgeneRBM39chr20:34309662chr17:57842332ENST00000253363-917445_508275531DomainRRM 3
HgeneRBM39chr20:34309662chr17:57842332ENST00000361162-917250_328275525DomainRRM 2
HgeneRBM39chr20:34309662chr17:57842332ENST00000361162-917445_508275525DomainRRM 3
HgeneRBM39chr20:34309662chr17:57842332ENST00000528062-816250_328253509DomainRRM 2
HgeneRBM39chr20:34309662chr17:57842332ENST00000528062-816445_508253509DomainRRM 3
HgeneRBM39chr20:34309662chr17:57842332ENST00000253363-917291_355275531RegionActivating domain
HgeneRBM39chr20:34309662chr17:57842332ENST00000361162-917291_355275525RegionActivating domain
HgeneRBM39chr20:34309662chr17:57842332ENST00000528062-816291_355253509RegionActivating domain
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+412131_250138407Topological domainExtracellular
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+4122_43138407Topological domainCytoplasmic
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+41265_77138407Topological domainExtracellular
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+41299_109138407Topological domainCytoplasmic
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+412110_130138407TransmembraneHelical
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+41244_64138407TransmembraneHelical
TgeneVMP1chr20:34309662chr17:57842332ENST00000262291+41278_98138407TransmembraneHelical


Top

FusionGeneSequence for RBM39_VMP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RBM39_ENST00000253363_chr20_34309662_-_VMP1_ENST00000262291_chr17_57842332_+_544aa
MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRDRERKKSKSRERKRSRSKERRRSRSRSRDRR
FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVR
DVRMISDRNSRRSKGIATVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLTVGSLHFNITEDMLRGIF
EPFGRGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPTFMARAARLSGAEPDDEE
TQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFS
KHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEE

>In-frame_RBM39_ENST00000253363_chr20_34309662_-_VMP1_ENST00000537567_chr17_57842332_+_544aa
MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRDRERKKSKSRERKRSRSKERRRSRSRSRDRR
FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVR
DVRMISDRNSRRSKGIATVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLTVGSLHFNITEDMLRGIF
EPFGRGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPTFMARAARLSGAEPDDEE
TQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFS
KHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEE

>In-frame_RBM39_ENST00000361162_chr20_34309662_-_VMP1_ENST00000262291_chr17_57842332_+_544aa
MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRDRERKKSKSRERKRSRSKERRRSRSRSRDRR
FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVR
DVRMISDRNSRRSKGIATVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLTVGSLHFNITEDMLRGIF
EPFGRGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPTFMARAARLSGAEPDDEE
TQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFS
KHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEE

>In-frame_RBM39_ENST00000361162_chr20_34309662_-_VMP1_ENST00000537567_chr17_57842332_+_544aa
MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRDRERKKSKSRERKRSRSKERRRSRSRSRDRR
FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVR
DVRMISDRNSRRSKGIATVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLTVGSLHFNITEDMLRGIF
EPFGRGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPTFMARAARLSGAEPDDEE
TQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFS
KHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEE

>In-frame_RBM39_ENST00000528062_chr20_34309662_-_VMP1_ENST00000262291_chr17_57842332_+_522aa
MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRDRERKKSKSRERKRSRSKERRRSRSRSRDRR
FRGRYRSPYRRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIATVEFV
DVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLTVGSLHFNITEDMLRGIFEPFGRGPHIASVTLAATECNSV
NFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPTFMARAARLSGAEPDDEETQEFEEMLEHAESAQDFASRAK
LAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQ

>In-frame_RBM39_ENST00000528062_chr20_34309662_-_VMP1_ENST00000537567_chr17_57842332_+_522aa
MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRDRERKKSKSRERKRSRSKERRRSRSRSRDRR
FRGRYRSPYRRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIATVEFV
DVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLTVGSLHFNITEDMLRGIFEPFGRGPHIASVTLAATECNSV
NFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPTFMARAARLSGAEPDDEETQEFEEMLEHAESAQDFASRAK
LAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQ

>In-frame_RBM39_ENST00000407261_chr20_34309662_-_VMP1_ENST00000262291_chr17_57842332_+_387aa
MQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIATVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSA
GPMRLTVGSLHFNITEDMLRGIFEPFGRGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAI
GELPPTFMARAARLSGAEPDDEETQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFG
ATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFI

>In-frame_RBM39_ENST00000407261_chr20_34309662_-_VMP1_ENST00000537567_chr17_57842332_+_387aa
MQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIATVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSA
GPMRLTVGSLHFNITEDMLRGIFEPFGRGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAI
GELPPTFMARAARLSGAEPDDEETQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFG
ATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RBM39_ENST00000253363_chr20_34309662_-_VMP1_ENST00000262291_chr17_57842332_+_1632nt
ATGGCAGACGATATTGATATTGAAGCAATGCTTGAGGCTCCTTACAAGAAGGATGAGAACAAGTTGAGCAGTGCCAACGGCCATGAAGAA
CGTAGCAAAAAGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAACGAAAGAGAAGCAAAAGTAAGGAACGGAAGCGAAGTAGAGAC
AGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCAAAGAGAGGCGACGGAGCCGCTCAAGAAGTCGAGATCGAAGA
TTTAGAGGCCGCTACAGAAGTCCTTACTCCGGACCAAAATTTAACAGTGCCATCCGAGGAAAGATTGGGTTGCCTCATAGCATCAAATTA
AGCAGACGACGTTCCCGAAGCAAAAGTCCATTCAGAAAAGACAAGAGCCCTGTGAGAGAACCTATTGATAATTTAACTCCTGAGGAAAGA
GATGCAAGGACAGTCTTCTGTATGCAGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTTTTTCTCTACAGTAGGAAAGGTTCGA
GATGTGAGGATGATTTCTGACAGAAATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGTCGATGTTAGCTCAGTGCCTCTAGCA
ATAGGATTAACTGGCCAACGAGTTTTAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAAAAACAGAGCTGCAGCAATGGCAAAC
AATTTACAAAAGGGAAGTGCTGGACCTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAACTGAAGATATGCTTCGTGGGATCTTT
GAGCCTTTTGGAAGAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCT
GATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATG
TGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAG
TATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAG
AAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTA
CCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGC
AAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_RBM39_ENST00000253363_chr20_34309662_-_VMP1_ENST00000537567_chr17_57842332_+_1632nt
ATGGCAGACGATATTGATATTGAAGCAATGCTTGAGGCTCCTTACAAGAAGGATGAGAACAAGTTGAGCAGTGCCAACGGCCATGAAGAA
CGTAGCAAAAAGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAACGAAAGAGAAGCAAAAGTAAGGAACGGAAGCGAAGTAGAGAC
AGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCAAAGAGAGGCGACGGAGCCGCTCAAGAAGTCGAGATCGAAGA
TTTAGAGGCCGCTACAGAAGTCCTTACTCCGGACCAAAATTTAACAGTGCCATCCGAGGAAAGATTGGGTTGCCTCATAGCATCAAATTA
AGCAGACGACGTTCCCGAAGCAAAAGTCCATTCAGAAAAGACAAGAGCCCTGTGAGAGAACCTATTGATAATTTAACTCCTGAGGAAAGA
GATGCAAGGACAGTCTTCTGTATGCAGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTTTTTCTCTACAGTAGGAAAGGTTCGA
GATGTGAGGATGATTTCTGACAGAAATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGTCGATGTTAGCTCAGTGCCTCTAGCA
ATAGGATTAACTGGCCAACGAGTTTTAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAAAAACAGAGCTGCAGCAATGGCAAAC
AATTTACAAAAGGGAAGTGCTGGACCTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAACTGAAGATATGCTTCGTGGGATCTTT
GAGCCTTTTGGAAGAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCT
GATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATG
TGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAG
TATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAG
AAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTA
CCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGC
AAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_RBM39_ENST00000361162_chr20_34309662_-_VMP1_ENST00000262291_chr17_57842332_+_1632nt
ATGGCAGACGATATTGATATTGAAGCAATGCTTGAGGCTCCTTACAAGAAGGATGAGAACAAGTTGAGCAGTGCCAACGGCCATGAAGAA
CGTAGCAAAAAGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAACGAAAGAGAAGCAAAAGTAAGGAACGGAAGCGAAGTAGAGAC
AGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCAAAGAGAGGCGACGGAGCCGCTCAAGAAGTCGAGATCGAAGA
TTTAGAGGCCGCTACAGAAGTCCTTACTCCGGACCAAAATTTAACAGTGCCATCCGAGGAAAGATTGGGTTGCCTCATAGCATCAAATTA
AGCAGACGACGTTCCCGAAGCAAAAGTCCATTCAGAAAAGACAAGAGCCCTGTGAGAGAACCTATTGATAATTTAACTCCTGAGGAAAGA
GATGCAAGGACAGTCTTCTGTATGCAGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTTTTTCTCTACAGTAGGAAAGGTTCGA
GATGTGAGGATGATTTCTGACAGAAATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGTCGATGTTAGCTCAGTGCCTCTAGCA
ATAGGATTAACTGGCCAACGAGTTTTAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAAAAACAGAGCTGCAGCAATGGCAAAC
AATTTACAAAAGGGAAGTGCTGGACCTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAACTGAAGATATGCTTCGTGGGATCTTT
GAGCCTTTTGGAAGAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCT
GATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATG
TGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAG
TATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAG
AAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTA
CCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGC
AAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_RBM39_ENST00000361162_chr20_34309662_-_VMP1_ENST00000537567_chr17_57842332_+_1632nt
ATGGCAGACGATATTGATATTGAAGCAATGCTTGAGGCTCCTTACAAGAAGGATGAGAACAAGTTGAGCAGTGCCAACGGCCATGAAGAA
CGTAGCAAAAAGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAACGAAAGAGAAGCAAAAGTAAGGAACGGAAGCGAAGTAGAGAC
AGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCAAAGAGAGGCGACGGAGCCGCTCAAGAAGTCGAGATCGAAGA
TTTAGAGGCCGCTACAGAAGTCCTTACTCCGGACCAAAATTTAACAGTGCCATCCGAGGAAAGATTGGGTTGCCTCATAGCATCAAATTA
AGCAGACGACGTTCCCGAAGCAAAAGTCCATTCAGAAAAGACAAGAGCCCTGTGAGAGAACCTATTGATAATTTAACTCCTGAGGAAAGA
GATGCAAGGACAGTCTTCTGTATGCAGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTTTTTCTCTACAGTAGGAAAGGTTCGA
GATGTGAGGATGATTTCTGACAGAAATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGTCGATGTTAGCTCAGTGCCTCTAGCA
ATAGGATTAACTGGCCAACGAGTTTTAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAAAAACAGAGCTGCAGCAATGGCAAAC
AATTTACAAAAGGGAAGTGCTGGACCTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAACTGAAGATATGCTTCGTGGGATCTTT
GAGCCTTTTGGAAGAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCT
GATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATG
TGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAG
TATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAG
AAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTA
CCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGC
AAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_RBM39_ENST00000528062_chr20_34309662_-_VMP1_ENST00000262291_chr17_57842332_+_1566nt
ATGGCAGACGATATTGATATTGAAGCAATGCTTGAGGCTCCTTACAAGAAGGATGAGAACAAGTTGAGCAGTGCCAACGGCCATGAAGAA
CGTAGCAAAAAGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAACGAAAGAGAAGCAAAAGTAAGGAACGGAAGCGAAGTAGAGAC
AGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCAAAGAGAGGCGACGGAGCCGCTCAAGAAGTCGAGATCGAAGA
TTTAGAGGCCGCTACAGAAGTCCTTACAGACGACGTTCCCGAAGCAAAAGTCCATTCAGAAAAGACAAGAGCCCTGTGAGAGAACCTATT
GATAATTTAACTCCTGAGGAAAGAGATGCAAGGACAGTCTTCTGTATGCAGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTTT
TTCTCTACAGTAGGAAAGGTTCGAGATGTGAGGATGATTTCTGACAGAAATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGTC
GATGTTAGCTCAGTGCCTCTAGCAATAGGATTAACTGGCCAACGAGTTTTAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAAA
AACAGAGCTGCAGCAATGGCAAACAATTTACAAAAGGGAAGTGCTGGACCTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAACT
GAAGATATGCTTCGTGGGATCTTTGAGCCTTTTGGAAGAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTT
AATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCA
AAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCA
GGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAA
CTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGA
ATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAA
ATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAG
AAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCC
TGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATC

>In-frame_RBM39_ENST00000528062_chr20_34309662_-_VMP1_ENST00000537567_chr17_57842332_+_1566nt
ATGGCAGACGATATTGATATTGAAGCAATGCTTGAGGCTCCTTACAAGAAGGATGAGAACAAGTTGAGCAGTGCCAACGGCCATGAAGAA
CGTAGCAAAAAGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAACGAAAGAGAAGCAAAAGTAAGGAACGGAAGCGAAGTAGAGAC
AGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCAAAGAGAGGCGACGGAGCCGCTCAAGAAGTCGAGATCGAAGA
TTTAGAGGCCGCTACAGAAGTCCTTACAGACGACGTTCCCGAAGCAAAAGTCCATTCAGAAAAGACAAGAGCCCTGTGAGAGAACCTATT
GATAATTTAACTCCTGAGGAAAGAGATGCAAGGACAGTCTTCTGTATGCAGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTTT
TTCTCTACAGTAGGAAAGGTTCGAGATGTGAGGATGATTTCTGACAGAAATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGTC
GATGTTAGCTCAGTGCCTCTAGCAATAGGATTAACTGGCCAACGAGTTTTAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAAA
AACAGAGCTGCAGCAATGGCAAACAATTTACAAAAGGGAAGTGCTGGACCTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAACT
GAAGATATGCTTCGTGGGATCTTTGAGCCTTTTGGAAGAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTT
AATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCA
AAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCA
GGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAA
CTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGA
ATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAA
ATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAG
AAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCC
TGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATC

>In-frame_RBM39_ENST00000407261_chr20_34309662_-_VMP1_ENST00000262291_chr17_57842332_+_1161nt
ATGCAGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTTTTTCTCTACAGTAGGAAAGGTTCGAGATGTGAGGATGATTTCTGAC
AGAAATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGTCGATGTTAGCTCAGTGCCTCTAGCAATAGGATTAACTGGCCAACGA
GTTTTAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAAAAACAGAGCTGCAGCAATGGCAAACAATTTACAAAAGGGAAGTGCT
GGACCTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAACTGAAGATATGCTTCGTGGGATCTTTGAGCCTTTTGGAAGAGGTCCA
CATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGAT
GAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATC
GGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATG
CTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATT
TTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGT
GCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATG
GTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCAC
CACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATC

>In-frame_RBM39_ENST00000407261_chr20_34309662_-_VMP1_ENST00000537567_chr17_57842332_+_1161nt
ATGCAGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTTTTTCTCTACAGTAGGAAAGGTTCGAGATGTGAGGATGATTTCTGAC
AGAAATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGTCGATGTTAGCTCAGTGCCTCTAGCAATAGGATTAACTGGCCAACGA
GTTTTAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAAAAACAGAGCTGCAGCAATGGCAAACAATTTACAAAAGGGAAGTGCT
GGACCTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAACTGAAGATATGCTTCGTGGGATCTTTGAGCCTTTTGGAAGAGGTCCA
CATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGAT
GAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATC
GGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATG
CTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATT
TTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGT
GCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATG
GTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCAC
CACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATC


* Fusion transcript sequences (Full-length transcript).
>In-frame_RBM39_ENST00000253363_chr20_34309662_-_VMP1_ENST00000262291_chr17_57842332_+_2837nt
GGCCGGAACAGGCGTTTAGAGAAAATGGCAGACGATATTGATATTGAAGCAATGCTTGAGGCTCCTTACAAGAAGGATGAGAACAAGTTG
AGCAGTGCCAACGGCCATGAAGAACGTAGCAAAAAGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAACGAAAGAGAAGCAAAAGT
AAGGAACGGAAGCGAAGTAGAGACAGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCAAAGAGAGGCGACGGAGC
CGCTCAAGAAGTCGAGATCGAAGATTTAGAGGCCGCTACAGAAGTCCTTACTCCGGACCAAAATTTAACAGTGCCATCCGAGGAAAGATT
GGGTTGCCTCATAGCATCAAATTAAGCAGACGACGTTCCCGAAGCAAAAGTCCATTCAGAAAAGACAAGAGCCCTGTGAGAGAACCTATT
GATAATTTAACTCCTGAGGAAAGAGATGCAAGGACAGTCTTCTGTATGCAGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTTT
TTCTCTACAGTAGGAAAGGTTCGAGATGTGAGGATGATTTCTGACAGAAATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGTC
GATGTTAGCTCAGTGCCTCTAGCAATAGGATTAACTGGCCAACGAGTTTTAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAAA
AACAGAGCTGCAGCAATGGCAAACAATTTACAAAAGGGAAGTGCTGGACCTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAACT
GAAGATATGCTTCGTGGGATCTTTGAGCCTTTTGGAAGAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTT
AATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCA
AAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCA
GGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAA
CTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGA
ATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAA
ATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAG
AAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCC
TGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATC
CAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATT
GGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACT
TTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGAT
GTTCAGCAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAAA
AAAAGTTCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATAA
ATTATCTAGATTGGATAACAGTCTTGCATGTTTATCATGTTACAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAAA
AAGGGCCATTTTATGATGCATTGCACACCCTCTGGGGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTTA
CAAGTGAGCTGACACCATTTTTTATTCTGTGTATTTAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAATT
GTGTCCGTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATTT
CTTAAGCTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGCA
CCTCTGGGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGAG
AAATTACCCATTTCTAAAAAAAAACCACACTCTGTCGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATTT
ATATGTTAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTTGTTC

>In-frame_RBM39_ENST00000253363_chr20_34309662_-_VMP1_ENST00000537567_chr17_57842332_+_1916nt
GGCCGGAACAGGCGTTTAGAGAAAATGGCAGACGATATTGATATTGAAGCAATGCTTGAGGCTCCTTACAAGAAGGATGAGAACAAGTTG
AGCAGTGCCAACGGCCATGAAGAACGTAGCAAAAAGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAACGAAAGAGAAGCAAAAGT
AAGGAACGGAAGCGAAGTAGAGACAGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCAAAGAGAGGCGACGGAGC
CGCTCAAGAAGTCGAGATCGAAGATTTAGAGGCCGCTACAGAAGTCCTTACTCCGGACCAAAATTTAACAGTGCCATCCGAGGAAAGATT
GGGTTGCCTCATAGCATCAAATTAAGCAGACGACGTTCCCGAAGCAAAAGTCCATTCAGAAAAGACAAGAGCCCTGTGAGAGAACCTATT
GATAATTTAACTCCTGAGGAAAGAGATGCAAGGACAGTCTTCTGTATGCAGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTTT
TTCTCTACAGTAGGAAAGGTTCGAGATGTGAGGATGATTTCTGACAGAAATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGTC
GATGTTAGCTCAGTGCCTCTAGCAATAGGATTAACTGGCCAACGAGTTTTAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAAA
AACAGAGCTGCAGCAATGGCAAACAATTTACAAAAGGGAAGTGCTGGACCTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAACT
GAAGATATGCTTCGTGGGATCTTTGAGCCTTTTGGAAGAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTT
AATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCA
AAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCA
GGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAA
CTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGA
ATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAA
ATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAG
AAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCC
TGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATC
CAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATT
GGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACT
TTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGAT

>In-frame_RBM39_ENST00000361162_chr20_34309662_-_VMP1_ENST00000262291_chr17_57842332_+_3198nt
GCGAGAGCCCGTGCTGAGGGCTCTGTGAGGCCCCGTGTGTTTGTGTGTGTGTATGTGTGCTGGTGAATGTGAGTACAGGGAAGCAGCGGC
CGCCATTTCAGGGAGCTTGTCGACGCTGTCGCAGGGGTGGATCCTGAGCTGCCGAAGCCGCCGTCCTGCTCTCCCGCGTGGGCTTCTCTA
ATTCCATTGTTTTTTTTAGATTCTCTCGGGCCTAGCCGTCCTTGGAACCCGATATTCGGGCTGGGCGGTTCCGCGGCCTGGGCCTAGGGG
CTTAACAGTAGCAACAGAAGCGGCGGCGGCGGCAGCAGCAGCAGCAGCAGCAGCAATCTCTTCCCGAACACGAGCACCACAGGCGCCCGA
AGGCCGGAACAGGCGTTTAGAGAAAATGGCAGACGATATTGATATTGAAGCAATGCTTGAGGCTCCTTACAAGAAGGATGAGAACAAGTT
GAGCAGTGCCAACGGCCATGAAGAACGTAGCAAAAAGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAACGAAAGAGAAGCAAAAG
TAAGGAACGGAAGCGAAGTAGAGACAGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCAAAGAGAGGCGACGGAG
CCGCTCAAGAAGTCGAGATCGAAGATTTAGAGGCCGCTACAGAAGTCCTTACTCCGGACCAAAATTTAACAGTGCCATCCGAGGAAAGAT
TGGGTTGCCTCATAGCATCAAATTAAGCAGACGACGTTCCCGAAGCAAAAGTCCATTCAGAAAAGACAAGAGCCCTGTGAGAGAACCTAT
TGATAATTTAACTCCTGAGGAAAGAGATGCAAGGACAGTCTTCTGTATGCAGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTT
TTTCTCTACAGTAGGAAAGGTTCGAGATGTGAGGATGATTTCTGACAGAAATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGT
CGATGTTAGCTCAGTGCCTCTAGCAATAGGATTAACTGGCCAACGAGTTTTAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAA
AAACAGAGCTGCAGCAATGGCAAACAATTTACAAAAGGGAAGTGCTGGACCTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAAC
TGAAGATATGCTTCGTGGGATCTTTGAGCCTTTTGGAAGAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGT
TAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTC
AAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTC
AGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAA
ACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGG
AATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAA
AATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCA
GAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTC
CTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAAT
CCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAAT
TGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATAC
TTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGA
TGTTCAGCAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAA
AAAAAGTTCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATA
AATTATCTAGATTGGATAACAGTCTTGCATGTTTATCATGTTACAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAA
AAAGGGCCATTTTATGATGCATTGCACACCCTCTGGGGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTT
ACAAGTGAGCTGACACCATTTTTTATTCTGTGTATTTAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAAT
TGTGTCCGTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATT
TCTTAAGCTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGC
ACCTCTGGGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGA
GAAATTACCCATTTCTAAAAAAAAACCACACTCTGTCGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATT
TATATGTTAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTTGTT

>In-frame_RBM39_ENST00000361162_chr20_34309662_-_VMP1_ENST00000537567_chr17_57842332_+_2277nt
GCGAGAGCCCGTGCTGAGGGCTCTGTGAGGCCCCGTGTGTTTGTGTGTGTGTATGTGTGCTGGTGAATGTGAGTACAGGGAAGCAGCGGC
CGCCATTTCAGGGAGCTTGTCGACGCTGTCGCAGGGGTGGATCCTGAGCTGCCGAAGCCGCCGTCCTGCTCTCCCGCGTGGGCTTCTCTA
ATTCCATTGTTTTTTTTAGATTCTCTCGGGCCTAGCCGTCCTTGGAACCCGATATTCGGGCTGGGCGGTTCCGCGGCCTGGGCCTAGGGG
CTTAACAGTAGCAACAGAAGCGGCGGCGGCGGCAGCAGCAGCAGCAGCAGCAGCAATCTCTTCCCGAACACGAGCACCACAGGCGCCCGA
AGGCCGGAACAGGCGTTTAGAGAAAATGGCAGACGATATTGATATTGAAGCAATGCTTGAGGCTCCTTACAAGAAGGATGAGAACAAGTT
GAGCAGTGCCAACGGCCATGAAGAACGTAGCAAAAAGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAACGAAAGAGAAGCAAAAG
TAAGGAACGGAAGCGAAGTAGAGACAGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCAAAGAGAGGCGACGGAG
CCGCTCAAGAAGTCGAGATCGAAGATTTAGAGGCCGCTACAGAAGTCCTTACTCCGGACCAAAATTTAACAGTGCCATCCGAGGAAAGAT
TGGGTTGCCTCATAGCATCAAATTAAGCAGACGACGTTCCCGAAGCAAAAGTCCATTCAGAAAAGACAAGAGCCCTGTGAGAGAACCTAT
TGATAATTTAACTCCTGAGGAAAGAGATGCAAGGACAGTCTTCTGTATGCAGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTT
TTTCTCTACAGTAGGAAAGGTTCGAGATGTGAGGATGATTTCTGACAGAAATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGT
CGATGTTAGCTCAGTGCCTCTAGCAATAGGATTAACTGGCCAACGAGTTTTAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAA
AAACAGAGCTGCAGCAATGGCAAACAATTTACAAAAGGGAAGTGCTGGACCTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAAC
TGAAGATATGCTTCGTGGGATCTTTGAGCCTTTTGGAAGAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGT
TAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTC
AAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTC
AGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAA
ACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGG
AATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAA
AATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCA
GAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTC
CTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAAT
CCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAAT
TGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATAC
TTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGA

>In-frame_RBM39_ENST00000528062_chr20_34309662_-_VMP1_ENST00000262291_chr17_57842332_+_3058nt
ACAGGGAAGCAGCGGCCGCCATTTCAGGGAGCTTGTCGACGCTGTCGCAGGGGTGGATCCTGAGCTGCCGAAGCCGCCGTCCTGCTCTCC
CGCGTGGGCTTCTCTAATTCCATTGTTTTTTTTAGATTCTCTCGGGCCTAGCCGTCCTTGGAACCCGATATTCGGGCTGGGCGGTTCCGC
GGCCTGGGCCTAGGGGCTTAACAGTAGCAACAGAAGCGGCGGCGGCGGCAGCAGCAGCAGCAGCAGCAGCAATCTCTTCCCGAACACGAG
CACCACAGGCGCCCGAAGGCCGGAACAGGCGTTTAGAGAAAATGGCAGACGATATTGATATTGAAGCAATGCTTGAGGCTCCTTACAAGA
AGGATGAGAACAAGTTGAGCAGTGCCAACGGCCATGAAGAACGTAGCAAAAAGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAAC
GAAAGAGAAGCAAAAGTAAGGAACGGAAGCGAAGTAGAGACAGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCA
AAGAGAGGCGACGGAGCCGCTCAAGAAGTCGAGATCGAAGATTTAGAGGCCGCTACAGAAGTCCTTACAGACGACGTTCCCGAAGCAAAA
GTCCATTCAGAAAAGACAAGAGCCCTGTGAGAGAACCTATTGATAATTTAACTCCTGAGGAAAGAGATGCAAGGACAGTCTTCTGTATGC
AGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTTTTTCTCTACAGTAGGAAAGGTTCGAGATGTGAGGATGATTTCTGACAGAA
ATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGTCGATGTTAGCTCAGTGCCTCTAGCAATAGGATTAACTGGCCAACGAGTTT
TAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAAAAACAGAGCTGCAGCAATGGCAAACAATTTACAAAAGGGAAGTGCTGGAC
CTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAACTGAAGATATGCTTCGTGGGATCTTTGAGCCTTTTGGAAGAGGTCCACATA
TAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAG
AGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAG
AGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGG
AACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGG
CCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAA
CCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGG
CTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACA
AAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTAT
CTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTT
TAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCA
ATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCT
CGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAGCAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTACTTTCAA
AAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAAAAAAAGTTCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCTTGTCACA
AATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATAAATTATCTAGATTGGATAACAGTCTTGCATGTTTATCATGTTACAATTTA
ATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAAAAAGGGCCATTTTATGATGCATTGCACACCCTCTGGGGAAATTGATCTTT
AAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTTACAAGTGAGCTGACACCATTTTTTATTCTGTGTATTTAGAATGAAGTCTT
GAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAATTGTGTCCGTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTTATACCAG
CTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATTTCTTAAGCTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGGCATGTTT
TGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGCACCTCTGGGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAAACAGGAG
AGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGAGAAATTACCCATTTCTAAAAAAAAACCACACTCTGTCGTATCTGTGTTAA
TGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATTTATATGTTAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTATTCTTAGT

>In-frame_RBM39_ENST00000528062_chr20_34309662_-_VMP1_ENST00000537567_chr17_57842332_+_2137nt
ACAGGGAAGCAGCGGCCGCCATTTCAGGGAGCTTGTCGACGCTGTCGCAGGGGTGGATCCTGAGCTGCCGAAGCCGCCGTCCTGCTCTCC
CGCGTGGGCTTCTCTAATTCCATTGTTTTTTTTAGATTCTCTCGGGCCTAGCCGTCCTTGGAACCCGATATTCGGGCTGGGCGGTTCCGC
GGCCTGGGCCTAGGGGCTTAACAGTAGCAACAGAAGCGGCGGCGGCGGCAGCAGCAGCAGCAGCAGCAGCAATCTCTTCCCGAACACGAG
CACCACAGGCGCCCGAAGGCCGGAACAGGCGTTTAGAGAAAATGGCAGACGATATTGATATTGAAGCAATGCTTGAGGCTCCTTACAAGA
AGGATGAGAACAAGTTGAGCAGTGCCAACGGCCATGAAGAACGTAGCAAAAAGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAAC
GAAAGAGAAGCAAAAGTAAGGAACGGAAGCGAAGTAGAGACAGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCA
AAGAGAGGCGACGGAGCCGCTCAAGAAGTCGAGATCGAAGATTTAGAGGCCGCTACAGAAGTCCTTACAGACGACGTTCCCGAAGCAAAA
GTCCATTCAGAAAAGACAAGAGCCCTGTGAGAGAACCTATTGATAATTTAACTCCTGAGGAAAGAGATGCAAGGACAGTCTTCTGTATGC
AGCTGGCGGCAAGAATTCGACCAAGGGATTTGGAAGAGTTTTTCTCTACAGTAGGAAAGGTTCGAGATGTGAGGATGATTTCTGACAGAA
ATTCAAGACGTTCCAAAGGAATTGCTTATGTGGAGTTCGTCGATGTTAGCTCAGTGCCTCTAGCAATAGGATTAACTGGCCAACGAGTTT
TAGGCGTGCCAATCATAGTACAGGCATCACAGGCAGAAAAAAACAGAGCTGCAGCAATGGCAAACAATTTACAAAAGGGAAGTGCTGGAC
CTATGAGGCTTTATGTGGGCTCATTACACTTCAACATAACTGAAGATATGCTTCGTGGGATCTTTGAGCCTTTTGGAAGAGGTCCACATA
TAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAG
AGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAG
AGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGG
AACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGG
CCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAA
CCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGG
CTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACA
AAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTAT
CTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTT
TAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCA
ATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCT

>In-frame_RBM39_ENST00000407261_chr20_34309662_-_VMP1_ENST00000262291_chr17_57842332_+_3214nt
GTGCTGGTGAATGTGAGTACAGGGAAGCAGCGGCCGCCATTTCAGGGAGCTTGTCGACGCTGTCGCAGGGGTGGATCCTGAGCTGCCGAA
GCCGCCGTCCTGCTCTCCCGCGTGGGCTTCTCTAATTCCATTGTTTTTTTTAGATTCTCTCGGGCCTAGCCGTCCTTGGAACCCGATATT
CGGGCTGGGCGGTTCCGCGGCCTGGGCCTAGGGGCTTAACAGTAGCAACAGAAGCGGCGGCGGCGGCAGCAGCAGCAGCAGCAGCAGCAA
TCTCTTCCCGAACACGAGCACCACAGGCGCCCGAAGGCCGGAACAGGCGTTTAGAGAAAATGGCAGACGATATTGATATTGAAGCAATGC
TTGAGGCTCCTTACAAGAAGGATGAGAACAAGTTGAGCAGTGCCAACGGCCATGAAGAACGTAGCAAAAAACAAACTTTCTGCCTCCTTG
GAAAGCTCTACATCTCCTTGTGATTGGAGTGTGGGTTTCAAGATTCCAGAAGGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAAC
GAAAGAGAAGCAAAAGTAAGGAACGGAAGCGAAGTAGAGACAGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCA
AAGAGAGGCGACGGAGCCGCTCAAGAAGTCGAGATCGAAGATTTAGAGGCCGCTACAGAAGTCCTTACTCCGGACCAAAATTTAACAGTG
CCATCCGAGGAAAGATTGGGTTGCCTCATAGCATCAAATTAAGCAGACGACGTTCCCGAAGCAAAAGTCCATTCAGAAAAGACAAGAGCC
CTGTGAGAGAACCTATTGATAATTTAACTCCTGAGGAAAGAGATGCAAGGACAGTCTTCTGTATGCAGCTGGCGGCAAGAATTCGACCAA
GGGATTTGGAAGAGTTTTTCTCTACAGTAGGAAAGGTTCGAGATGTGAGGATGATTTCTGACAGAAATTCAAGACGTTCCAAAGGAATTG
CTTATGTGGAGTTCGTCGATGTTAGCTCAGTGCCTCTAGCAATAGGATTAACTGGCCAACGAGTTTTAGGCGTGCCAATCATAGTACAGG
CATCACAGGCAGAAAAAAACAGAGCTGCAGCAATGGCAAACAATTTACAAAAGGGAAGTGCTGGACCTATGAGGCTTTATGTGGGCTCAT
TACACTTCAACATAACTGAAGATATGCTTCGTGGGATCTTTGAGCCTTTTGGAAGAGGTCCACATATAGCCTCAGTTACATTAGCTGCTT
ATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTT
TGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCA
GAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACT
TTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTT
TATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAA
AAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCA
TAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGG
GAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAA
GTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGAT
GGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAA
GCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTC
TTAGGGTGGAATGTGATGTTCAGCAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAG
AATTCCCACCGCACAAAAAAAGTTCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGT
CATCAAAATGTATATAAATTATCTAGATTGGATAACAGTCTTGCATGTTTATCATGTTACAATTTAATATTCCATCCTGCCCAACCCTTC
CTCTCCCATCCTCAAAAAAGGGCCATTTTATGATGCATTGCACACCCTCTGGGGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAA
ATCTGGTTGGTGTCTTACAAGTGAGCTGACACCATTTTTTATTCTGTGTATTTAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCT
TTAATCATTCCAAAATTGTGTCCGTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCC
ACCTACAACAAGAATTTCTTAAGCTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTG
CATACTGCTAAATGGCACCTCTGGGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGA
AAGGATACTGGAGAGAGAAATTACCCATTTCTAAAAAAAAACCACACTCTGTCGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTT
TCAACAGACACAAATTTATATGTTAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTT

>In-frame_RBM39_ENST00000407261_chr20_34309662_-_VMP1_ENST00000537567_chr17_57842332_+_2293nt
GTGCTGGTGAATGTGAGTACAGGGAAGCAGCGGCCGCCATTTCAGGGAGCTTGTCGACGCTGTCGCAGGGGTGGATCCTGAGCTGCCGAA
GCCGCCGTCCTGCTCTCCCGCGTGGGCTTCTCTAATTCCATTGTTTTTTTTAGATTCTCTCGGGCCTAGCCGTCCTTGGAACCCGATATT
CGGGCTGGGCGGTTCCGCGGCCTGGGCCTAGGGGCTTAACAGTAGCAACAGAAGCGGCGGCGGCGGCAGCAGCAGCAGCAGCAGCAGCAA
TCTCTTCCCGAACACGAGCACCACAGGCGCCCGAAGGCCGGAACAGGCGTTTAGAGAAAATGGCAGACGATATTGATATTGAAGCAATGC
TTGAGGCTCCTTACAAGAAGGATGAGAACAAGTTGAGCAGTGCCAACGGCCATGAAGAACGTAGCAAAAAACAAACTTTCTGCCTCCTTG
GAAAGCTCTACATCTCCTTGTGATTGGAGTGTGGGTTTCAAGATTCCAGAAGGAGGAAAAAAAGCAAGAGCAGAAGTCGTAGTCATGAAC
GAAAGAGAAGCAAAAGTAAGGAACGGAAGCGAAGTAGAGACAGAGAAAGGAAAAAGAGCAAAAGCCGTGAAAGAAAGCGAAGTAGAAGCA
AAGAGAGGCGACGGAGCCGCTCAAGAAGTCGAGATCGAAGATTTAGAGGCCGCTACAGAAGTCCTTACTCCGGACCAAAATTTAACAGTG
CCATCCGAGGAAAGATTGGGTTGCCTCATAGCATCAAATTAAGCAGACGACGTTCCCGAAGCAAAAGTCCATTCAGAAAAGACAAGAGCC
CTGTGAGAGAACCTATTGATAATTTAACTCCTGAGGAAAGAGATGCAAGGACAGTCTTCTGTATGCAGCTGGCGGCAAGAATTCGACCAA
GGGATTTGGAAGAGTTTTTCTCTACAGTAGGAAAGGTTCGAGATGTGAGGATGATTTCTGACAGAAATTCAAGACGTTCCAAAGGAATTG
CTTATGTGGAGTTCGTCGATGTTAGCTCAGTGCCTCTAGCAATAGGATTAACTGGCCAACGAGTTTTAGGCGTGCCAATCATAGTACAGG
CATCACAGGCAGAAAAAAACAGAGCTGCAGCAATGGCAAACAATTTACAAAAGGGAAGTGCTGGACCTATGAGGCTTTATGTGGGCTCAT
TACACTTCAACATAACTGAAGATATGCTTCGTGGGATCTTTGAGCCTTTTGGAAGAGGTCCACATATAGCCTCAGTTACATTAGCTGCTT
ATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTT
TGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCA
GAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACT
TTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTT
TATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAA
AAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCA
TAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGG
GAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAA
GTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGAT
GGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAA
GCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTC


Top

FusionGenePPI for RBM39_VMP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RBM39ESR2, ESR1, JUN, HNRNPA1, CDK9, KHDRBS2, SRRM1, SRRM2, HIST1H1C, CTNNBL1, TADA2A, UBC, MME, HDAC5, SND1, RPS2, RPS3, ACIN1, SNRNP200, CDK12, SF3B1, RBM25, PNN, U2AF2, PCBP3, TRA2B, LUC7L2, SRSF7, SRSF1, SAP18, SNRPD1, HNRNPU, XRCC5, XRCC6, IRF2BP2, RPS13, RPL27A, IRF2BPL, HDGF, SF3A2, SIRT7, TCF3, NR2C1, CUL3, CUL1, COPS5, CAND1, PGR, APP, SMU1, DDX3X, BCAS2, PLRG1, NHP2L1, USP39, PRPF19, RALY, TOP1, DDX21, GPATCH1, ILF3, RRP7A, SEPT7, TRMT112, UTP14A, S100A9, RRS1, RAN, SEPT2, RBM14, VTN, FLNA, RPS14, BARD1, MDC1, MAGOH, PRPF40A, CHERP, RBM23, PRPF3, PRPF38A, SAP30BP, HNRNPH2, NKAP, TOE1, TTC14, ZCCHC10, RNF113A, SRPK2, AICDA, SRPK1, CLK2, SRPK3, TARDBP, RPA3, RPA2, RPA1, WWOX, SPRTN, TP53, PHC2, GOLGA2, REL, SDCBP, SP100, MLX, ZBTB22, SRSF11, PPIG, SF3B4, KIAA0907, ARL6IP4, BANP, THAP1, C11orf57, HOMEZ, AK8, FAM200A, SREK1IP1, KRTAP12-2, RP9P, NXF1, CUL7, OBSL1, EZH2, SUZ12, EED, RNF2, HSPB1, PNISR, RBM14-RBM4, CDC5L, SNRNP70, RNPS1, SON, SREK1, SFN, NTRK1, CLK1, AHSA1, SEC16A, LAP3, KMT2E, SNW1, CRBN, ZNF746, EGFR, JMJD6, NCL, MTNR1A, INO80B, TRIM25, MCPH1VMP1HGS, ELAVL1, TJP1, KLK11, LPAR6, ERGIC3, FAF2, KRAS, TCTN2, TCTN3, TMEM216, DPEP1, CDH13, MAS1, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneRBM39chr20:34309662chr17:57842332ENST00000253363-917355_406275531ESR1 and ESR2
HgeneRBM39chr20:34309662chr17:57842332ENST00000361162-917355_406275525ESR1 and ESR2
HgeneRBM39chr20:34309662chr17:57842332ENST00000528062-816355_406253509ESR1 and ESR2
HgeneRBM39chr20:34309662chr17:57842332ENST00000253363-917291_406275531JUN
HgeneRBM39chr20:34309662chr17:57842332ENST00000361162-917291_406275525JUN
HgeneRBM39chr20:34309662chr17:57842332ENST00000528062-816291_406253509JUN
HgeneRBM39chr20:34309662chr17:57842332ENST00000253363-917406_530275531NCOA6
HgeneRBM39chr20:34309662chr17:57842332ENST00000361162-917406_530275525NCOA6
HgeneRBM39chr20:34309662chr17:57842332ENST00000528062-816406_530253509NCOA6


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RBM39_VMP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RBM39_VMP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource