FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30715

FusionGeneSummary for RBM19_CLK2

check button Fusion gene summary
Fusion gene informationFusion gene name: RBM19_CLK2
Fusion gene ID: 30715
HgeneTgene
Gene symbol

RBM19

CLK2

Gene ID

9904

9894

Gene nameRNA binding motif protein 19telomere maintenance 2
SynonymsMrd1CLK2|TEL2|YHFS
Cytomap

12q24.13-q24.21

16p13.3

Type of geneprotein-codingprotein-coding
Descriptionprobable RNA-binding protein 19telomere length regulation protein TEL2 homologTEL2, telomere maintenance 2, homologprotein clk-2 homolog
Modification date2018052320180523
UniProtAcc

Q9Y4C8

P49760

Ensembl transtripts involved in fusion geneENST00000545145, ENST00000392561, 
ENST00000261741, ENST00000553232, 
ENST00000361168, ENST00000368361, 
ENST00000355560, ENST00000497188, 
ENST00000536801, 
Fusion gene scores* DoF score3 X 3 X 3=272 X 2 X 2=8
# samples 32
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/8*10)=1.32192809488736
Context

PubMed: RBM19 [Title/Abstract] AND CLK2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationDDR (DNA damage repair) gene involved fusion gene, retained protein feature but frameshift.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-VP-A87K-01ARBM19chr12

114364859

-CLK2chr1

155240768

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000545145ENST00000361168RBM19chr12

114364859

-CLK2chr1

155240768

-
Frame-shitENST00000545145ENST00000368361RBM19chr12

114364859

-CLK2chr1

155240768

-
Frame-shitENST00000545145ENST00000355560RBM19chr12

114364859

-CLK2chr1

155240768

-
5CDS-intronENST00000545145ENST00000497188RBM19chr12

114364859

-CLK2chr1

155240768

-
5CDS-intronENST00000545145ENST00000536801RBM19chr12

114364859

-CLK2chr1

155240768

-
Frame-shitENST00000392561ENST00000361168RBM19chr12

114364859

-CLK2chr1

155240768

-
Frame-shitENST00000392561ENST00000368361RBM19chr12

114364859

-CLK2chr1

155240768

-
Frame-shitENST00000392561ENST00000355560RBM19chr12

114364859

-CLK2chr1

155240768

-
5CDS-intronENST00000392561ENST00000497188RBM19chr12

114364859

-CLK2chr1

155240768

-
5CDS-intronENST00000392561ENST00000536801RBM19chr12

114364859

-CLK2chr1

155240768

-
In-frameENST00000261741ENST00000361168RBM19chr12

114364859

-CLK2chr1

155240768

-
In-frameENST00000261741ENST00000368361RBM19chr12

114364859

-CLK2chr1

155240768

-
In-frameENST00000261741ENST00000355560RBM19chr12

114364859

-CLK2chr1

155240768

-
5CDS-intronENST00000261741ENST00000497188RBM19chr12

114364859

-CLK2chr1

155240768

-
5CDS-intronENST00000261741ENST00000536801RBM19chr12

114364859

-CLK2chr1

155240768

-
intron-3CDSENST00000553232ENST00000361168RBM19chr12

114364859

-CLK2chr1

155240768

-
intron-3CDSENST00000553232ENST00000368361RBM19chr12

114364859

-CLK2chr1

155240768

-
intron-3CDSENST00000553232ENST00000355560RBM19chr12

114364859

-CLK2chr1

155240768

-
intron-intronENST00000553232ENST00000497188RBM19chr12

114364859

-CLK2chr1

155240768

-
intron-intronENST00000553232ENST00000536801RBM19chr12

114364859

-CLK2chr1

155240768

-

Top

FusionProtFeatures for RBM19_CLK2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RBM19

Q9Y4C8

CLK2

P49760

Plays a role in embryo pre-implantation development.{ECO:0000250}. Dual specificity kinase acting on both serine/threonineand tyrosine-containing substrates. Phosphorylates serine- andarginine-rich (SR) proteins of the spliceosomal complex. May be aconstituent of a network of regulatory mechanisms that enable SRproteins to control RNA splicing and can cause redistribution ofSR proteins from speckles to a diffuse nucleoplasmic distribution.Acts as a suppressor of hepatic gluconeogenesis and glucose outputby repressing PPARGC1A transcriptional activity on gluconeogenicgenes via its phosphorylation. Phosphorylates PPP2R5B therebystimulating the assembly of PP2A phosphatase with the PPP2R5B-AKT1complex leading to dephosphorylation of AKT1. Phosphorylates:PTPN1, SRSF1 and SRSF3. Regulates the alternative splicing oftissue factor (F3) pre-mRNA in endothelial cells.{ECO:0000269|PubMed:10480872, ECO:0000269|PubMed:19168442,ECO:0000269|PubMed:8910305, ECO:0000269|PubMed:9637771}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for RBM19_CLK2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RBM19_ENST00000261741_chr12_114364859_-_CLK2_ENST00000361168_chr1_155240768_-_1247aa
MSRLIVKNLPNGMKEERFRQLFAAFGTLTDCSLKFTKDGKFRKFGFIGFKSEEEAQKAQKHFNKSFIDTSRITVEFCKSFGDPAKPRAWS
KHAQKPSQPKQPPKDSTTPEIKKDEKKKKVAGQLEKLKEDTEFQEFLSVHQRRAQAATWANDGLDAEPSKGKSKPASDYLNFDSDSGQES
EEEGAGEDLEEEASLEPKAAVQKELSDMDYLKSKMVKAGSSSSSEEEESEDEAVHCDEGSEAEEEDSSATPVLQERDSKGAGQEQGMPAG
KKRPPEARAETEKPANQKEPTTCHTVKLRGAPFNVTEKNVMEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSNEEEVKQALKCNREYMGGR
YIEVFREKNVPTTKGAPKNTTKSWQGRILGENEEEEDLAESGRLFVRNLPYTSTEEDLEKLFSKTGPLSELHYPIDSLTKKPKGFAFITF
MFPEHAVKAYSEVDGQVFQGRMLHVLPSTIKKEASEDASALGSSSYKKKKEAQDKANSASSHNWNTLFMGPNAVADAIAQKYNATKSQVF
DHETKGSVAVRVALGETQLVQEVRRFLIDNGVSLDSFSQAAAERSKTVILVKNLPAGTLAAQLQETFGHFGSLGRVLLPEGGITAIVEFL
EPLEARKAFRHLATSKFHHVPLTLEWAPVGVFSSTAPQKKKLQDTPSEPMEKDPAEPETVPDGETPEDENPTEEGADNSSAKMEEEEEEE
EEEEESLPGCTLFIKNLNFDTTEEKLKEMPHPRRYHSSERGSRGSYREHTRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSTDDR
SSDRRVTDRRYCGSYRRNDTSRDRGDAYTDTDTRHSTETQRENSSYRSQRSSRRKHRRRRRRSRTFSRSSSHSSRRAKSVEDDAEGHLIY
HVGDWLQERTEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISF
ELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDTELTYNLEKKRDERSVKSTAVRVVDFGSATF
DHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYTVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKTFYRGRLDWDE

>In-frame_RBM19_ENST00000261741_chr12_114364859_-_CLK2_ENST00000368361_chr1_155240768_-_1248aa
MSRLIVKNLPNGMKEERFRQLFAAFGTLTDCSLKFTKDGKFRKFGFIGFKSEEEAQKAQKHFNKSFIDTSRITVEFCKSFGDPAKPRAWS
KHAQKPSQPKQPPKDSTTPEIKKDEKKKKVAGQLEKLKEDTEFQEFLSVHQRRAQAATWANDGLDAEPSKGKSKPASDYLNFDSDSGQES
EEEGAGEDLEEEASLEPKAAVQKELSDMDYLKSKMVKAGSSSSSEEEESEDEAVHCDEGSEAEEEDSSATPVLQERDSKGAGQEQGMPAG
KKRPPEARAETEKPANQKEPTTCHTVKLRGAPFNVTEKNVMEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSNEEEVKQALKCNREYMGGR
YIEVFREKNVPTTKGAPKNTTKSWQGRILGENEEEEDLAESGRLFVRNLPYTSTEEDLEKLFSKTGPLSELHYPIDSLTKKPKGFAFITF
MFPEHAVKAYSEVDGQVFQGRMLHVLPSTIKKEASEDASALGSSSYKKKKEAQDKANSASSHNWNTLFMGPNAVADAIAQKYNATKSQVF
DHETKGSVAVRVALGETQLVQEVRRFLIDNGVSLDSFSQAAAERSKTVILVKNLPAGTLAAQLQETFGHFGSLGRVLLPEGGITAIVEFL
EPLEARKAFRHLATSKFHHVPLTLEWAPVGVFSSTAPQKKKLQDTPSEPMEKDPAEPETVPDGETPEDENPTEEGADNSSAKMEEEEEEE
EEEEESLPGCTLFIKNLNFDTTEEKLKEMPHPRRYHSSERGSRGSYREHTRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSTDDR
SSDRRVTDRRYCGSYRRNDTSRDRGDAYTDTDTRHSTETQRENSSYRSQRSSRRKHRRRRRRSRTFSRSSSQHSSRRAKSVEDDAEGHLI
YHVGDWLQERTEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCIS
FELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDTELTYNLEKKRDERSVKSTAVRVVDFGSAT
FDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYTVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKTFYRGRLDWD

>In-frame_RBM19_ENST00000261741_chr12_114364859_-_CLK2_ENST00000355560_chr1_155240768_-_1246aa
MSRLIVKNLPNGMKEERFRQLFAAFGTLTDCSLKFTKDGKFRKFGFIGFKSEEEAQKAQKHFNKSFIDTSRITVEFCKSFGDPAKPRAWS
KHAQKPSQPKQPPKDSTTPEIKKDEKKKKVAGQLEKLKEDTEFQEFLSVHQRRAQAATWANDGLDAEPSKGKSKPASDYLNFDSDSGQES
EEEGAGEDLEEEASLEPKAAVQKELSDMDYLKSKMVKAGSSSSSEEEESEDEAVHCDEGSEAEEEDSSATPVLQERDSKGAGQEQGMPAG
KKRPPEARAETEKPANQKEPTTCHTVKLRGAPFNVTEKNVMEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSNEEEVKQALKCNREYMGGR
YIEVFREKNVPTTKGAPKNTTKSWQGRILGENEEEEDLAESGRLFVRNLPYTSTEEDLEKLFSKTGPLSELHYPIDSLTKKPKGFAFITF
MFPEHAVKAYSEVDGQVFQGRMLHVLPSTIKKEASEDASALGSSSYKKKKEAQDKANSASSHNWNTLFMGPNAVADAIAQKYNATKSQVF
DHETKGSVAVRVALGETQLVQEVRRFLIDNGVSLDSFSQAAAERSKTVILVKNLPAGTLAAQLQETFGHFGSLGRVLLPEGGITAIVEFL
EPLEARKAFRHLATSKFHHVPLTLEWAPVGVFSSTAPQKKKLQDTPSEPMEKDPAEPETVPDGETPEDENPTEEGADNSSAKMEEEEEEE
EEEEESLPGCTLFIKNLNFDTTEEKLKEMPHPRRYHSSERGSRGSYREHTRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSTDDRS
SDRRVTDRRYCGSYRRNDTSRDRGDAYTDTDTRHSTETQRENSSYRSQRSSRRKHRRRRRRSRTFSRSSSHSSRRAKSVEDDAEGHLIYH
VGDWLQERTEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFE
LLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDTELTYNLEKKRDERSVKSTAVRVVDFGSATFD
HEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYTVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKTFYRGRLDWDEN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RBM19_ENST00000261741_chr12_114364859_-_CLK2_ENST00000361168_chr1_155240768_-_3741nt
ATGTCGCGACTGATCGTGAAGAATCTCCCGAATGGGATGAAGGAGGAGCGTTTCAGGCAGCTGTTTGCCGCCTTCGGCACGCTGACAGAC
TGCAGCCTGAAGTTCACCAAAGATGGCAAGTTCCGCAAGTTTGGTTTTATTGGCTTCAAGTCCGAGGAAGAGGCCCAGAAGGCACAGAAG
CATTTCAACAAGAGCTTCATCGACACATCCCGGATCACAGTGGAGTTCTGCAAGTCATTCGGGGACCCGGCCAAACCCAGAGCCTGGAGC
AAACATGCCCAGAAACCAAGCCAGCCCAAGCAGCCTCCAAAAGACTCTACTACTCCAGAAATTAAGAAAGATGAGAAGAAGAAAAAGGTG
GCAGGTCAACTGGAGAAGCTGAAGGAGGATACAGAGTTCCAGGAGTTTCTGTCAGTTCATCAGAGGCGGGCGCAGGCAGCCACTTGGGCG
AATGATGGCCTGGATGCTGAGCCCTCGAAAGGGAAGAGCAAGCCGGCCAGTGACTACCTGAACTTCGACTCCGATTCTGGGCAGGAGAGT
GAGGAGGAGGGAGCCGGGGAGGACCTGGAAGAAGAGGCAAGCCTCGAACCAAAGGCAGCTGTGCAGAAGGAGCTGTCGGACATGGATTAC
CTGAAATCCAAGATGGTGAAGGCTGGGTCGTCCTCTTCCTCGGAGGAAGAGGAAAGTGAAGATGAAGCCGTGCACTGTGATGAAGGGAGT
GAGGCCGAGGAAGAGGATTCCTCCGCCACCCCAGTCCTGCAGGAAAGAGACAGCAAGGGTGCAGGCCAAGAGCAAGGGATGCCAGCTGGG
AAAAAGAGACCACCGGAGGCCAGAGCCGAGACAGAGAAACCAGCAAACCAGAAGGAACCCACCACCTGCCACACCGTGAAGCTGCGGGGA
GCCCCGTTCAATGTCACAGAGAAAAATGTTATGGAATTCCTGGCACCCCTGAAACCAGTGGCCATTCGAATTGTGAGAAACGCTCATGGG
AATAAAACAGGATACATCTTTGTGGATTTCAGCAATGAAGAGGAAGTGAAGCAAGCTCTGAAATGCAACCGGGAGTACATGGGTGGGCGC
TACATCGAGGTGTTCAGGGAAAAGAACGTCCCCACCACCAAGGGTGCACCAAAGAATACCACCAAATCCTGGCAAGGCCGGATACTCGGG
GAGAACGAAGAGGAGGAGGACCTGGCCGAATCCGGAAGGCTCTTTGTACGGAACCTGCCCTACACCAGCACCGAGGAGGATCTGGAGAAG
CTCTTCTCCAAATATGGTCCCCTGTCTGAGCTCCACTACCCCATCGACAGCCTGACCAAGAAACCCAAGGGTTTTGCATTCATCACCTTC
ATGTTCCCTGAGCACGCTGTGAAGGCCTACTCGGAGGTGGACGGGCAGGTATTCCAGGGCAGGATGCTCCACGTGTTACCATCTACCATC
AAGAAGGAAGCCAGCGAGGATGCCAGTGCCCTGGGATCGTCGTCCTACAAGAAGAAGAAGGAGGCCCAGGACAAAGCCAACAGTGCCAGC
TCTCACAACTGGAACACACTATTCATGGGGCCGAATGCCGTGGCCGATGCCATCGCACAGAAGTACAACGCCACCAAGAGTCAAGTGTTT
GACCACGAGACCAAGGGCAGCGTGGCCGTGCGCGTGGCTCTGGGGGAAACCCAGCTCGTCCAGGAAGTGCGGCGTTTTCTCATAGACAAC
GGGGTCAGCCTGGATTCCTTCAGCCAGGCTGCAGCAGAGCGAAGCAAGACTGTGATTCTGGTCAAGAACCTCCCGGCAGGCACCCTGGCG
GCCCAGCTGCAGGAGACCTTCGGCCATTTTGGCAGCCTGGGCCGCGTGCTGCTGCCAGAGGGCGGAATCACTGCCATCGTGGAGTTCCTG
GAGCCCCTGGAGGCCCGCAAGGCCTTCAGGCATCTGGCCTATTCCAAGTTCCATCATGTCCCCCTCTATCTGGAGTGGGCTCCAGTTGGC
GTCTTCTCCAGCACAGCCCCACAGAAGAAAAAGCTCCAAGACACACCTTCAGAACCCATGGAAAAGGACCCAGCAGAGCCAGAAACAGTG
CCTGATGGCGAAACCCCAGAAGATGAAAATCCAACAGAGGAAGGAGCAGACAACTCTTCAGCAAAGATGGAAGAGGAGGAGGAGGAAGAG
GAAGAAGAAGAAGAGAGCCTCCCAGGATGTACTCTGTTTATTAAGAATCTCAATTTTGACACAACAGAAGAGAAGCTGAAGGAAATGCCG
CATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGCCGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGAAGAAGT
CGCTCCTGGTCAAGTAGTAGTGACCGGACACGACGGCGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGCAGTTATGATGATCGT
TCGTCCGACCGGAGGGTGTATGACCGGCGATACTGTGGCAGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTACTATGAC
ACAGACTATCGGCATTCCTATGAATATCAGCGGGAGAACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGGCGGAGG
AGGCGCAGCCGGACATTTAGCCGCTCATCTTCGCACAGCAGCCGGAGAGCCAAGAGTGTAGAGGACGACGCTGAGGGCCACCTCATCTAC
CACGTCGGGGACTGGCTACAAGAGCGATATGAAATCGTTAGCACCTTAGGAGAGGGGACCTTCGGCCGAGTTGTACAATGTGTTGACCAT
CGCAGGGGTGGGGCTCGAGTTGCCCTGAAGATCATTAAGAATGTGGAGAAGTACAAGGAAGCAGCTCGACTTGAGATCAACGTGCTAGAG
AAAATCAATGAGAAAGACCCTGACAACAAGAACCTCTGTGTCCAGATGTTTGACTGGTTTGACTACCATGGCCACATGTGTATCTCCTTT
GAGCTTCTGGGCCTTAGCACCTTCGATTTCCTCAAAGACAACAACTACCTGCCCTACCCCATCCACCAAGTGCGCCACATGGCCTTCCAG
CTGTGCCAGGCTGTCAAGTTCCTCCATGATAACAAGCTGACACATACAGACCTCAAGCCTGAAAATATTCTGTTTGTGAATTCAGACTAT
GAGCTCACCTACAACCTAGAGAAGAAGCGAGATGAGCGCAGTGTGAAGAGCACAGCTGTGCGGGTGGTAGACTTTGGCAGTGCCACCTTT
GACCATGAGCACCATAGCACCATTGTCTCCACTCGCCATTACCGAGCACCAGAAGTCATCCTTGAGTTGGGCTGGTCACAGCCTTGTGAT
GTGTGGAGTATAGGCTGCATCATCTTTGAATACTATGTGGGATTCACCCTCTTCCAGACCCATGACAACAGAGAGCATCTAGCCATGATG
GAAAGGATCTTGGGTCCTATCCCTTCCCGGATGATCCGAAAGACAAGAAAGCAGAAATATTTTTACCGGGGTCGCCTGGATTGGGATGAG
AACACATCAGCTGGGCGCTATGTTCGTGAGAACTGCAAACCGCTGCGGCGGTATCTGACCTCAGAGGCAGAGGAACACCACCAGCTCTTC
GATCTGATTGAAAGCATGCTAGAGTATGAACCAGCTAAGCGGCTGACCTTGGGTGAAGCCCTTCAGCATCCTTTCTTCGCCCGCCTTCGG

>In-frame_RBM19_ENST00000261741_chr12_114364859_-_CLK2_ENST00000368361_chr1_155240768_-_3744nt
ATGTCGCGACTGATCGTGAAGAATCTCCCGAATGGGATGAAGGAGGAGCGTTTCAGGCAGCTGTTTGCCGCCTTCGGCACGCTGACAGAC
TGCAGCCTGAAGTTCACCAAAGATGGCAAGTTCCGCAAGTTTGGTTTTATTGGCTTCAAGTCCGAGGAAGAGGCCCAGAAGGCACAGAAG
CATTTCAACAAGAGCTTCATCGACACATCCCGGATCACAGTGGAGTTCTGCAAGTCATTCGGGGACCCGGCCAAACCCAGAGCCTGGAGC
AAACATGCCCAGAAACCAAGCCAGCCCAAGCAGCCTCCAAAAGACTCTACTACTCCAGAAATTAAGAAAGATGAGAAGAAGAAAAAGGTG
GCAGGTCAACTGGAGAAGCTGAAGGAGGATACAGAGTTCCAGGAGTTTCTGTCAGTTCATCAGAGGCGGGCGCAGGCAGCCACTTGGGCG
AATGATGGCCTGGATGCTGAGCCCTCGAAAGGGAAGAGCAAGCCGGCCAGTGACTACCTGAACTTCGACTCCGATTCTGGGCAGGAGAGT
GAGGAGGAGGGAGCCGGGGAGGACCTGGAAGAAGAGGCAAGCCTCGAACCAAAGGCAGCTGTGCAGAAGGAGCTGTCGGACATGGATTAC
CTGAAATCCAAGATGGTGAAGGCTGGGTCGTCCTCTTCCTCGGAGGAAGAGGAAAGTGAAGATGAAGCCGTGCACTGTGATGAAGGGAGT
GAGGCCGAGGAAGAGGATTCCTCCGCCACCCCAGTCCTGCAGGAAAGAGACAGCAAGGGTGCAGGCCAAGAGCAAGGGATGCCAGCTGGG
AAAAAGAGACCACCGGAGGCCAGAGCCGAGACAGAGAAACCAGCAAACCAGAAGGAACCCACCACCTGCCACACCGTGAAGCTGCGGGGA
GCCCCGTTCAATGTCACAGAGAAAAATGTTATGGAATTCCTGGCACCCCTGAAACCAGTGGCCATTCGAATTGTGAGAAACGCTCATGGG
AATAAAACAGGATACATCTTTGTGGATTTCAGCAATGAAGAGGAAGTGAAGCAAGCTCTGAAATGCAACCGGGAGTACATGGGTGGGCGC
TACATCGAGGTGTTCAGGGAAAAGAACGTCCCCACCACCAAGGGTGCACCAAAGAATACCACCAAATCCTGGCAAGGCCGGATACTCGGG
GAGAACGAAGAGGAGGAGGACCTGGCCGAATCCGGAAGGCTCTTTGTACGGAACCTGCCCTACACCAGCACCGAGGAGGATCTGGAGAAG
CTCTTCTCCAAATATGGTCCCCTGTCTGAGCTCCACTACCCCATCGACAGCCTGACCAAGAAACCCAAGGGTTTTGCATTCATCACCTTC
ATGTTCCCTGAGCACGCTGTGAAGGCCTACTCGGAGGTGGACGGGCAGGTATTCCAGGGCAGGATGCTCCACGTGTTACCATCTACCATC
AAGAAGGAAGCCAGCGAGGATGCCAGTGCCCTGGGATCGTCGTCCTACAAGAAGAAGAAGGAGGCCCAGGACAAAGCCAACAGTGCCAGC
TCTCACAACTGGAACACACTATTCATGGGGCCGAATGCCGTGGCCGATGCCATCGCACAGAAGTACAACGCCACCAAGAGTCAAGTGTTT
GACCACGAGACCAAGGGCAGCGTGGCCGTGCGCGTGGCTCTGGGGGAAACCCAGCTCGTCCAGGAAGTGCGGCGTTTTCTCATAGACAAC
GGGGTCAGCCTGGATTCCTTCAGCCAGGCTGCAGCAGAGCGAAGCAAGACTGTGATTCTGGTCAAGAACCTCCCGGCAGGCACCCTGGCG
GCCCAGCTGCAGGAGACCTTCGGCCATTTTGGCAGCCTGGGCCGCGTGCTGCTGCCAGAGGGCGGAATCACTGCCATCGTGGAGTTCCTG
GAGCCCCTGGAGGCCCGCAAGGCCTTCAGGCATCTGGCCTATTCCAAGTTCCATCATGTCCCCCTCTATCTGGAGTGGGCTCCAGTTGGC
GTCTTCTCCAGCACAGCCCCACAGAAGAAAAAGCTCCAAGACACACCTTCAGAACCCATGGAAAAGGACCCAGCAGAGCCAGAAACAGTG
CCTGATGGCGAAACCCCAGAAGATGAAAATCCAACAGAGGAAGGAGCAGACAACTCTTCAGCAAAGATGGAAGAGGAGGAGGAGGAAGAG
GAAGAAGAAGAAGAGAGCCTCCCAGGATGTACTCTGTTTATTAAGAATCTCAATTTTGACACAACAGAAGAGAAGCTGAAGGAAATGCCG
CATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGCCGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGAAGAAGT
CGCTCCTGGTCAAGTAGTAGTGACCGGACACGACGGCGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGCAGTTATGATGATCGT
TCGTCCGACCGGAGGGTGTATGACCGGCGATACTGTGGCAGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTACTATGAC
ACAGACTATCGGCATTCCTATGAATATCAGCGGGAGAACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGGCGGAGG
AGGCGCAGCCGGACATTTAGCCGCTCATCTTCGCAGCACAGCAGCCGGAGAGCCAAGAGTGTAGAGGACGACGCTGAGGGCCACCTCATC
TACCACGTCGGGGACTGGCTACAAGAGCGATATGAAATCGTTAGCACCTTAGGAGAGGGGACCTTCGGCCGAGTTGTACAATGTGTTGAC
CATCGCAGGGGTGGGGCTCGAGTTGCCCTGAAGATCATTAAGAATGTGGAGAAGTACAAGGAAGCAGCTCGACTTGAGATCAACGTGCTA
GAGAAAATCAATGAGAAAGACCCTGACAACAAGAACCTCTGTGTCCAGATGTTTGACTGGTTTGACTACCATGGCCACATGTGTATCTCC
TTTGAGCTTCTGGGCCTTAGCACCTTCGATTTCCTCAAAGACAACAACTACCTGCCCTACCCCATCCACCAAGTGCGCCACATGGCCTTC
CAGCTGTGCCAGGCTGTCAAGTTCCTCCATGATAACAAGCTGACACATACAGACCTCAAGCCTGAAAATATTCTGTTTGTGAATTCAGAC
TATGAGCTCACCTACAACCTAGAGAAGAAGCGAGATGAGCGCAGTGTGAAGAGCACAGCTGTGCGGGTGGTAGACTTTGGCAGTGCCACC
TTTGACCATGAGCACCATAGCACCATTGTCTCCACTCGCCATTACCGAGCACCAGAAGTCATCCTTGAGTTGGGCTGGTCACAGCCTTGT
GATGTGTGGAGTATAGGCTGCATCATCTTTGAATACTATGTGGGATTCACCCTCTTCCAGACCCATGACAACAGAGAGCATCTAGCCATG
ATGGAAAGGATCTTGGGTCCTATCCCTTCCCGGATGATCCGAAAGACAAGAAAGCAGAAATATTTTTACCGGGGTCGCCTGGATTGGGAT
GAGAACACATCAGCTGGGCGCTATGTTCGTGAGAACTGCAAACCGCTGCGGCGGTATCTGACCTCAGAGGCAGAGGAACACCACCAGCTC
TTCGATCTGATTGAAAGCATGCTAGAGTATGAACCAGCTAAGCGGCTGACCTTGGGTGAAGCCCTTCAGCATCCTTTCTTCGCCCGCCTT

>In-frame_RBM19_ENST00000261741_chr12_114364859_-_CLK2_ENST00000355560_chr1_155240768_-_3738nt
ATGTCGCGACTGATCGTGAAGAATCTCCCGAATGGGATGAAGGAGGAGCGTTTCAGGCAGCTGTTTGCCGCCTTCGGCACGCTGACAGAC
TGCAGCCTGAAGTTCACCAAAGATGGCAAGTTCCGCAAGTTTGGTTTTATTGGCTTCAAGTCCGAGGAAGAGGCCCAGAAGGCACAGAAG
CATTTCAACAAGAGCTTCATCGACACATCCCGGATCACAGTGGAGTTCTGCAAGTCATTCGGGGACCCGGCCAAACCCAGAGCCTGGAGC
AAACATGCCCAGAAACCAAGCCAGCCCAAGCAGCCTCCAAAAGACTCTACTACTCCAGAAATTAAGAAAGATGAGAAGAAGAAAAAGGTG
GCAGGTCAACTGGAGAAGCTGAAGGAGGATACAGAGTTCCAGGAGTTTCTGTCAGTTCATCAGAGGCGGGCGCAGGCAGCCACTTGGGCG
AATGATGGCCTGGATGCTGAGCCCTCGAAAGGGAAGAGCAAGCCGGCCAGTGACTACCTGAACTTCGACTCCGATTCTGGGCAGGAGAGT
GAGGAGGAGGGAGCCGGGGAGGACCTGGAAGAAGAGGCAAGCCTCGAACCAAAGGCAGCTGTGCAGAAGGAGCTGTCGGACATGGATTAC
CTGAAATCCAAGATGGTGAAGGCTGGGTCGTCCTCTTCCTCGGAGGAAGAGGAAAGTGAAGATGAAGCCGTGCACTGTGATGAAGGGAGT
GAGGCCGAGGAAGAGGATTCCTCCGCCACCCCAGTCCTGCAGGAAAGAGACAGCAAGGGTGCAGGCCAAGAGCAAGGGATGCCAGCTGGG
AAAAAGAGACCACCGGAGGCCAGAGCCGAGACAGAGAAACCAGCAAACCAGAAGGAACCCACCACCTGCCACACCGTGAAGCTGCGGGGA
GCCCCGTTCAATGTCACAGAGAAAAATGTTATGGAATTCCTGGCACCCCTGAAACCAGTGGCCATTCGAATTGTGAGAAACGCTCATGGG
AATAAAACAGGATACATCTTTGTGGATTTCAGCAATGAAGAGGAAGTGAAGCAAGCTCTGAAATGCAACCGGGAGTACATGGGTGGGCGC
TACATCGAGGTGTTCAGGGAAAAGAACGTCCCCACCACCAAGGGTGCACCAAAGAATACCACCAAATCCTGGCAAGGCCGGATACTCGGG
GAGAACGAAGAGGAGGAGGACCTGGCCGAATCCGGAAGGCTCTTTGTACGGAACCTGCCCTACACCAGCACCGAGGAGGATCTGGAGAAG
CTCTTCTCCAAATATGGTCCCCTGTCTGAGCTCCACTACCCCATCGACAGCCTGACCAAGAAACCCAAGGGTTTTGCATTCATCACCTTC
ATGTTCCCTGAGCACGCTGTGAAGGCCTACTCGGAGGTGGACGGGCAGGTATTCCAGGGCAGGATGCTCCACGTGTTACCATCTACCATC
AAGAAGGAAGCCAGCGAGGATGCCAGTGCCCTGGGATCGTCGTCCTACAAGAAGAAGAAGGAGGCCCAGGACAAAGCCAACAGTGCCAGC
TCTCACAACTGGAACACACTATTCATGGGGCCGAATGCCGTGGCCGATGCCATCGCACAGAAGTACAACGCCACCAAGAGTCAAGTGTTT
GACCACGAGACCAAGGGCAGCGTGGCCGTGCGCGTGGCTCTGGGGGAAACCCAGCTCGTCCAGGAAGTGCGGCGTTTTCTCATAGACAAC
GGGGTCAGCCTGGATTCCTTCAGCCAGGCTGCAGCAGAGCGAAGCAAGACTGTGATTCTGGTCAAGAACCTCCCGGCAGGCACCCTGGCG
GCCCAGCTGCAGGAGACCTTCGGCCATTTTGGCAGCCTGGGCCGCGTGCTGCTGCCAGAGGGCGGAATCACTGCCATCGTGGAGTTCCTG
GAGCCCCTGGAGGCCCGCAAGGCCTTCAGGCATCTGGCCTATTCCAAGTTCCATCATGTCCCCCTCTATCTGGAGTGGGCTCCAGTTGGC
GTCTTCTCCAGCACAGCCCCACAGAAGAAAAAGCTCCAAGACACACCTTCAGAACCCATGGAAAAGGACCCAGCAGAGCCAGAAACAGTG
CCTGATGGCGAAACCCCAGAAGATGAAAATCCAACAGAGGAAGGAGCAGACAACTCTTCAGCAAAGATGGAAGAGGAGGAGGAGGAAGAG
GAAGAAGAAGAAGAGAGCCTCCCAGGATGTACTCTGTTTATTAAGAATCTCAATTTTGACACAACAGAAGAGAAGCTGAAGGAAATGCCG
CATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGCCGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGAAGAAGT
CGCTCCTGGTCAAGTAGTAGTGACCGGACACGACGGCGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGTTATGATGATCGTTCG
TCCGACCGGAGGGTGTATGACCGGCGATACTGTGGCAGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTACTATGACACA
GACTATCGGCATTCCTATGAATATCAGCGGGAGAACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGGCGGAGGAGG
CGCAGCCGGACATTTAGCCGCTCATCTTCGCACAGCAGCCGGAGAGCCAAGAGTGTAGAGGACGACGCTGAGGGCCACCTCATCTACCAC
GTCGGGGACTGGCTACAAGAGCGATATGAAATCGTTAGCACCTTAGGAGAGGGGACCTTCGGCCGAGTTGTACAATGTGTTGACCATCGC
AGGGGTGGGGCTCGAGTTGCCCTGAAGATCATTAAGAATGTGGAGAAGTACAAGGAAGCAGCTCGACTTGAGATCAACGTGCTAGAGAAA
ATCAATGAGAAAGACCCTGACAACAAGAACCTCTGTGTCCAGATGTTTGACTGGTTTGACTACCATGGCCACATGTGTATCTCCTTTGAG
CTTCTGGGCCTTAGCACCTTCGATTTCCTCAAAGACAACAACTACCTGCCCTACCCCATCCACCAAGTGCGCCACATGGCCTTCCAGCTG
TGCCAGGCTGTCAAGTTCCTCCATGATAACAAGCTGACACATACAGACCTCAAGCCTGAAAATATTCTGTTTGTGAATTCAGACTATGAG
CTCACCTACAACCTAGAGAAGAAGCGAGATGAGCGCAGTGTGAAGAGCACAGCTGTGCGGGTGGTAGACTTTGGCAGTGCCACCTTTGAC
CATGAGCACCATAGCACCATTGTCTCCACTCGCCATTACCGAGCACCAGAAGTCATCCTTGAGTTGGGCTGGTCACAGCCTTGTGATGTG
TGGAGTATAGGCTGCATCATCTTTGAATACTATGTGGGATTCACCCTCTTCCAGACCCATGACAACAGAGAGCATCTAGCCATGATGGAA
AGGATCTTGGGTCCTATCCCTTCCCGGATGATCCGAAAGACAAGAAAGCAGAAATATTTTTACCGGGGTCGCCTGGATTGGGATGAGAAC
ACATCAGCTGGGCGCTATGTTCGTGAGAACTGCAAACCGCTGCGGCGGTATCTGACCTCAGAGGCAGAGGAACACCACCAGCTCTTCGAT
CTGATTGAAAGCATGCTAGAGTATGAACCAGCTAAGCGGCTGACCTTGGGTGAAGCCCTTCAGCATCCTTTCTTCGCCCGCCTTCGGGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_RBM19_ENST00000261741_chr12_114364859_-_CLK2_ENST00000361168_chr1_155240768_-_4235nt
CTTCCGGACAGGTCAGGCCAAGGTCTCAGCCACGTGACTGTGTTCCGGCTCGGTAAAGATGGCGGCGCCCAGGGCGGTAGCGTGAAACTT
GGTGGAAGACGCTGACCAGTCGTGTTGGAATCAAAACAGCGGGGACCCTGCGCCATGTCGCGACTGATCGTGAAGAATCTCCCGAATGGG
ATGAAGGAGGAGCGTTTCAGGCAGCTGTTTGCCGCCTTCGGCACGCTGACAGACTGCAGCCTGAAGTTCACCAAAGATGGCAAGTTCCGC
AAGTTTGGTTTTATTGGCTTCAAGTCCGAGGAAGAGGCCCAGAAGGCACAGAAGCATTTCAACAAGAGCTTCATCGACACATCCCGGATC
ACAGTGGAGTTCTGCAAGTCATTCGGGGACCCGGCCAAACCCAGAGCCTGGAGCAAACATGCCCAGAAACCAAGCCAGCCCAAGCAGCCT
CCAAAAGACTCTACTACTCCAGAAATTAAGAAAGATGAGAAGAAGAAAAAGGTGGCAGGTCAACTGGAGAAGCTGAAGGAGGATACAGAG
TTCCAGGAGTTTCTGTCAGTTCATCAGAGGCGGGCGCAGGCAGCCACTTGGGCGAATGATGGCCTGGATGCTGAGCCCTCGAAAGGGAAG
AGCAAGCCGGCCAGTGACTACCTGAACTTCGACTCCGATTCTGGGCAGGAGAGTGAGGAGGAGGGAGCCGGGGAGGACCTGGAAGAAGAG
GCAAGCCTCGAACCAAAGGCAGCTGTGCAGAAGGAGCTGTCGGACATGGATTACCTGAAATCCAAGATGGTGAAGGCTGGGTCGTCCTCT
TCCTCGGAGGAAGAGGAAAGTGAAGATGAAGCCGTGCACTGTGATGAAGGGAGTGAGGCCGAGGAAGAGGATTCCTCCGCCACCCCAGTC
CTGCAGGAAAGAGACAGCAAGGGTGCAGGCCAAGAGCAAGGGATGCCAGCTGGGAAAAAGAGACCACCGGAGGCCAGAGCCGAGACAGAG
AAACCAGCAAACCAGAAGGAACCCACCACCTGCCACACCGTGAAGCTGCGGGGAGCCCCGTTCAATGTCACAGAGAAAAATGTTATGGAA
TTCCTGGCACCCCTGAAACCAGTGGCCATTCGAATTGTGAGAAACGCTCATGGGAATAAAACAGGATACATCTTTGTGGATTTCAGCAAT
GAAGAGGAAGTGAAGCAAGCTCTGAAATGCAACCGGGAGTACATGGGTGGGCGCTACATCGAGGTGTTCAGGGAAAAGAACGTCCCCACC
ACCAAGGGTGCACCAAAGAATACCACCAAATCCTGGCAAGGCCGGATACTCGGGGAGAACGAAGAGGAGGAGGACCTGGCCGAATCCGGA
AGGCTCTTTGTACGGAACCTGCCCTACACCAGCACCGAGGAGGATCTGGAGAAGCTCTTCTCCAAATATGGTCCCCTGTCTGAGCTCCAC
TACCCCATCGACAGCCTGACCAAGAAACCCAAGGGTTTTGCATTCATCACCTTCATGTTCCCTGAGCACGCTGTGAAGGCCTACTCGGAG
GTGGACGGGCAGGTATTCCAGGGCAGGATGCTCCACGTGTTACCATCTACCATCAAGAAGGAAGCCAGCGAGGATGCCAGTGCCCTGGGA
TCGTCGTCCTACAAGAAGAAGAAGGAGGCCCAGGACAAAGCCAACAGTGCCAGCTCTCACAACTGGAACACACTATTCATGGGGCCGAAT
GCCGTGGCCGATGCCATCGCACAGAAGTACAACGCCACCAAGAGTCAAGTGTTTGACCACGAGACCAAGGGCAGCGTGGCCGTGCGCGTG
GCTCTGGGGGAAACCCAGCTCGTCCAGGAAGTGCGGCGTTTTCTCATAGACAACGGGGTCAGCCTGGATTCCTTCAGCCAGGCTGCAGCA
GAGCGAAGCAAGACTGTGATTCTGGTCAAGAACCTCCCGGCAGGCACCCTGGCGGCCCAGCTGCAGGAGACCTTCGGCCATTTTGGCAGC
CTGGGCCGCGTGCTGCTGCCAGAGGGCGGAATCACTGCCATCGTGGAGTTCCTGGAGCCCCTGGAGGCCCGCAAGGCCTTCAGGCATCTG
GCCTATTCCAAGTTCCATCATGTCCCCCTCTATCTGGAGTGGGCTCCAGTTGGCGTCTTCTCCAGCACAGCCCCACAGAAGAAAAAGCTC
CAAGACACACCTTCAGAACCCATGGAAAAGGACCCAGCAGAGCCAGAAACAGTGCCTGATGGCGAAACCCCAGAAGATGAAAATCCAACA
GAGGAAGGAGCAGACAACTCTTCAGCAAAGATGGAAGAGGAGGAGGAGGAAGAGGAAGAAGAAGAAGAGAGCCTCCCAGGATGTACTCTG
TTTATTAAGAATCTCAATTTTGACACAACAGAAGAGAAGCTGAAGGAAATGCCGCATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGC
CGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGAAGAAGTCGCTCCTGGTCAAGTAGTAGTGACCGGACACGACGG
CGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGCAGTTATGATGATCGTTCGTCCGACCGGAGGGTGTATGACCGGCGATACTGT
GGCAGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTACTATGACACAGACTATCGGCATTCCTATGAATATCAGCGGGAG
AACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGGCGGAGGAGGCGCAGCCGGACATTTAGCCGCTCATCTTCGCAC
AGCAGCCGGAGAGCCAAGAGTGTAGAGGACGACGCTGAGGGCCACCTCATCTACCACGTCGGGGACTGGCTACAAGAGCGATATGAAATC
GTTAGCACCTTAGGAGAGGGGACCTTCGGCCGAGTTGTACAATGTGTTGACCATCGCAGGGGTGGGGCTCGAGTTGCCCTGAAGATCATT
AAGAATGTGGAGAAGTACAAGGAAGCAGCTCGACTTGAGATCAACGTGCTAGAGAAAATCAATGAGAAAGACCCTGACAACAAGAACCTC
TGTGTCCAGATGTTTGACTGGTTTGACTACCATGGCCACATGTGTATCTCCTTTGAGCTTCTGGGCCTTAGCACCTTCGATTTCCTCAAA
GACAACAACTACCTGCCCTACCCCATCCACCAAGTGCGCCACATGGCCTTCCAGCTGTGCCAGGCTGTCAAGTTCCTCCATGATAACAAG
CTGACACATACAGACCTCAAGCCTGAAAATATTCTGTTTGTGAATTCAGACTATGAGCTCACCTACAACCTAGAGAAGAAGCGAGATGAG
CGCAGTGTGAAGAGCACAGCTGTGCGGGTGGTAGACTTTGGCAGTGCCACCTTTGACCATGAGCACCATAGCACCATTGTCTCCACTCGC
CATTACCGAGCACCAGAAGTCATCCTTGAGTTGGGCTGGTCACAGCCTTGTGATGTGTGGAGTATAGGCTGCATCATCTTTGAATACTAT
GTGGGATTCACCCTCTTCCAGACCCATGACAACAGAGAGCATCTAGCCATGATGGAAAGGATCTTGGGTCCTATCCCTTCCCGGATGATC
CGAAAGACAAGAAAGCAGAAATATTTTTACCGGGGTCGCCTGGATTGGGATGAGAACACATCAGCTGGGCGCTATGTTCGTGAGAACTGC
AAACCGCTGCGGCGGTATCTGACCTCAGAGGCAGAGGAACACCACCAGCTCTTCGATCTGATTGAAAGCATGCTAGAGTATGAACCAGCT
AAGCGGCTGACCTTGGGTGAAGCCCTTCAGCATCCTTTCTTCGCCCGCCTTCGGGCTGAGCCGCCCAACAAGTTGTGGGACTCCAGTCGG
GATATCAGTCGGTGACGATCAGGCCCTGGGCCCCCCTGCATCTTTTATAGCAGTGGGTGTCCAGTCCAGGACACTGGTGCTTTTTTATAC
AAGAGAACGAGCCAGAGTTCACTCCTTCCTCCTGGCTCTCTATATACCTGTGAATATGTGAAATAGTGTAAATATGAAAGAACTTGTACC
TATCACTTCAACCCCTGCCTTGTACATAATACTATTCCATCCACACAGTTTCCACCCTCACCTGCCCCCTCATACGGAGTTGGATGGGGG
CCGAGTGAGGTAACCAGGTGGCATCTACCCCATGTTTTATAAGGAATTTTGTACAGTCTTTGTGAAATAAAATAACGTGCTTCATTTGAC

>In-frame_RBM19_ENST00000261741_chr12_114364859_-_CLK2_ENST00000368361_chr1_155240768_-_4238nt
CTTCCGGACAGGTCAGGCCAAGGTCTCAGCCACGTGACTGTGTTCCGGCTCGGTAAAGATGGCGGCGCCCAGGGCGGTAGCGTGAAACTT
GGTGGAAGACGCTGACCAGTCGTGTTGGAATCAAAACAGCGGGGACCCTGCGCCATGTCGCGACTGATCGTGAAGAATCTCCCGAATGGG
ATGAAGGAGGAGCGTTTCAGGCAGCTGTTTGCCGCCTTCGGCACGCTGACAGACTGCAGCCTGAAGTTCACCAAAGATGGCAAGTTCCGC
AAGTTTGGTTTTATTGGCTTCAAGTCCGAGGAAGAGGCCCAGAAGGCACAGAAGCATTTCAACAAGAGCTTCATCGACACATCCCGGATC
ACAGTGGAGTTCTGCAAGTCATTCGGGGACCCGGCCAAACCCAGAGCCTGGAGCAAACATGCCCAGAAACCAAGCCAGCCCAAGCAGCCT
CCAAAAGACTCTACTACTCCAGAAATTAAGAAAGATGAGAAGAAGAAAAAGGTGGCAGGTCAACTGGAGAAGCTGAAGGAGGATACAGAG
TTCCAGGAGTTTCTGTCAGTTCATCAGAGGCGGGCGCAGGCAGCCACTTGGGCGAATGATGGCCTGGATGCTGAGCCCTCGAAAGGGAAG
AGCAAGCCGGCCAGTGACTACCTGAACTTCGACTCCGATTCTGGGCAGGAGAGTGAGGAGGAGGGAGCCGGGGAGGACCTGGAAGAAGAG
GCAAGCCTCGAACCAAAGGCAGCTGTGCAGAAGGAGCTGTCGGACATGGATTACCTGAAATCCAAGATGGTGAAGGCTGGGTCGTCCTCT
TCCTCGGAGGAAGAGGAAAGTGAAGATGAAGCCGTGCACTGTGATGAAGGGAGTGAGGCCGAGGAAGAGGATTCCTCCGCCACCCCAGTC
CTGCAGGAAAGAGACAGCAAGGGTGCAGGCCAAGAGCAAGGGATGCCAGCTGGGAAAAAGAGACCACCGGAGGCCAGAGCCGAGACAGAG
AAACCAGCAAACCAGAAGGAACCCACCACCTGCCACACCGTGAAGCTGCGGGGAGCCCCGTTCAATGTCACAGAGAAAAATGTTATGGAA
TTCCTGGCACCCCTGAAACCAGTGGCCATTCGAATTGTGAGAAACGCTCATGGGAATAAAACAGGATACATCTTTGTGGATTTCAGCAAT
GAAGAGGAAGTGAAGCAAGCTCTGAAATGCAACCGGGAGTACATGGGTGGGCGCTACATCGAGGTGTTCAGGGAAAAGAACGTCCCCACC
ACCAAGGGTGCACCAAAGAATACCACCAAATCCTGGCAAGGCCGGATACTCGGGGAGAACGAAGAGGAGGAGGACCTGGCCGAATCCGGA
AGGCTCTTTGTACGGAACCTGCCCTACACCAGCACCGAGGAGGATCTGGAGAAGCTCTTCTCCAAATATGGTCCCCTGTCTGAGCTCCAC
TACCCCATCGACAGCCTGACCAAGAAACCCAAGGGTTTTGCATTCATCACCTTCATGTTCCCTGAGCACGCTGTGAAGGCCTACTCGGAG
GTGGACGGGCAGGTATTCCAGGGCAGGATGCTCCACGTGTTACCATCTACCATCAAGAAGGAAGCCAGCGAGGATGCCAGTGCCCTGGGA
TCGTCGTCCTACAAGAAGAAGAAGGAGGCCCAGGACAAAGCCAACAGTGCCAGCTCTCACAACTGGAACACACTATTCATGGGGCCGAAT
GCCGTGGCCGATGCCATCGCACAGAAGTACAACGCCACCAAGAGTCAAGTGTTTGACCACGAGACCAAGGGCAGCGTGGCCGTGCGCGTG
GCTCTGGGGGAAACCCAGCTCGTCCAGGAAGTGCGGCGTTTTCTCATAGACAACGGGGTCAGCCTGGATTCCTTCAGCCAGGCTGCAGCA
GAGCGAAGCAAGACTGTGATTCTGGTCAAGAACCTCCCGGCAGGCACCCTGGCGGCCCAGCTGCAGGAGACCTTCGGCCATTTTGGCAGC
CTGGGCCGCGTGCTGCTGCCAGAGGGCGGAATCACTGCCATCGTGGAGTTCCTGGAGCCCCTGGAGGCCCGCAAGGCCTTCAGGCATCTG
GCCTATTCCAAGTTCCATCATGTCCCCCTCTATCTGGAGTGGGCTCCAGTTGGCGTCTTCTCCAGCACAGCCCCACAGAAGAAAAAGCTC
CAAGACACACCTTCAGAACCCATGGAAAAGGACCCAGCAGAGCCAGAAACAGTGCCTGATGGCGAAACCCCAGAAGATGAAAATCCAACA
GAGGAAGGAGCAGACAACTCTTCAGCAAAGATGGAAGAGGAGGAGGAGGAAGAGGAAGAAGAAGAAGAGAGCCTCCCAGGATGTACTCTG
TTTATTAAGAATCTCAATTTTGACACAACAGAAGAGAAGCTGAAGGAAATGCCGCATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGC
CGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGAAGAAGTCGCTCCTGGTCAAGTAGTAGTGACCGGACACGACGG
CGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGCAGTTATGATGATCGTTCGTCCGACCGGAGGGTGTATGACCGGCGATACTGT
GGCAGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTACTATGACACAGACTATCGGCATTCCTATGAATATCAGCGGGAG
AACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGGCGGAGGAGGCGCAGCCGGACATTTAGCCGCTCATCTTCGCAG
CACAGCAGCCGGAGAGCCAAGAGTGTAGAGGACGACGCTGAGGGCCACCTCATCTACCACGTCGGGGACTGGCTACAAGAGCGATATGAA
ATCGTTAGCACCTTAGGAGAGGGGACCTTCGGCCGAGTTGTACAATGTGTTGACCATCGCAGGGGTGGGGCTCGAGTTGCCCTGAAGATC
ATTAAGAATGTGGAGAAGTACAAGGAAGCAGCTCGACTTGAGATCAACGTGCTAGAGAAAATCAATGAGAAAGACCCTGACAACAAGAAC
CTCTGTGTCCAGATGTTTGACTGGTTTGACTACCATGGCCACATGTGTATCTCCTTTGAGCTTCTGGGCCTTAGCACCTTCGATTTCCTC
AAAGACAACAACTACCTGCCCTACCCCATCCACCAAGTGCGCCACATGGCCTTCCAGCTGTGCCAGGCTGTCAAGTTCCTCCATGATAAC
AAGCTGACACATACAGACCTCAAGCCTGAAAATATTCTGTTTGTGAATTCAGACTATGAGCTCACCTACAACCTAGAGAAGAAGCGAGAT
GAGCGCAGTGTGAAGAGCACAGCTGTGCGGGTGGTAGACTTTGGCAGTGCCACCTTTGACCATGAGCACCATAGCACCATTGTCTCCACT
CGCCATTACCGAGCACCAGAAGTCATCCTTGAGTTGGGCTGGTCACAGCCTTGTGATGTGTGGAGTATAGGCTGCATCATCTTTGAATAC
TATGTGGGATTCACCCTCTTCCAGACCCATGACAACAGAGAGCATCTAGCCATGATGGAAAGGATCTTGGGTCCTATCCCTTCCCGGATG
ATCCGAAAGACAAGAAAGCAGAAATATTTTTACCGGGGTCGCCTGGATTGGGATGAGAACACATCAGCTGGGCGCTATGTTCGTGAGAAC
TGCAAACCGCTGCGGCGGTATCTGACCTCAGAGGCAGAGGAACACCACCAGCTCTTCGATCTGATTGAAAGCATGCTAGAGTATGAACCA
GCTAAGCGGCTGACCTTGGGTGAAGCCCTTCAGCATCCTTTCTTCGCCCGCCTTCGGGCTGAGCCGCCCAACAAGTTGTGGGACTCCAGT
CGGGATATCAGTCGGTGACGATCAGGCCCTGGGCCCCCCTGCATCTTTTATAGCAGTGGGTGTCCAGTCCAGGACACTGGTGCTTTTTTA
TACAAGAGAACGAGCCAGAGTTCACTCCTTCCTCCTGGCTCTCTATATACCTGTGAATATGTGAAATAGTGTAAATATGAAAGAACTTGT
ACCTATCACTTCAACCCCTGCCTTGTACATAATACTATTCCATCCACACAGTTTCCACCCTCACCTGCCCCCTCATACGGAGTTGGATGG
GGGCCGAGTGAGGTAACCAGGTGGCATCTACCCCATGTTTTATAAGGAATTTTGTACAGTCTTTGTGAAATAAAATAACGTGCTTCATTT

>In-frame_RBM19_ENST00000261741_chr12_114364859_-_CLK2_ENST00000355560_chr1_155240768_-_4226nt
CTTCCGGACAGGTCAGGCCAAGGTCTCAGCCACGTGACTGTGTTCCGGCTCGGTAAAGATGGCGGCGCCCAGGGCGGTAGCGTGAAACTT
GGTGGAAGACGCTGACCAGTCGTGTTGGAATCAAAACAGCGGGGACCCTGCGCCATGTCGCGACTGATCGTGAAGAATCTCCCGAATGGG
ATGAAGGAGGAGCGTTTCAGGCAGCTGTTTGCCGCCTTCGGCACGCTGACAGACTGCAGCCTGAAGTTCACCAAAGATGGCAAGTTCCGC
AAGTTTGGTTTTATTGGCTTCAAGTCCGAGGAAGAGGCCCAGAAGGCACAGAAGCATTTCAACAAGAGCTTCATCGACACATCCCGGATC
ACAGTGGAGTTCTGCAAGTCATTCGGGGACCCGGCCAAACCCAGAGCCTGGAGCAAACATGCCCAGAAACCAAGCCAGCCCAAGCAGCCT
CCAAAAGACTCTACTACTCCAGAAATTAAGAAAGATGAGAAGAAGAAAAAGGTGGCAGGTCAACTGGAGAAGCTGAAGGAGGATACAGAG
TTCCAGGAGTTTCTGTCAGTTCATCAGAGGCGGGCGCAGGCAGCCACTTGGGCGAATGATGGCCTGGATGCTGAGCCCTCGAAAGGGAAG
AGCAAGCCGGCCAGTGACTACCTGAACTTCGACTCCGATTCTGGGCAGGAGAGTGAGGAGGAGGGAGCCGGGGAGGACCTGGAAGAAGAG
GCAAGCCTCGAACCAAAGGCAGCTGTGCAGAAGGAGCTGTCGGACATGGATTACCTGAAATCCAAGATGGTGAAGGCTGGGTCGTCCTCT
TCCTCGGAGGAAGAGGAAAGTGAAGATGAAGCCGTGCACTGTGATGAAGGGAGTGAGGCCGAGGAAGAGGATTCCTCCGCCACCCCAGTC
CTGCAGGAAAGAGACAGCAAGGGTGCAGGCCAAGAGCAAGGGATGCCAGCTGGGAAAAAGAGACCACCGGAGGCCAGAGCCGAGACAGAG
AAACCAGCAAACCAGAAGGAACCCACCACCTGCCACACCGTGAAGCTGCGGGGAGCCCCGTTCAATGTCACAGAGAAAAATGTTATGGAA
TTCCTGGCACCCCTGAAACCAGTGGCCATTCGAATTGTGAGAAACGCTCATGGGAATAAAACAGGATACATCTTTGTGGATTTCAGCAAT
GAAGAGGAAGTGAAGCAAGCTCTGAAATGCAACCGGGAGTACATGGGTGGGCGCTACATCGAGGTGTTCAGGGAAAAGAACGTCCCCACC
ACCAAGGGTGCACCAAAGAATACCACCAAATCCTGGCAAGGCCGGATACTCGGGGAGAACGAAGAGGAGGAGGACCTGGCCGAATCCGGA
AGGCTCTTTGTACGGAACCTGCCCTACACCAGCACCGAGGAGGATCTGGAGAAGCTCTTCTCCAAATATGGTCCCCTGTCTGAGCTCCAC
TACCCCATCGACAGCCTGACCAAGAAACCCAAGGGTTTTGCATTCATCACCTTCATGTTCCCTGAGCACGCTGTGAAGGCCTACTCGGAG
GTGGACGGGCAGGTATTCCAGGGCAGGATGCTCCACGTGTTACCATCTACCATCAAGAAGGAAGCCAGCGAGGATGCCAGTGCCCTGGGA
TCGTCGTCCTACAAGAAGAAGAAGGAGGCCCAGGACAAAGCCAACAGTGCCAGCTCTCACAACTGGAACACACTATTCATGGGGCCGAAT
GCCGTGGCCGATGCCATCGCACAGAAGTACAACGCCACCAAGAGTCAAGTGTTTGACCACGAGACCAAGGGCAGCGTGGCCGTGCGCGTG
GCTCTGGGGGAAACCCAGCTCGTCCAGGAAGTGCGGCGTTTTCTCATAGACAACGGGGTCAGCCTGGATTCCTTCAGCCAGGCTGCAGCA
GAGCGAAGCAAGACTGTGATTCTGGTCAAGAACCTCCCGGCAGGCACCCTGGCGGCCCAGCTGCAGGAGACCTTCGGCCATTTTGGCAGC
CTGGGCCGCGTGCTGCTGCCAGAGGGCGGAATCACTGCCATCGTGGAGTTCCTGGAGCCCCTGGAGGCCCGCAAGGCCTTCAGGCATCTG
GCCTATTCCAAGTTCCATCATGTCCCCCTCTATCTGGAGTGGGCTCCAGTTGGCGTCTTCTCCAGCACAGCCCCACAGAAGAAAAAGCTC
CAAGACACACCTTCAGAACCCATGGAAAAGGACCCAGCAGAGCCAGAAACAGTGCCTGATGGCGAAACCCCAGAAGATGAAAATCCAACA
GAGGAAGGAGCAGACAACTCTTCAGCAAAGATGGAAGAGGAGGAGGAGGAAGAGGAAGAAGAAGAAGAGAGCCTCCCAGGATGTACTCTG
TTTATTAAGAATCTCAATTTTGACACAACAGAAGAGAAGCTGAAGGAAATGCCGCATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGC
CGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGAAGAAGTCGCTCCTGGTCAAGTAGTAGTGACCGGACACGACGG
CGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGTTATGATGATCGTTCGTCCGACCGGAGGGTGTATGACCGGCGATACTGTGGC
AGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTACTATGACACAGACTATCGGCATTCCTATGAATATCAGCGGGAGAAC
AGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGGCGGAGGAGGCGCAGCCGGACATTTAGCCGCTCATCTTCGCACAGC
AGCCGGAGAGCCAAGAGTGTAGAGGACGACGCTGAGGGCCACCTCATCTACCACGTCGGGGACTGGCTACAAGAGCGATATGAAATCGTT
AGCACCTTAGGAGAGGGGACCTTCGGCCGAGTTGTACAATGTGTTGACCATCGCAGGGGTGGGGCTCGAGTTGCCCTGAAGATCATTAAG
AATGTGGAGAAGTACAAGGAAGCAGCTCGACTTGAGATCAACGTGCTAGAGAAAATCAATGAGAAAGACCCTGACAACAAGAACCTCTGT
GTCCAGATGTTTGACTGGTTTGACTACCATGGCCACATGTGTATCTCCTTTGAGCTTCTGGGCCTTAGCACCTTCGATTTCCTCAAAGAC
AACAACTACCTGCCCTACCCCATCCACCAAGTGCGCCACATGGCCTTCCAGCTGTGCCAGGCTGTCAAGTTCCTCCATGATAACAAGCTG
ACACATACAGACCTCAAGCCTGAAAATATTCTGTTTGTGAATTCAGACTATGAGCTCACCTACAACCTAGAGAAGAAGCGAGATGAGCGC
AGTGTGAAGAGCACAGCTGTGCGGGTGGTAGACTTTGGCAGTGCCACCTTTGACCATGAGCACCATAGCACCATTGTCTCCACTCGCCAT
TACCGAGCACCAGAAGTCATCCTTGAGTTGGGCTGGTCACAGCCTTGTGATGTGTGGAGTATAGGCTGCATCATCTTTGAATACTATGTG
GGATTCACCCTCTTCCAGACCCATGACAACAGAGAGCATCTAGCCATGATGGAAAGGATCTTGGGTCCTATCCCTTCCCGGATGATCCGA
AAGACAAGAAAGCAGAAATATTTTTACCGGGGTCGCCTGGATTGGGATGAGAACACATCAGCTGGGCGCTATGTTCGTGAGAACTGCAAA
CCGCTGCGGCGGTATCTGACCTCAGAGGCAGAGGAACACCACCAGCTCTTCGATCTGATTGAAAGCATGCTAGAGTATGAACCAGCTAAG
CGGCTGACCTTGGGTGAAGCCCTTCAGCATCCTTTCTTCGCCCGCCTTCGGGCTGAGCCGCCCAACAAGTTGTGGGACTCCAGTCGGGAT
ATCAGTCGGTGACGATCAGGCCCTGGGCCCCCCTGCATCTTTTATAGCAGTGGGTGTCCAGTCCAGGACACTGGTGCTTTTTTATACAAG
AGAACGAGCCAGAGTTCACTCCTTCCTCCTGGCTCTCTATATACCTGTGAATATGTGAAATAGTGTAAATATGAAAGAACTTGTACCTAT
CACTTCAACCCCTGCCTTGTACATAATACTATTCCATCCACACAGTTTCCACCCTCACCTGCCCCCTCATACGGAGTTGGATGGGGGCCG


Top

FusionGenePPI for RBM19_CLK2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RBM19FTSJ3, PTPN12, NXF1, FBXW11, HIST1H1A, NOL12, NIFK, ZC3H3, RPS8, BYSL, DDX27, DHX37, FBL, GRWD1, NOL10, RRP12, UTP18, TSR1, UTP15, IFI16, SRPK2, MEX3C, HIST1H1E, RPS14, HIST1H1T, GPATCH4, ZC3HAV1, ZCRB1, FGF3, FGF8, ZNF2, RPL7, RPL18, CDX1, H2AFY2, H2AFX, ZBTB48, RRS1, FOXA1, TRIM25CLK2CLK3, UBL5, FANCM, C19orf40, YWHAG, HSP90AA1, AKT1, SNRNP70, PNN, HNRNPM, LUC7L, TNPO3, CLK2, HUWE1, PSME3, SKIV2L2, ZCCHC8, BCLAF1, CPSF1, FIP1L1, RBBP6, WDR33, PPHLN1, RBM7, ACIN1, PABPC1, SETD2, PKP2, THRAP3, CPSF2, RBM39, SON, ZNF30, HNRNPF, CPSF4, CDKN2A, ECE1, TRIM27, SDCBP, SRPK2, U2AF1, UBE2I, ZRSR2, ZNF263, SRRM1, RNPS1, KLHL2, ZNF473, MRPL4, LUZP4, RSRP1, ZNF398, GMCL1, SNIP1, CPSF7, ZNF394, LNX1, PRPF38A, YTHDC1, BRCA1, EED, TRA2A, LUC7L2, TBC1D9B, NKTR, ZC3H18, CLK1, RBMXL1, SRSF8, ELAVL2, CLASRP, GPATCH8, ZNF638, C11orf57, SRSF12, MDK, SRSF10, NCOA5, EPB41L2, RSBN1L, C17orf85, GPALPP1, APOBEC3D, U2AF2, CDX1, ZC3H14, GSPT2, REPIN1, SRRT, JPH4, CASC3, PRPF4B, PTPN1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RBM19_CLK2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RBM19_CLK2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource