FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30545

FusionGeneSummary for RASGRF1_HCN4

check button Fusion gene summary
Fusion gene informationFusion gene name: RASGRF1_HCN4
Fusion gene ID: 30545
HgeneTgene
Gene symbol

RASGRF1

HCN4

Gene ID

5923

10021

Gene nameRas protein specific guanine nucleotide releasing factor 1hyperpolarization activated cyclic nucleotide gated potassium channel 4
SynonymsCDC25|CDC25L|GNRP|GRF1|GRF55|H-GRF55|PP13187|ras-GRF1SSS2
Cytomap

15q25.1

15q24.1

Type of geneprotein-codingprotein-coding
Descriptionras-specific guanine nucleotide-releasing factor 1Ras-specific guanine nucleotide-releasing factor, CDC25 homologRas-specific nucleotide exchange factor CDC25guanine nucleotide exchange factorguanine nucleotide-releasing factor 1guanine nucleotide-repotassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4hyperpolarization activated cyclic nucleotide-gated cation channel 4
Modification date2018051920180522
UniProtAcc

Q13972

Q9Y3Q4

Ensembl transtripts involved in fusion geneENST00000558480, ENST00000419573, 
ENST00000560334, ENST00000394745, 
ENST00000261917, 
Fusion gene scores* DoF score3 X 3 X 3=271 X 1 X 1=1
# samples 31
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: RASGRF1 [Title/Abstract] AND HCN4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneHCN4

GO:0003254

regulation of membrane depolarization

12750403

TgeneHCN4

GO:0006812

cation transport

12750403

TgeneHCN4

GO:0071320

cellular response to cAMP

12750403|16407510|22748890

TgeneHCN4

GO:0071321

cellular response to cGMP

22748890

TgeneHCN4

GO:0071805

potassium ion transmembrane transport

16407510

TgeneHCN4

GO:0098719

sodium ion import across plasma membrane

10228147

TgeneHCN4

GO:1990573

potassium ion import across plasma membrane

10228147


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-FX-A3TO-01ARASGRF1chr15

79264208

-HCN4chr15

73636149

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000558480ENST00000261917RASGRF1chr15

79264208

-HCN4chr15

73636149

-
Frame-shitENST00000419573ENST00000261917RASGRF1chr15

79264208

-HCN4chr15

73636149

-
intron-3CDSENST00000560334ENST00000261917RASGRF1chr15

79264208

-HCN4chr15

73636149

-
In-frameENST00000394745ENST00000261917RASGRF1chr15

79264208

-HCN4chr15

73636149

-

Top

FusionProtFeatures for RASGRF1_HCN4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RASGRF1

Q13972

HCN4

Q9Y3Q4

Promotes the exchange of Ras-bound GDP by GTP.{ECO:0000269|PubMed:11389730}. Hyperpolarization-activated ion channel with very slowactivation and inactivation exhibiting weak selectivity forpotassium over sodium ions. Contributes to the native pacemakercurrents in heart (If) that regulate the rhythm of heart beat. Maycontribute to the native pacemaker currents in neurons (Ih). Maymediate responses to sour stimuli. {ECO:0000269|PubMed:10228147,ECO:0000269|PubMed:10430953, ECO:0000269|PubMed:16407510,ECO:0000269|PubMed:19165230, ECO:0000269|PubMed:20829353}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for RASGRF1_HCN4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RASGRF1_ENST00000394745_chr15_79264208_-_HCN4_ENST00000261917_chr15_73636149_-_942aa
ILLGPDHAAADGGKPDYHSCGHHLLQGXEHHTLDCLQCGVRHILPHRLGPQLPHRDRGGGQHRDHPGPAADXNEVPEKLVHGRFHFLHPR
GLHLPHCGDTHRLGGLQDCPGPAHCPLHEDPQPLTPVTPLPPHSIYSPVGRDLPHDLRPGQRRGAHREPHRHDAPALPLGRLPAVPGTHA
TGLPXRLLGVHQQHGEQLLGEAVLLRALQGHEPHAVHRLRAAGARGHVRRLAHHAQHDRGCHLLRHVHWPRHCPHPVPGLLPAPVPGKVQ
AGGAVHVLSQAPARHPAAHPRLLRAPLPGQDVRRGEHPGRAKRAPAGGDHQLXLSEAGGLHATVCQCGPQLRDVHADQAAFRGLPAWGLH
HPGRHHWQEDVLHPAWRGQRAHQGQQGDQAGRRLLLWRDLPADPGPAHSQREGRHLLPPLLAERGQLQXGAGGVPHDAKGLRDRGAGPPG
PHWQEELHPPPQSPARPQLRRLQLPGEXDHPADCAAXPGDGPLRAPRPGCCLCHPNPHARHLDPADPGTTAGCRCHHFCGHSPHPPPSPA
CCHLPPSPRIWAGQPRCRADAKAPETAAVPDPFCAGLRLARQQPVPGGHTVFILLPHPTAGWILCPRWTEPTPALIQLLPTPRGLWLPLG
SHTISWRSRHHHSRVWPLPQGAGWLPVLLRLSPAHPAAARRPLPAGCPAISRATRGPGRPGTPGALPATPTLIQIPVIXPRAAGPASRGV
VPRSGHWPTEHARDTPTAAXAAVPCGRGLWGGFPCRLYSPRRSQPPWPQPRPPKNLPECPAPGLWLPRILAPATCIQPPTTPGPPAPGHT
PAHPRPPHPGPQAHLRVSASPASGRGADSPQSLPALLRGVHGCLPALPQGWGWQRGQWEQRGPRSPWEALWCHPRPARHSASEDILRFFA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RASGRF1_ENST00000394745_chr15_79264208_-_HCN4_ENST00000261917_chr15_73636149_-_2827nt
ATTTTACTGGGACCTGACCATGCTGCTGCTGATGGTGGGAAACCTGATTATCATTCCTGTGGGCATCACCTTCTTCAAGGATGAGAACAC
CACACCCTGGATTGTCTTCAATGTGGTGTCAGACACATTCTTCCTCATCGACTTGGTCCTCAACTTCCGCACAGGGATCGTGGTGGAGGA
CAACACAGAGATCATCCTGGACCCGCAGCGGATTAAAATGAAGTACCTGAAAAGCTGGTTCATGGTAGATTTCATTTCCTCCATCCCCGT
GGACTACATCTTCCTCATTGTGGAGACACGCATCGACTCGGAGGTCTACAAGACTGCCCGGGCCCTGCGCATTGTCCGCTTCACGAAGAT
CCTCAGCCTCTTACGCCTGTTACGCCTCTCCCGCCTCATTCGATATATTCACCAGTGGGAAGAGATCTTCCACATGACCTACGACCTGGC
CAGCGCCGTGGTGCGCATCGTGAACCTCATCGGCATGATGCTCCTGCTCTGCCACTGGGACGGCTGCCTGCAGTTCCTGGTACCCATGCT
ACAGGACTTCCCTGACGACTGCTGGGTGTCCATCAACAACATGGTGAACAACTCCTGGGGGAAGCAGTACTCCTACGCGCTCTTCAAGGC
CATGAGCCACATGCTGTGCATCGGCTACGGGCGGCAGGCGCCCGTGGGCATGTCCGACGTCTGGCTCACCATGCTCAGCATGATCGTGGG
TGCCACCTGCTACGCCATGTTCATTGGCCACGCCACTGCCCTCATCCAGTCCCTGGACTCCTCCCGGCGCCAGTACCAGGAAAAGTACAA
GCAGGTGGAGCAGTACATGTCCTTTCACAAGCTCCCGCCCGACACCCGGCAGCGCATCCACGACTACTACGAGCACCGCTACCAGGGCAA
GATGTTCGACGAGGAGAGCATCCTGGGCGAGCTAAGCGAGCCCCTGCGGGAGGAGATCATCAACTTTAACTGTCGGAAGCTGGTGGCCTC
CATGCCACTGTTTGCCAATGCGGACCCCAACTTCGTGACGTCCATGCTGACCAAGCTGCGTTTCGAGGTCTTCCAGCCTGGGGACTACAT
CATCCGGGAAGGCACCATTGGCAAGAAGATGTACTTCATCCAGCATGGCGTGGTCAGCGTGCTCACCAAGGGCAACAAGGAGACCAAGCT
GGCCGACGGCTCCTACTTTGGAGAGATCTGCCTGCTGACCCGGGGCCGGCGCACAGCCAGCGTGAGGGCCGACACCTACTGCCGCCTCTA
CTCGCTGAGCGTGGACAACTTCAATGAGGTGCTGGAGGAGTACCCCATGATGCGAAGGGCCTTCGAGACCGTGGCGCTGGACCGCCTGGA
CCGCATTGGCAAGAAGAACTCCATCCTCCTCCACAAAGTCCAGCACGACCTCAACTCCGGCGTCTTCAACTACCAGGAGAATGAGATCAT
CCAGCAGATTGTGCAGCATGACCGGGAGATGGCCCACTGCGCGCACCGCGTCCAGGCTGCTGCCTCTGCCACCCCAACCCCCACGCCCGT
CATCTGGACCCCGCTGATCCAGGCACCACTGCAGGCTGCCGCTGCCACCACTTCTGTGGCCATAGCCCTCACCCACCACCCTCGCCTGCC
TGCTGCCATCTTCCGCCCTCCCCCAGGATCTGGGCTGGGCAACCTCGGTGCCGGGCAGACGCCAAGGCACCTGAAACGGCTGCAGTCCCT
GATCCCTTCTGCGCTGGGCTCCGCCTCGCCCGCCAGCAGCCCGTCCCAGGTGGACACACCGTCTTCATCCTCCTTCCACATCCAACAGCT
GGCTGGATTCTCTGCCCCCGCTGGACTGAGCCCACTCCTGCCCTCATCCAGCTCCTCCCCACCCCCCGGGGCCTGTGGCTCCCCCTCGGC
TCCCACACCATCAGCTGGCGTAGCCGCCACCACCATAGCCGGGTTTGGCCACTTCCACAAGGCGCTGGGTGGCTCCCTGTCCTCCTCCGA
CTCTCCCCTGCTCACCCCGCTGCAGCCAGGCGCCCGCTCCCCGCAGGCTGCCCAGCCATCTCCCGCGCCACCCGGGGCCCGGGGAGGCCT
GGGACTCCCGGAGCACTTCCTGCCACCCCCACCCTCATCCAGATCCCCGTCATCTAGCCCCGGGCAGCTGGGCCAGCCTCCCGGGGAGTT
GTCCCTAGGTCTGGCCACTGGCCCACTGAGCACGCCAGAGACACCCCCACGGCAGCCTGAGCCGCCGTCCCTTGTGGCAGGGGCCTCTGG
GGGGGCTTCCCCTGTAGGCTTTACTCCCCGAGGAGGTCTCAGCCCCCCTGGCCACAGCCCAGGCCCCCCAAGAACCTTCCCGAGTGCCCC
GCCCCGGGCCTCTGGCTCCCACGGATCCTTGCTCCTGCCACCTGCATCCAGCCCCCCACCACCCCAGGTCCCCCAGCGCCGGGGCACACC
CCCGCTCACCCCCGGCCGCCTCACCCAGGACCTCAAGCTCATCTCCGCGTCTCAGCCAGCCCTGCCTCAGGACGGGGCGCAGACTCTCCG
CAGAGCCTCCCCGCACTCCTCAGGGGAGTCCATGGCTGCCTTCCCGCTCTTCCCCAGGGCTGGGGGTGGCAGCGGGGGCAGTGGGAGCAG
CGGGGGCCTCGGTCCCCCTGGGAGGCCCTATGGTGCCATCCCCGGCCAGCACGTCACTCTGCCTCGGAAGACATCCTCAGGTTCTTTGCC
ACCCCCTCTGTCTTTGTTTGGGGCAAGAGCCACCTCTTCTGGGGGGCCCCCTCTGACTGCTGGACCCCAGAGGGAACCTGGGGCCAGGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_RASGRF1_ENST00000394745_chr15_79264208_-_HCN4_ENST00000261917_chr15_73636149_-_8004nt
GGAGCCCTTTTTGGCCTACTTGGGGTGAGTCAACATAAGGAGTGCAGGCCACCTTAGCCTTTGCTTCTCAAAAGTCATGGGGCAATGAAG
GACTTGGCCAAGGCTGTCCAGCAGTAGGCCAAGTTCAGGGATTGGCTCAGGCCCCTAATGGACTTCACTGCATCCAGGAATGGTAGGTGA
TTATCTTTTCCGAGAGGCCACCTACCCAGATCCCAGTTGTGGACAGCCCATCCCAGCCCTCAGAGGCTCAGAGGCTCTCTGAGTGCCCTG
CCCCAAAACACCCTAGGCAAGACATTATGCCAGAGCCTCAGCTCTAGGGCTGCCTGGAGCAGAGCTCCTGAATCACACTGGCTCCCCAGG
GCTCCCCAGGAACCTCACCATTCCTCCCCCAATCCACACCTCTGCTGCCAGAGCAACGCAACGACCCAGAATACACCCGTTCCCTCTTCT
GTTCCCTCCTCCTGCCCCCACCTCAGGCCTCACTGGGGCAGGGTACATCTTGCCTCTCTGCCCTGAACTTCTGAAACCTCAATGATCAGA
TTCCCAGGGCTCTGAGAAAACAGAAGCAAACATCCCATCCAGGATGGATTTACCCCCTAAAAGTCACTGAGATCATTCCCAGGGGCCCAG
CAGACAGTGTCCTTCCTTTCCCAGCAGCAGTGCCCTGCAGAACAAAGAGGCTGGTTCAGAGCCAGCTCTCAGCCCTATGGCCTTGGCTGA
GTCCCTTAACCTTTCTGAGACTCAGTTTCCTACCTGTGACATTCCTGCAGTTATCCTGTAGGAATAAGAGTGCCTACGTCCTGGGGCAAC
AGTGAGGGTTAAAAGATCAATCCTATCCTGTGTGCAACGTGGAGCAGACAGCCTCGATGAGACAAGCTATGGTTTGCAATGTTCTGGATG
TATAACCTGTTTCCAGCCTGGCCTGAGGTGGAACCCTGTCATGAGGATGGTCGCTGGAGCTCCTGTTTGCCAGTGGCCAGAACAATAAGC
TCCTGTACGGTGAACCCCCCAAGTCCCCGCGCGCCACCCGCAAGTTCTCCTCGCCGCCACCTCTGTCCATCACCAAGACATCGTCACCGA
GCCGCCGGCGGAAGCTCTCCCTGAACATCCCCATCATCACTGGCGGCAAGGCCCTGGACCTGGCCGCCCTCAGCTGCAACTCCAATGGCT
ACACCAGCATGTACTCGGCCATGTCACCCTTCAGCAAGGCCACGCTGGACACCAGCAAGCTCTATGTGTCCAGCAGCTTCACCAACAAGA
TTCCAGATGAGGGCGATACGACCCCTGAGAAGCCCGAAGACCCTTCAGCGCTCAGCAAGCAGAGCTCAGAAGTCTCCATGAGAGAGGAGT
CAGATATTGATCAAAACCAGAGTGATGATGGTGATACTGAAACATCACCAACTAAATCTCCAACAACACCCAAATCAGTCAAAAACAAAA
ATTCTTCAGAGTTCCCACTCTTTTCCTATAACAATGGAGTCGTCATGACCTCCTGTCGTGAACTGGACAATAACCGCAGTGCCTTGTCGG
CCGCCTCTGCCTTTGCCATAGCAACCGCCGGGGCCAACGAGGGCACCCCAAACAAGGAGAAGTACCGGAGGATGTCCTTAGCCAGTGCAG
GGTTTCCCCCAGACCAGAGGAATGGAGACAAGGAGTTTGTGATCCGCAGAGCAGCCACCAATCGTGTCTTGAACGTGCTCCGCCACTGGG
TGTCCAAGCACTCTCAGGACTTTGAGACCAACGATGAGCTCAAATGCAAGGTGATCGGCTTCCTGGAAGAAGTCATGCACGACCCGGAGC
TCCTGACCCAGGAGCGGAAGGCTGCAGCCAACATCATCAGGACTCTGACCCAGGAGGACCCAGGTGACAACCAGATCACGCTGGAGGAGA
TCACGCAGATGGCTGAAGGCGTGAAGGCTGAGCCCTTTGAAAACCACTCAGCCCTGGAGATCGCGGAGCAGCTGACCCTGCTAGATCACC
TCGTCTTCAAGAAGATTCCTTATGAGGAGTTCTTCGGACAAGGATGGATGAAACTGGAAAAGAATGAAAGGACCCCTTATATCATGAAAA
CCACTAAGCACTTCAATGACATCAGTAACTTGATTGCTTCAGAAATCATCCGCAATGAGGACATCAACGCCAGGGTGAGCGCCATCGAGA
AGTGGGTGGCCGTAGCTGACATATGCCGCTGCCTCCACAACTACAATGCCGTACTGGAGATCACCTCGTCCATGAACCGCAGTGCAATCT
TCCGGCTCAAAAAGACGTGGCTCAAAGTCTCTAAGCAGACTAAAGCTTTGATTGATAAGCTCCAAAAGCTTGTGTCATCTGAGGGCAGAT
TTAAGAATCTCAGAGAAGCTCTGAAAAATTGTGACCCACCCTGTGTCCCTTACCTGGGGATGTACCTCACCGACCTGGCCTTCATCGAGG
AGGGGACGCCCAATTACACGGAAGACGGCCTGGTCAACTTCTCCAAGATGAGGATGATATCCCATATTATCCGAGAGATTCGCCAGTTTC
AACAAACTGCCTACAAAATAGAGCACCAAGCAAAGATTTTACTGGGACCTGACCATGCTGCTGCTGATGGTGGGAAACCTGATTATCATT
CCTGTGGGCATCACCTTCTTCAAGGATGAGAACACCACACCCTGGATTGTCTTCAATGTGGTGTCAGACACATTCTTCCTCATCGACTTG
GTCCTCAACTTCCGCACAGGGATCGTGGTGGAGGACAACACAGAGATCATCCTGGACCCGCAGCGGATTAAAATGAAGTACCTGAAAAGC
TGGTTCATGGTAGATTTCATTTCCTCCATCCCCGTGGACTACATCTTCCTCATTGTGGAGACACGCATCGACTCGGAGGTCTACAAGACT
GCCCGGGCCCTGCGCATTGTCCGCTTCACGAAGATCCTCAGCCTCTTACGCCTGTTACGCCTCTCCCGCCTCATTCGATATATTCACCAG
TGGGAAGAGATCTTCCACATGACCTACGACCTGGCCAGCGCCGTGGTGCGCATCGTGAACCTCATCGGCATGATGCTCCTGCTCTGCCAC
TGGGACGGCTGCCTGCAGTTCCTGGTACCCATGCTACAGGACTTCCCTGACGACTGCTGGGTGTCCATCAACAACATGGTGAACAACTCC
TGGGGGAAGCAGTACTCCTACGCGCTCTTCAAGGCCATGAGCCACATGCTGTGCATCGGCTACGGGCGGCAGGCGCCCGTGGGCATGTCC
GACGTCTGGCTCACCATGCTCAGCATGATCGTGGGTGCCACCTGCTACGCCATGTTCATTGGCCACGCCACTGCCCTCATCCAGTCCCTG
GACTCCTCCCGGCGCCAGTACCAGGAAAAGTACAAGCAGGTGGAGCAGTACATGTCCTTTCACAAGCTCCCGCCCGACACCCGGCAGCGC
ATCCACGACTACTACGAGCACCGCTACCAGGGCAAGATGTTCGACGAGGAGAGCATCCTGGGCGAGCTAAGCGAGCCCCTGCGGGAGGAG
ATCATCAACTTTAACTGTCGGAAGCTGGTGGCCTCCATGCCACTGTTTGCCAATGCGGACCCCAACTTCGTGACGTCCATGCTGACCAAG
CTGCGTTTCGAGGTCTTCCAGCCTGGGGACTACATCATCCGGGAAGGCACCATTGGCAAGAAGATGTACTTCATCCAGCATGGCGTGGTC
AGCGTGCTCACCAAGGGCAACAAGGAGACCAAGCTGGCCGACGGCTCCTACTTTGGAGAGATCTGCCTGCTGACCCGGGGCCGGCGCACA
GCCAGCGTGAGGGCCGACACCTACTGCCGCCTCTACTCGCTGAGCGTGGACAACTTCAATGAGGTGCTGGAGGAGTACCCCATGATGCGA
AGGGCCTTCGAGACCGTGGCGCTGGACCGCCTGGACCGCATTGGCAAGAAGAACTCCATCCTCCTCCACAAAGTCCAGCACGACCTCAAC
TCCGGCGTCTTCAACTACCAGGAGAATGAGATCATCCAGCAGATTGTGCAGCATGACCGGGAGATGGCCCACTGCGCGCACCGCGTCCAG
GCTGCTGCCTCTGCCACCCCAACCCCCACGCCCGTCATCTGGACCCCGCTGATCCAGGCACCACTGCAGGCTGCCGCTGCCACCACTTCT
GTGGCCATAGCCCTCACCCACCACCCTCGCCTGCCTGCTGCCATCTTCCGCCCTCCCCCAGGATCTGGGCTGGGCAACCTCGGTGCCGGG
CAGACGCCAAGGCACCTGAAACGGCTGCAGTCCCTGATCCCTTCTGCGCTGGGCTCCGCCTCGCCCGCCAGCAGCCCGTCCCAGGTGGAC
ACACCGTCTTCATCCTCCTTCCACATCCAACAGCTGGCTGGATTCTCTGCCCCCGCTGGACTGAGCCCACTCCTGCCCTCATCCAGCTCC
TCCCCACCCCCCGGGGCCTGTGGCTCCCCCTCGGCTCCCACACCATCAGCTGGCGTAGCCGCCACCACCATAGCCGGGTTTGGCCACTTC
CACAAGGCGCTGGGTGGCTCCCTGTCCTCCTCCGACTCTCCCCTGCTCACCCCGCTGCAGCCAGGCGCCCGCTCCCCGCAGGCTGCCCAG
CCATCTCCCGCGCCACCCGGGGCCCGGGGAGGCCTGGGACTCCCGGAGCACTTCCTGCCACCCCCACCCTCATCCAGATCCCCGTCATCT
AGCCCCGGGCAGCTGGGCCAGCCTCCCGGGGAGTTGTCCCTAGGTCTGGCCACTGGCCCACTGAGCACGCCAGAGACACCCCCACGGCAG
CCTGAGCCGCCGTCCCTTGTGGCAGGGGCCTCTGGGGGGGCTTCCCCTGTAGGCTTTACTCCCCGAGGAGGTCTCAGCCCCCCTGGCCAC
AGCCCAGGCCCCCCAAGAACCTTCCCGAGTGCCCCGCCCCGGGCCTCTGGCTCCCACGGATCCTTGCTCCTGCCACCTGCATCCAGCCCC
CCACCACCCCAGGTCCCCCAGCGCCGGGGCACACCCCCGCTCACCCCCGGCCGCCTCACCCAGGACCTCAAGCTCATCTCCGCGTCTCAG
CCAGCCCTGCCTCAGGACGGGGCGCAGACTCTCCGCAGAGCCTCCCCGCACTCCTCAGGGGAGTCCATGGCTGCCTTCCCGCTCTTCCCC
AGGGCTGGGGGTGGCAGCGGGGGCAGTGGGAGCAGCGGGGGCCTCGGTCCCCCTGGGAGGCCCTATGGTGCCATCCCCGGCCAGCACGTC
ACTCTGCCTCGGAAGACATCCTCAGGTTCTTTGCCACCCCCTCTGTCTTTGTTTGGGGCAAGAGCCACCTCTTCTGGGGGGCCCCCTCTG
ACTGCTGGACCCCAGAGGGAACCTGGGGCCAGGCCTGAGCCAGTGCGCTCCAAACTGCCATCCAATCTATGAGCTGGGCCCTTCCTTCCC
TCTTCTTTCTTCTTTTCTCTCCCTTCCTTCTTCCTTCAGGTTTAACTGTGATTAGGAGATATACCAATAACAGTAATAATTATTTAAAAA
ACCACACACACCAGAAAAACAAAAGACAGCAGAAAATAACCAGGTATTCTTAGAGCTATAGATTTTTGGTCACTTGCTTTTATAGACTAT
TTTAATACTCAGCACTAGAGGGAGGGAGGGGGAGGGAGGAGGGAGCAGGCAGGTCCCAAATGCAAAAGCCAGAGAAAGGCAGATGGGGTC
TCCGGGGCTGGGCAGGGGTGGGAGTGGCCAGTGTTGGCGGTTCTTAGAGCAGATGTGTCATTGTGTTCATTTAGAGAAACAGCTGCCATC
AGCCCGTTAGCTGTAACTTGGAGCTCCACTCTGCCCCCAGAAAGGGGCTGCCCTGGGGTGTGCCCTGGGGAGCCTCAGAAGCCTGCGACC
TTGGGAGAAAAGGGCCAGGGCCCTGAGGGCCTAGCATTTTTTCTACTGTAAACGTAGCAAGATCTGTATATGAATATGTATATGTATATG
TATGTAAGATGTGTATATGTATAGCTATGTAGCGCTCTGTAGAGCCATGTAGATAGCCACTCACATGTGCGCACACGTGTGCGGTCTAGT
TTAATCCCATGTTGACAGGATGCCCAGGTCACCTTACACCCAGCAACCCGCCTTGGCCCACAGGCTGTGCACTGCATGGTCTAGGGACGT
TCTCTCTCCAGTCCTCAGGGAAGAGGACCCCAGGACTTCGCAGCAGGCCCCCTCTCTCCCCATCTCTGGTCTCAAAGCCAGTCCCAGCCT
GACCTCTCACCACACGGAAGTGGAAGACTCCCCTTTCCTAGGGCCTCAAGCACACACCGCCACCTCTGGGGCCGTCAGTTTGCCCATCTG
TACAGTGGGAGGTGAGCGGAACTTCTGTTTATTGAGTCTGCTCTGTGCCAAGCACTGGTTTCGCACTTTACACACATTAACTCCTTCAGT
TTCACAAAGACCATGGGGTGGGTACTTTGATTCTCCCCATTTAGCAGAGGAAGAAACAGTTTTGGGTAATTTTTCCAGAATCATGTAACT
AGGAGTGGCAGAGTGGGGACTGATTTGAGGTTCGAGTCCACGCCTCCTTGAGGCCCAAGTCTGTGTTCCTTCCATCAGAAAACTGTGTTG
AGGGGGGCTGAGGTAGATGGTCCCCAAGCATGGTACAGAAGGAAGACACCAGATTTTGGCAGCAGTCAGGCCTGGGTTTGAATCCCAGCC
CTGCCACTTCTTAGCTGTATGATCTTGGGCAAGTTATCTGACCTTTCTGTCACCTCATTTGTAAAATGGGAATAATTATGGTACTGCCTC
ACAAGGACCTATGAGGACCAGATGAGAAAAATCTATATGTGAAATGCCCAGCCCAGCGCCTGGCACATACCATGGTAGGTGCTCAATAAA
AAATCACATTTCTTCTGCCCCTCATATGCCCAGCCTATTGCTCCAGCAAACTATGTGAGAGCCCAGGGAGCTTTGGCTGAGGGCTCCAAG
ACTTAAAATCTCAGGACTCAGGAGGTGGCTGGGCCTCCCTAAGGGCCCAAGGAAGGTGTGTGGCCAGAGGTGGGTGGGAGCCAGGCCTTG
AGAAGTGGGAAGACTTCAACAGGGAGAGAGGGAGGGAATGGTGGGTGGGATGGAGTGTATGGTGGGGAGATTCCTGAGGTGGATGTGGAG
TGGTGGATCAGGGCTTTGGGAGGGGATCCCCAGGCTGAGGGGTCAGAGGGACGGCCTTGGGTGATAGGGTAAGGGATTGTCTGGGCTTAG
TCCTGGCAACTAGGAGCCATAAGCAGGTTCCAGATTGCGGGAACGAGAAAGCAGCTCAGATGCCTTTGGAGGCACCATCCTCCCTCCTCC
CAGATGGGATCTTGCCAGAGCCAAGGTCAGGGGTCTGCCCCTGCCTATAGGGCCAGAGCAGGTATGGCTGCAATCCCCAAGTAATGAGAA
GGGCTGGTCCCACATTATCCATCCAGAACCTTCCATGCTCCAAGCCAGAATGTTGGCAAGATCGGGTTTTGCCTTGAGCTATCCTGGGAT
GTGAGACAAACCGATTTCTCCATAGATGGGCTGCAGGGAGTGGGAGGCAGTACTCCAGGAGAGAAGTGGGTGAAGGTTCCTGGGATCTTA
GGTAAAGACTAGACGCCGCCTAGTACTGGTCTCTACTGTGCTGGCTCAGGAGTTCTGAGAACTGGAAGGACTTAGCCTCAACCTGAGTTC
TGCACACACCCCTTCCCCTTAAGGAAGGCAGCTCTGAGAGGCAGCAGGACTTGATCCAAACCCACAGTCTTGTCCTGGAGGCAGCAGGGG
TGAAGGTGGAGGGTCCAGGGCCATGAGGAGCCCCCTTGCCATCAGAGCCTGGCCTAACCACCCTCTTCTCTACTTACACACACATGCATT
TTATAATAGCTCTGACCCAACCTGGCCACTCTGCAGAGACTGGGACAGACAGGTGCAGGCAATGGGCCCTCCCACACCCAGTCACCTACA


Top

FusionGenePPI for RASGRF1_HCN4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RASGRF1MARK3, YWHAB, HRAS, PPP1R9B, MYC, EHD4, ADRBK1, CEBPA, SNRNP70, SRC, SRPK2HCN4HCN1, HCN3, HCN2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RASGRF1_HCN4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RASGRF1_HCN4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRASGRF1C0005586Bipolar Disorder1PSYGENET
HgeneRASGRF1C0013386Dyskinesia, Drug-Induced1CTD_human
HgeneRASGRF1C0027092Myopia1CTD_human
HgeneRASGRF1C0034951Refractive Errors1CTD_human
TgeneHCN4C1834144Sick Sinus Syndrome 2, Autosomal Dominant3CTD_human;UNIPROT
TgeneHCN4C0004238Atrial Fibrillation1CTD_human;HPO
TgeneHCN4C0525045Mood Disorders1PSYGENET