FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30484

FusionGeneSummary for RARA_SLC9A3R1

check button Fusion gene summary
Fusion gene informationFusion gene name: RARA_SLC9A3R1
Fusion gene ID: 30484
HgeneTgene
Gene symbol

RARA

SLC9A3R1

Gene ID

5914

9368

Gene nameretinoic acid receptor alphaSLC9A3 regulator 1
SynonymsNR1B1|RAREBP50|NHERF|NHERF-1|NHERF1|NPHLOP2
Cytomap

17q21.2

17q25.1

Type of geneprotein-codingprotein-coding
Descriptionretinoic acid receptor alphaRAR-alphanuclear receptor subfamily 1 group B member 1nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long formretinoic acid nuclear receptor alpha variant 1retinoic acid nuclear receptor alpha variant 2Na(+)/H(+) exchange regulatory cofactor NHE-RF1Na+/H+ exchange regulatory co-factorezrin-radixin-moesin binding phosphoprotein-50regulatory cofactor of Na(+)/H(+) exchangersolute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulatory facto
Modification date2018052320180522
UniProtAcc

P10276

O14745

Ensembl transtripts involved in fusion geneENST00000254066, ENST00000394089, 
ENST00000425707, ENST00000394086, 
ENST00000394081, ENST00000420042, 
ENST00000262613, ENST00000413388, 
Fusion gene scores* DoF score29 X 12 X 7=24364 X 3 X 4=48
# samples 426
** MAII scorelog2(42/2436*10)=-2.53605290024021
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/48*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RARA [Title/Abstract] AND SLC9A3R1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRARA

GO:0007165

signal transduction

2825025

HgeneRARA

GO:0030853

negative regulation of granulocyte differentiation

19917671

HgeneRARA

GO:0032689

negative regulation of interferon-gamma production

18416830

HgeneRARA

GO:0032720

negative regulation of tumor necrosis factor production

18416830

HgeneRARA

GO:0032736

positive regulation of interleukin-13 production

18416830

HgeneRARA

GO:0032753

positive regulation of interleukin-4 production

18416830

HgeneRARA

GO:0032754

positive regulation of interleukin-5 production

18416830

HgeneRARA

GO:0045630

positive regulation of T-helper 2 cell differentiation

18416830

HgeneRARA

GO:0045892

negative regulation of transcription, DNA-templated

20080953

HgeneRARA

GO:0045893

positive regulation of transcription, DNA-templated

18845237|19850744|20080953

HgeneRARA

GO:0045944

positive regulation of transcription by RNA polymerase II

19850744

HgeneRARA

GO:0071300

cellular response to retinoic acid

19917671

HgeneRARA

GO:0071391

cellular response to estrogen stimulus

20080953

TgeneSLC9A3R1

GO:0008285

negative regulation of cell proliferation

20012548

TgeneSLC9A3R1

GO:0070373

negative regulation of ERK1 and ERK2 cascade

20012548

TgeneSLC9A3R1

GO:2001244

positive regulation of intrinsic apoptotic signaling pathway

20012548


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCSTCGA-N8-A4PQ-01ARARAchr17

38508759

+SLC9A3R1chr17

72758151

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000254066ENST00000262613RARAchr17

38508759

+SLC9A3R1chr17

72758151

+
5CDS-5UTRENST00000254066ENST00000413388RARAchr17

38508759

+SLC9A3R1chr17

72758151

+
In-frameENST00000394089ENST00000262613RARAchr17

38508759

+SLC9A3R1chr17

72758151

+
5CDS-5UTRENST00000394089ENST00000413388RARAchr17

38508759

+SLC9A3R1chr17

72758151

+
In-frameENST00000425707ENST00000262613RARAchr17

38508759

+SLC9A3R1chr17

72758151

+
5CDS-5UTRENST00000425707ENST00000413388RARAchr17

38508759

+SLC9A3R1chr17

72758151

+
In-frameENST00000394086ENST00000262613RARAchr17

38508759

+SLC9A3R1chr17

72758151

+
5CDS-5UTRENST00000394086ENST00000413388RARAchr17

38508759

+SLC9A3R1chr17

72758151

+
In-frameENST00000394081ENST00000262613RARAchr17

38508759

+SLC9A3R1chr17

72758151

+
5CDS-5UTRENST00000394081ENST00000413388RARAchr17

38508759

+SLC9A3R1chr17

72758151

+
3UTR-3CDSENST00000420042ENST00000262613RARAchr17

38508759

+SLC9A3R1chr17

72758151

+
3UTR-5UTRENST00000420042ENST00000413388RARAchr17

38508759

+SLC9A3R1chr17

72758151

+

Top

FusionProtFeatures for RARA_SLC9A3R1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RARA

P10276

SLC9A3R1

O14745

Receptor for retinoic acid. Retinoic acid receptors bindas heterodimers to their target response elements in response totheir ligands, all-trans or 9-cis retinoic acid, and regulate geneexpression in various biological processes. The RXR/RARheterodimers bind to the retinoic acid response elements (RARE)composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In theabsence of ligand, the RXR-RAR heterodimers associate with amultiprotein complex containing transcription corepressors thatinduce histone acetylation, chromatin condensation andtranscriptional suppression. On ligand binding, the corepressorsdissociate from the receptors and associate with the coactivatorsleading to transcriptional activation. RARA plays an essentialrole in the regulation of retinoic acid-induced germ celldevelopment during spermatogenesis. Has a role in the survival ofearly spermatocytes at the beginning prophase of meiosis. InSertoli cells, may promote the survival and development of earlymeiotic prophase spermatocytes. In concert with RARG, required forskeletal growth, matrix homeostasis and growth plate function (Bysimilarity). {ECO:0000250|UniProtKB:P11416,ECO:0000269|PubMed:16417524, ECO:0000269|PubMed:19850744,ECO:0000269|PubMed:20215566}. Scaffold protein that connects plasma membrane proteinswith members of the ezrin/moesin/radixin family and thereby helpsto link them to the actin cytoskeleton and to regulate theirsurface expression. Necessary for recycling of internalized ADRB2.Was first known to play a role in the regulation of the activityand subcellular location of SLC9A3. Necessary for cAMP-mediatedphosphorylation and inhibition of SLC9A3. May enhance Wntsignaling. May participate in HTR4 targeting to microvilli (Bysimilarity). Involved in the regulation of phosphate reabsorptionin the renal proximal tubules. Involved in sperm capacitation. Mayparticipate in the regulation of the chloride and bicarbonatehomeostasis in spermatozoa. {ECO:0000250,ECO:0000269|PubMed:10499588, ECO:0000269|PubMed:18784102,ECO:0000269|PubMed:9096337, ECO:0000269|PubMed:9430655}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRARAchr17:38508759chr17:72758151ENST00000254066+6988_153269463DNA bindingNuclear receptor
HgeneRARAchr17:38508759chr17:72758151ENST00000394081+5888_153264458DNA bindingNuclear receptor
HgeneRARAchr17:38508759chr17:72758151ENST00000394089+6988_153269463DNA bindingNuclear receptor
HgeneRARAchr17:38508759chr17:72758151ENST00000425707+4788_153172366DNA bindingNuclear receptor
HgeneRARAchr17:38508759chr17:72758151ENST00000254066+69154_182269463RegionNote=Hinge
HgeneRARAchr17:38508759chr17:72758151ENST00000254066+691_87269463RegionNote=Modulating
HgeneRARAchr17:38508759chr17:72758151ENST00000394081+58154_182264458RegionNote=Hinge
HgeneRARAchr17:38508759chr17:72758151ENST00000394081+581_87264458RegionNote=Modulating
HgeneRARAchr17:38508759chr17:72758151ENST00000394089+69154_182269463RegionNote=Hinge
HgeneRARAchr17:38508759chr17:72758151ENST00000394089+691_87269463RegionNote=Modulating
HgeneRARAchr17:38508759chr17:72758151ENST00000425707+471_87172366RegionNote=Modulating
HgeneRARAchr17:38508759chr17:72758151ENST00000254066+69124_148269463Zinc fingerNR C4-type
HgeneRARAchr17:38508759chr17:72758151ENST00000254066+6988_108269463Zinc fingerNR C4-type
HgeneRARAchr17:38508759chr17:72758151ENST00000394081+58124_148264458Zinc fingerNR C4-type
HgeneRARAchr17:38508759chr17:72758151ENST00000394081+5888_108264458Zinc fingerNR C4-type
HgeneRARAchr17:38508759chr17:72758151ENST00000394089+69124_148269463Zinc fingerNR C4-type
HgeneRARAchr17:38508759chr17:72758151ENST00000394089+6988_108269463Zinc fingerNR C4-type
HgeneRARAchr17:38508759chr17:72758151ENST00000425707+47124_148172366Zinc fingerNR C4-type
HgeneRARAchr17:38508759chr17:72758151ENST00000425707+4788_108172366Zinc fingerNR C4-type
TgeneSLC9A3R1chr17:38508759chr17:72758151ENST00000262613+06154_234147359DomainPDZ 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRARAchr17:38508759chr17:72758151ENST00000254066+69183_417269463DomainNR LBD
HgeneRARAchr17:38508759chr17:72758151ENST00000394081+58183_417264458DomainNR LBD
HgeneRARAchr17:38508759chr17:72758151ENST00000394089+69183_417269463DomainNR LBD
HgeneRARAchr17:38508759chr17:72758151ENST00000425707+47183_417172366DomainNR LBD
HgeneRARAchr17:38508759chr17:72758151ENST00000254066+69404_419269463RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38508759chr17:72758151ENST00000394081+58404_419264458RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38508759chr17:72758151ENST00000394089+69404_419269463RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38508759chr17:72758151ENST00000425707+47154_182172366RegionNote=Hinge
HgeneRARAchr17:38508759chr17:72758151ENST00000425707+47404_419172366RegionNote=Required for binding corepressor NCOR1
TgeneSLC9A3R1chr17:38508759chr17:72758151ENST00000262613+0614_94147359DomainPDZ 1


Top

FusionGeneSequence for RARA_SLC9A3R1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RARA_ENST00000254066_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_481aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFV
CQDKSSGYHTGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILR
ELRPRLCTMKKGPSGTGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEF
FKKCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLA

>In-frame_RARA_ENST00000394089_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_481aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFV
CQDKSSGYHTGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILR
ELRPRLCTMKKGPSGTGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEF
FKKCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLA

>In-frame_RARA_ENST00000425707_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_384aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPATVRNDRNKKKKEVPKPECSESYTLTPEVGEL
IEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILRELRPRLC
TMKKGPSGTGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRVI
PSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAH

>In-frame_RARA_ENST00000394086_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_497aa
MMSQTMTQAGVSFRHSVRAAQCHTRVPNTWPRATRPYASCRRSPRLRGRWPGSAGQGAGGRAPRAGWRAGDVTGSAIETQSSSSEEIVPS
PPSPPPLPRIYKPCFVCQDKSSGYHTGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNK
KKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTI
ADQITLLKAACLDILRELRPRLCTMKKGPSGTGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAG
GDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPS

>In-frame_RARA_ENST00000394081_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_476aa
MYESVEVGGPTPNPFLVVDFTNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKS
SGYHTGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVG
ELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILRELRPR
LCTMKKGPSGTGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKCR
VIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKER


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RARA_ENST00000254066_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_1443nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCACC
ATTGAGACCCAGAGCAGCAGTTCTGAAGAGATAGTGCCCAGCCCTCCCTCGCCACCCCCTCTACCCCGCATCTACAAGCCTTGCTTTGTC
TGTCAGGACAAGTCCTCAGGCTACCACTATGGGGTCAGCGCCTGTGAGGGCTGCAAGGGCTTCTTCCGCCGCAGCATCCAGAAGAACATG
GTGTACACGTGTCACCGGGACAAGAACTGCATCATCAACAAGGTGACCCGGAACCGCTGCCAGTACTGCCGACTGCAGAAGTGCTTTGAA
GTGGGCATGTCCAAGGAGTCTGTGAGAAACGACCGAAACAAGAAGAAGAAGGAGGTGCCCAAGCCCGAGTGCTCTGAGAGCTACACGCTG
ACGCCGGAGGTGGGGGAGCTCATTGAGAAGGTGCGCAAAGCGCACCAGGAAACCTTCCCTGCCCTCTGCCAGCTGGGCAAATACACTACG
AACAACAGCTCAGAACAACGTGTCTCTCTGGACATTGACCTCTGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCATTAAGACTGTG
GAGTTCGCCAAGCAGCTGCCCGGCTTCACCACCCTCACCATCGCCGACCAGATCACCCTCCTCAAGGCTGCCTGCCTGGACATCCTGCGC
GAGCTTCGGCCTCGGCTCTGTACCATGAAGAAGGGCCCCAGTGGCTATGGCTTCAACCTGCACAGCGACAAGTCCAAGCCAGGCCAGTTC
ATCCGGTCAGTGGACCCAGACTCCCCGGCTGAGGCTTCAGGGCTCCGGGCCCAGGATCGCATTGTGGAGGTGAACGGGGTCTGCATGGAG
GGGAAGCAGCATGGGGACGTGGTGTCCGCCATCAGGGCTGGCGGGGACGAGACCAAGCTGCTGGTGGTGGACAGGGAAACTGACGAGTTC
TTCAAGAAATGCAGAGTGATCCCATCTCAGGAGCACCTGAATGGTCCCCTGCCTGTGCCCTTCACCAATGGGGAGATACAGAAGGAGAAC
AGTCGTGAAGCCCTGGCAGAGGCAGCCTTGGAGAGCCCCAGGCCAGCCCTGGTGAGATCCGCCTCCAGTGACACCAGCGAGGAGCTGAAT
TCCCAAGACAGCCCCCCAAAACAGGACTCCACAGCGCCCTCGTCTACCTCCTCCTCCGACCCCATCCTAGACTTCAACATCTCCCTGGCC
ATGGCCAAAGAGAGGGCCCACCAGAAACGCAGCAGCAAACGGGCCCCGCAGATGGACTGGAGCAAGAAAAACGAACTCTTCAGCAACCTC

>In-frame_RARA_ENST00000394089_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_1443nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCACC
ATTGAGACCCAGAGCAGCAGTTCTGAAGAGATAGTGCCCAGCCCTCCCTCGCCACCCCCTCTACCCCGCATCTACAAGCCTTGCTTTGTC
TGTCAGGACAAGTCCTCAGGCTACCACTATGGGGTCAGCGCCTGTGAGGGCTGCAAGGGCTTCTTCCGCCGCAGCATCCAGAAGAACATG
GTGTACACGTGTCACCGGGACAAGAACTGCATCATCAACAAGGTGACCCGGAACCGCTGCCAGTACTGCCGACTGCAGAAGTGCTTTGAA
GTGGGCATGTCCAAGGAGTCTGTGAGAAACGACCGAAACAAGAAGAAGAAGGAGGTGCCCAAGCCCGAGTGCTCTGAGAGCTACACGCTG
ACGCCGGAGGTGGGGGAGCTCATTGAGAAGGTGCGCAAAGCGCACCAGGAAACCTTCCCTGCCCTCTGCCAGCTGGGCAAATACACTACG
AACAACAGCTCAGAACAACGTGTCTCTCTGGACATTGACCTCTGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCATTAAGACTGTG
GAGTTCGCCAAGCAGCTGCCCGGCTTCACCACCCTCACCATCGCCGACCAGATCACCCTCCTCAAGGCTGCCTGCCTGGACATCCTGCGC
GAGCTTCGGCCTCGGCTCTGTACCATGAAGAAGGGCCCCAGTGGCTATGGCTTCAACCTGCACAGCGACAAGTCCAAGCCAGGCCAGTTC
ATCCGGTCAGTGGACCCAGACTCCCCGGCTGAGGCTTCAGGGCTCCGGGCCCAGGATCGCATTGTGGAGGTGAACGGGGTCTGCATGGAG
GGGAAGCAGCATGGGGACGTGGTGTCCGCCATCAGGGCTGGCGGGGACGAGACCAAGCTGCTGGTGGTGGACAGGGAAACTGACGAGTTC
TTCAAGAAATGCAGAGTGATCCCATCTCAGGAGCACCTGAATGGTCCCCTGCCTGTGCCCTTCACCAATGGGGAGATACAGAAGGAGAAC
AGTCGTGAAGCCCTGGCAGAGGCAGCCTTGGAGAGCCCCAGGCCAGCCCTGGTGAGATCCGCCTCCAGTGACACCAGCGAGGAGCTGAAT
TCCCAAGACAGCCCCCCAAAACAGGACTCCACAGCGCCCTCGTCTACCTCCTCCTCCGACCCCATCCTAGACTTCAACATCTCCCTGGCC
ATGGCCAAAGAGAGGGCCCACCAGAAACGCAGCAGCAAACGGGCCCCGCAGATGGACTGGAGCAAGAAAAACGAACTCTTCAGCAACCTC

>In-frame_RARA_ENST00000425707_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_1152nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCACT
GTGAGAAACGACCGAAACAAGAAGAAGAAGGAGGTGCCCAAGCCCGAGTGCTCTGAGAGCTACACGCTGACGCCGGAGGTGGGGGAGCTC
ATTGAGAAGGTGCGCAAAGCGCACCAGGAAACCTTCCCTGCCCTCTGCCAGCTGGGCAAATACACTACGAACAACAGCTCAGAACAACGT
GTCTCTCTGGACATTGACCTCTGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCATTAAGACTGTGGAGTTCGCCAAGCAGCTGCCC
GGCTTCACCACCCTCACCATCGCCGACCAGATCACCCTCCTCAAGGCTGCCTGCCTGGACATCCTGCGCGAGCTTCGGCCTCGGCTCTGT
ACCATGAAGAAGGGCCCCAGTGGCTATGGCTTCAACCTGCACAGCGACAAGTCCAAGCCAGGCCAGTTCATCCGGTCAGTGGACCCAGAC
TCCCCGGCTGAGGCTTCAGGGCTCCGGGCCCAGGATCGCATTGTGGAGGTGAACGGGGTCTGCATGGAGGGGAAGCAGCATGGGGACGTG
GTGTCCGCCATCAGGGCTGGCGGGGACGAGACCAAGCTGCTGGTGGTGGACAGGGAAACTGACGAGTTCTTCAAGAAATGCAGAGTGATC
CCATCTCAGGAGCACCTGAATGGTCCCCTGCCTGTGCCCTTCACCAATGGGGAGATACAGAAGGAGAACAGTCGTGAAGCCCTGGCAGAG
GCAGCCTTGGAGAGCCCCAGGCCAGCCCTGGTGAGATCCGCCTCCAGTGACACCAGCGAGGAGCTGAATTCCCAAGACAGCCCCCCAAAA
CAGGACTCCACAGCGCCCTCGTCTACCTCCTCCTCCGACCCCATCCTAGACTTCAACATCTCCCTGGCCATGGCCAAAGAGAGGGCCCAC

>In-frame_RARA_ENST00000394086_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_1491nt
ATGATGTCACAGACAATGACACAAGCCGGTGTCTCATTCCGACACAGCGTCCGAGCTGCACAATGTCACACCCGGGTGCCAAACACTTGG
CCCCGCGCGACCCGGCCCTACGCCTCCTGCCGCCGCTCTCCGCGTCTCCGGGGGAGGTGGCCCGGTTCGGCCGGGCAGGGGGCTGGCGGG
CGAGCCCCGCGGGCGGGCTGGCGAGCGGGTGATGTCACGGGCAGCGCCATTGAGACCCAGAGCAGCAGTTCTGAAGAGATAGTGCCCAGC
CCTCCCTCGCCACCCCCTCTACCCCGCATCTACAAGCCTTGCTTTGTCTGTCAGGACAAGTCCTCAGGCTACCACTATGGGGTCAGCGCC
TGTGAGGGCTGCAAGGGCTTCTTCCGCCGCAGCATCCAGAAGAACATGGTGTACACGTGTCACCGGGACAAGAACTGCATCATCAACAAG
GTGACCCGGAACCGCTGCCAGTACTGCCGACTGCAGAAGTGCTTTGAAGTGGGCATGTCCAAGGAGTCTGTGAGAAACGACCGAAACAAG
AAGAAGAAGGAGGTGCCCAAGCCCGAGTGCTCTGAGAGCTACACGCTGACGCCGGAGGTGGGGGAGCTCATTGAGAAGGTGCGCAAAGCG
CACCAGGAAACCTTCCCTGCCCTCTGCCAGCTGGGCAAATACACTACGAACAACAGCTCAGAACAACGTGTCTCTCTGGACATTGACCTC
TGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCATTAAGACTGTGGAGTTCGCCAAGCAGCTGCCCGGCTTCACCACCCTCACCATC
GCCGACCAGATCACCCTCCTCAAGGCTGCCTGCCTGGACATCCTGCGCGAGCTTCGGCCTCGGCTCTGTACCATGAAGAAGGGCCCCAGT
GGCTATGGCTTCAACCTGCACAGCGACAAGTCCAAGCCAGGCCAGTTCATCCGGTCAGTGGACCCAGACTCCCCGGCTGAGGCTTCAGGG
CTCCGGGCCCAGGATCGCATTGTGGAGGTGAACGGGGTCTGCATGGAGGGGAAGCAGCATGGGGACGTGGTGTCCGCCATCAGGGCTGGC
GGGGACGAGACCAAGCTGCTGGTGGTGGACAGGGAAACTGACGAGTTCTTCAAGAAATGCAGAGTGATCCCATCTCAGGAGCACCTGAAT
GGTCCCCTGCCTGTGCCCTTCACCAATGGGGAGATACAGAAGGAGAACAGTCGTGAAGCCCTGGCAGAGGCAGCCTTGGAGAGCCCCAGG
CCAGCCCTGGTGAGATCCGCCTCCAGTGACACCAGCGAGGAGCTGAATTCCCAAGACAGCCCCCCAAAACAGGACTCCACAGCGCCCTCG
TCTACCTCCTCCTCCGACCCCATCCTAGACTTCAACATCTCCCTGGCCATGGCCAAAGAGAGGGCCCACCAGAAACGCAGCAGCAAACGG

>In-frame_RARA_ENST00000394081_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_1428nt
ATGTACGAGAGTGTAGAAGTGGGGGGTCCCACCCCTAATCCCTTCCTAGTGGTGGATTTTTATAACCAGAACCGGGCCTGTTTGCTCCCA
GAGAAGGGGCTCCCCGCCCCGGGTCCGTACTCCACCCCGCTCCGGACTCCGCTTTGGAATGGCTCAAACCACTCCATTGAGACCCAGAGC
AGCAGTTCTGAAGAGATAGTGCCCAGCCCTCCCTCGCCACCCCCTCTACCCCGCATCTACAAGCCTTGCTTTGTCTGTCAGGACAAGTCC
TCAGGCTACCACTATGGGGTCAGCGCCTGTGAGGGCTGCAAGGGCTTCTTCCGCCGCAGCATCCAGAAGAACATGGTGTACACGTGTCAC
CGGGACAAGAACTGCATCATCAACAAGGTGACCCGGAACCGCTGCCAGTACTGCCGACTGCAGAAGTGCTTTGAAGTGGGCATGTCCAAG
GAGTCTGTGAGAAACGACCGAAACAAGAAGAAGAAGGAGGTGCCCAAGCCCGAGTGCTCTGAGAGCTACACGCTGACGCCGGAGGTGGGG
GAGCTCATTGAGAAGGTGCGCAAAGCGCACCAGGAAACCTTCCCTGCCCTCTGCCAGCTGGGCAAATACACTACGAACAACAGCTCAGAA
CAACGTGTCTCTCTGGACATTGACCTCTGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCATTAAGACTGTGGAGTTCGCCAAGCAG
CTGCCCGGCTTCACCACCCTCACCATCGCCGACCAGATCACCCTCCTCAAGGCTGCCTGCCTGGACATCCTGCGCGAGCTTCGGCCTCGG
CTCTGTACCATGAAGAAGGGCCCCAGTGGCTATGGCTTCAACCTGCACAGCGACAAGTCCAAGCCAGGCCAGTTCATCCGGTCAGTGGAC
CCAGACTCCCCGGCTGAGGCTTCAGGGCTCCGGGCCCAGGATCGCATTGTGGAGGTGAACGGGGTCTGCATGGAGGGGAAGCAGCATGGG
GACGTGGTGTCCGCCATCAGGGCTGGCGGGGACGAGACCAAGCTGCTGGTGGTGGACAGGGAAACTGACGAGTTCTTCAAGAAATGCAGA
GTGATCCCATCTCAGGAGCACCTGAATGGTCCCCTGCCTGTGCCCTTCACCAATGGGGAGATACAGAAGGAGAACAGTCGTGAAGCCCTG
GCAGAGGCAGCCTTGGAGAGCCCCAGGCCAGCCCTGGTGAGATCCGCCTCCAGTGACACCAGCGAGGAGCTGAATTCCCAAGACAGCCCC
CCAAAACAGGACTCCACAGCGCCCTCGTCTACCTCCTCCTCCGACCCCATCCTAGACTTCAACATCTCCCTGGCCATGGCCAAAGAGAGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RARA_ENST00000254066_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_2595nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCACCATTGAGACCCAGAGCAGCAGTTCTGAAGAGATAGTGCCCAGCCCTCCCTCGCCACCCCCTCTACCCCGCATCTACAAGCCTTGCT
TTGTCTGTCAGGACAAGTCCTCAGGCTACCACTATGGGGTCAGCGCCTGTGAGGGCTGCAAGGGCTTCTTCCGCCGCAGCATCCAGAAGA
ACATGGTGTACACGTGTCACCGGGACAAGAACTGCATCATCAACAAGGTGACCCGGAACCGCTGCCAGTACTGCCGACTGCAGAAGTGCT
TTGAAGTGGGCATGTCCAAGGAGTCTGTGAGAAACGACCGAAACAAGAAGAAGAAGGAGGTGCCCAAGCCCGAGTGCTCTGAGAGCTACA
CGCTGACGCCGGAGGTGGGGGAGCTCATTGAGAAGGTGCGCAAAGCGCACCAGGAAACCTTCCCTGCCCTCTGCCAGCTGGGCAAATACA
CTACGAACAACAGCTCAGAACAACGTGTCTCTCTGGACATTGACCTCTGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCATTAAGA
CTGTGGAGTTCGCCAAGCAGCTGCCCGGCTTCACCACCCTCACCATCGCCGACCAGATCACCCTCCTCAAGGCTGCCTGCCTGGACATCC
TGCGCGAGCTTCGGCCTCGGCTCTGTACCATGAAGAAGGGCCCCAGTGGCTATGGCTTCAACCTGCACAGCGACAAGTCCAAGCCAGGCC
AGTTCATCCGGTCAGTGGACCCAGACTCCCCGGCTGAGGCTTCAGGGCTCCGGGCCCAGGATCGCATTGTGGAGGTGAACGGGGTCTGCA
TGGAGGGGAAGCAGCATGGGGACGTGGTGTCCGCCATCAGGGCTGGCGGGGACGAGACCAAGCTGCTGGTGGTGGACAGGGAAACTGACG
AGTTCTTCAAGAAATGCAGAGTGATCCCATCTCAGGAGCACCTGAATGGTCCCCTGCCTGTGCCCTTCACCAATGGGGAGATACAGAAGG
AGAACAGTCGTGAAGCCCTGGCAGAGGCAGCCTTGGAGAGCCCCAGGCCAGCCCTGGTGAGATCCGCCTCCAGTGACACCAGCGAGGAGC
TGAATTCCCAAGACAGCCCCCCAAAACAGGACTCCACAGCGCCCTCGTCTACCTCCTCCTCCGACCCCATCCTAGACTTCAACATCTCCC
TGGCCATGGCCAAAGAGAGGGCCCACCAGAAACGCAGCAGCAAACGGGCCCCGCAGATGGACTGGAGCAAGAAAAACGAACTCTTCAGCA
ACCTCTGAGCGCCCTGCTGCCACCCAGTGACTGGCAGGGCCGAGCCAGCATTCCACCCCACCTTTTTCCTTCTCCCCAATTACTCCCCTG
AATCAATGTACAAATCAGCACCCACATCCCCTTTCTTGACAAATGATTTTTCTAGAGAACTATGTTCTTCCCTGACTTTAGGGAAGGTGA
ATGTGTTCCCGTCCTCCCGCAGTCAGAAAGGAGACTCTGCCTCCCTCCTCCTCACTGAGTGCCTCATCCTACCGGGTGTCCCTTTGCCAC
CCTGCCTGGGACATCGCTGGAACCTGCACCATGCCAGGATCATGGGACCAGGCGAGAGGGCACCCTCCCTTCCTCCCCCATGTGATAAAT
GGGTCCAGGGCTGATCAAAGAACTCTGACTGCAGAACTGCCGCTCTCAGTGGACAGGGCATCTGTTACCCTGAGACCTGTGGCAGACACG
TCTTGTTTTCATTTGATTTTTGTTAAGAGTGCAGTATTGCAGAGTCTAGAGGAATTTTTGTTTCCTTGATTAACATGATTTTCCTGGTTG
TTACATCCAGGGCATGGCAGTGGCCTCAGCCTTAAACTTTTGTTCCTACTCCCACCCTCAGCGAACTGGGCAGCACGGGGAGGGTTTGGC

>In-frame_RARA_ENST00000394089_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_2670nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCACCATTGAGACCC
AGAGCAGCAGTTCTGAAGAGATAGTGCCCAGCCCTCCCTCGCCACCCCCTCTACCCCGCATCTACAAGCCTTGCTTTGTCTGTCAGGACA
AGTCCTCAGGCTACCACTATGGGGTCAGCGCCTGTGAGGGCTGCAAGGGCTTCTTCCGCCGCAGCATCCAGAAGAACATGGTGTACACGT
GTCACCGGGACAAGAACTGCATCATCAACAAGGTGACCCGGAACCGCTGCCAGTACTGCCGACTGCAGAAGTGCTTTGAAGTGGGCATGT
CCAAGGAGTCTGTGAGAAACGACCGAAACAAGAAGAAGAAGGAGGTGCCCAAGCCCGAGTGCTCTGAGAGCTACACGCTGACGCCGGAGG
TGGGGGAGCTCATTGAGAAGGTGCGCAAAGCGCACCAGGAAACCTTCCCTGCCCTCTGCCAGCTGGGCAAATACACTACGAACAACAGCT
CAGAACAACGTGTCTCTCTGGACATTGACCTCTGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCATTAAGACTGTGGAGTTCGCCA
AGCAGCTGCCCGGCTTCACCACCCTCACCATCGCCGACCAGATCACCCTCCTCAAGGCTGCCTGCCTGGACATCCTGCGCGAGCTTCGGC
CTCGGCTCTGTACCATGAAGAAGGGCCCCAGTGGCTATGGCTTCAACCTGCACAGCGACAAGTCCAAGCCAGGCCAGTTCATCCGGTCAG
TGGACCCAGACTCCCCGGCTGAGGCTTCAGGGCTCCGGGCCCAGGATCGCATTGTGGAGGTGAACGGGGTCTGCATGGAGGGGAAGCAGC
ATGGGGACGTGGTGTCCGCCATCAGGGCTGGCGGGGACGAGACCAAGCTGCTGGTGGTGGACAGGGAAACTGACGAGTTCTTCAAGAAAT
GCAGAGTGATCCCATCTCAGGAGCACCTGAATGGTCCCCTGCCTGTGCCCTTCACCAATGGGGAGATACAGAAGGAGAACAGTCGTGAAG
CCCTGGCAGAGGCAGCCTTGGAGAGCCCCAGGCCAGCCCTGGTGAGATCCGCCTCCAGTGACACCAGCGAGGAGCTGAATTCCCAAGACA
GCCCCCCAAAACAGGACTCCACAGCGCCCTCGTCTACCTCCTCCTCCGACCCCATCCTAGACTTCAACATCTCCCTGGCCATGGCCAAAG
AGAGGGCCCACCAGAAACGCAGCAGCAAACGGGCCCCGCAGATGGACTGGAGCAAGAAAAACGAACTCTTCAGCAACCTCTGAGCGCCCT
GCTGCCACCCAGTGACTGGCAGGGCCGAGCCAGCATTCCACCCCACCTTTTTCCTTCTCCCCAATTACTCCCCTGAATCAATGTACAAAT
CAGCACCCACATCCCCTTTCTTGACAAATGATTTTTCTAGAGAACTATGTTCTTCCCTGACTTTAGGGAAGGTGAATGTGTTCCCGTCCT
CCCGCAGTCAGAAAGGAGACTCTGCCTCCCTCCTCCTCACTGAGTGCCTCATCCTACCGGGTGTCCCTTTGCCACCCTGCCTGGGACATC
GCTGGAACCTGCACCATGCCAGGATCATGGGACCAGGCGAGAGGGCACCCTCCCTTCCTCCCCCATGTGATAAATGGGTCCAGGGCTGAT
CAAAGAACTCTGACTGCAGAACTGCCGCTCTCAGTGGACAGGGCATCTGTTACCCTGAGACCTGTGGCAGACACGTCTTGTTTTCATTTG
ATTTTTGTTAAGAGTGCAGTATTGCAGAGTCTAGAGGAATTTTTGTTTCCTTGATTAACATGATTTTCCTGGTTGTTACATCCAGGGCAT
GGCAGTGGCCTCAGCCTTAAACTTTTGTTCCTACTCCCACCCTCAGCGAACTGGGCAGCACGGGGAGGGTTTGGCTACCCCTGCCCATCC

>In-frame_RARA_ENST00000425707_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_2375nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCACTGTGAGAAACGACCG
AAACAAGAAGAAGAAGGAGGTGCCCAAGCCCGAGTGCTCTGAGAGCTACACGCTGACGCCGGAGGTGGGGGAGCTCATTGAGAAGGTGCG
CAAAGCGCACCAGGAAACCTTCCCTGCCCTCTGCCAGCTGGGCAAATACACTACGAACAACAGCTCAGAACAACGTGTCTCTCTGGACAT
TGACCTCTGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCATTAAGACTGTGGAGTTCGCCAAGCAGCTGCCCGGCTTCACCACCCT
CACCATCGCCGACCAGATCACCCTCCTCAAGGCTGCCTGCCTGGACATCCTGCGCGAGCTTCGGCCTCGGCTCTGTACCATGAAGAAGGG
CCCCAGTGGCTATGGCTTCAACCTGCACAGCGACAAGTCCAAGCCAGGCCAGTTCATCCGGTCAGTGGACCCAGACTCCCCGGCTGAGGC
TTCAGGGCTCCGGGCCCAGGATCGCATTGTGGAGGTGAACGGGGTCTGCATGGAGGGGAAGCAGCATGGGGACGTGGTGTCCGCCATCAG
GGCTGGCGGGGACGAGACCAAGCTGCTGGTGGTGGACAGGGAAACTGACGAGTTCTTCAAGAAATGCAGAGTGATCCCATCTCAGGAGCA
CCTGAATGGTCCCCTGCCTGTGCCCTTCACCAATGGGGAGATACAGAAGGAGAACAGTCGTGAAGCCCTGGCAGAGGCAGCCTTGGAGAG
CCCCAGGCCAGCCCTGGTGAGATCCGCCTCCAGTGACACCAGCGAGGAGCTGAATTCCCAAGACAGCCCCCCAAAACAGGACTCCACAGC
GCCCTCGTCTACCTCCTCCTCCGACCCCATCCTAGACTTCAACATCTCCCTGGCCATGGCCAAAGAGAGGGCCCACCAGAAACGCAGCAG
CAAACGGGCCCCGCAGATGGACTGGAGCAAGAAAAACGAACTCTTCAGCAACCTCTGAGCGCCCTGCTGCCACCCAGTGACTGGCAGGGC
CGAGCCAGCATTCCACCCCACCTTTTTCCTTCTCCCCAATTACTCCCCTGAATCAATGTACAAATCAGCACCCACATCCCCTTTCTTGAC
AAATGATTTTTCTAGAGAACTATGTTCTTCCCTGACTTTAGGGAAGGTGAATGTGTTCCCGTCCTCCCGCAGTCAGAAAGGAGACTCTGC
CTCCCTCCTCCTCACTGAGTGCCTCATCCTACCGGGTGTCCCTTTGCCACCCTGCCTGGGACATCGCTGGAACCTGCACCATGCCAGGAT
CATGGGACCAGGCGAGAGGGCACCCTCCCTTCCTCCCCCATGTGATAAATGGGTCCAGGGCTGATCAAAGAACTCTGACTGCAGAACTGC
CGCTCTCAGTGGACAGGGCATCTGTTACCCTGAGACCTGTGGCAGACACGTCTTGTTTTCATTTGATTTTTGTTAAGAGTGCAGTATTGC
AGAGTCTAGAGGAATTTTTGTTTCCTTGATTAACATGATTTTCCTGGTTGTTACATCCAGGGCATGGCAGTGGCCTCAGCCTTAAACTTT
TGTTCCTACTCCCACCCTCAGCGAACTGGGCAGCACGGGGAGGGTTTGGCTACCCCTGCCCATCCCTGAGCCAGGTACCACCATTGTAAG

>In-frame_RARA_ENST00000394086_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_2190nt
ACATGATGTCACAGACAATGACACAAGCCGGTGTCTCATTCCGACACAGCGTCCGAGCTGCACAATGTCACACCCGGGTGCCAAACACTT
GGCCCCGCGCGACCCGGCCCTACGCCTCCTGCCGCCGCTCTCCGCGTCTCCGGGGGAGGTGGCCCGGTTCGGCCGGGCAGGGGGCTGGCG
GGCGAGCCCCGCGGGCGGGCTGGCGAGCGGGTGATGTCACGGGCAGCGCCATTGAGACCCAGAGCAGCAGTTCTGAAGAGATAGTGCCCA
GCCCTCCCTCGCCACCCCCTCTACCCCGCATCTACAAGCCTTGCTTTGTCTGTCAGGACAAGTCCTCAGGCTACCACTATGGGGTCAGCG
CCTGTGAGGGCTGCAAGGGCTTCTTCCGCCGCAGCATCCAGAAGAACATGGTGTACACGTGTCACCGGGACAAGAACTGCATCATCAACA
AGGTGACCCGGAACCGCTGCCAGTACTGCCGACTGCAGAAGTGCTTTGAAGTGGGCATGTCCAAGGAGTCTGTGAGAAACGACCGAAACA
AGAAGAAGAAGGAGGTGCCCAAGCCCGAGTGCTCTGAGAGCTACACGCTGACGCCGGAGGTGGGGGAGCTCATTGAGAAGGTGCGCAAAG
CGCACCAGGAAACCTTCCCTGCCCTCTGCCAGCTGGGCAAATACACTACGAACAACAGCTCAGAACAACGTGTCTCTCTGGACATTGACC
TCTGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCATTAAGACTGTGGAGTTCGCCAAGCAGCTGCCCGGCTTCACCACCCTCACCA
TCGCCGACCAGATCACCCTCCTCAAGGCTGCCTGCCTGGACATCCTGCGCGAGCTTCGGCCTCGGCTCTGTACCATGAAGAAGGGCCCCA
GTGGCTATGGCTTCAACCTGCACAGCGACAAGTCCAAGCCAGGCCAGTTCATCCGGTCAGTGGACCCAGACTCCCCGGCTGAGGCTTCAG
GGCTCCGGGCCCAGGATCGCATTGTGGAGGTGAACGGGGTCTGCATGGAGGGGAAGCAGCATGGGGACGTGGTGTCCGCCATCAGGGCTG
GCGGGGACGAGACCAAGCTGCTGGTGGTGGACAGGGAAACTGACGAGTTCTTCAAGAAATGCAGAGTGATCCCATCTCAGGAGCACCTGA
ATGGTCCCCTGCCTGTGCCCTTCACCAATGGGGAGATACAGAAGGAGAACAGTCGTGAAGCCCTGGCAGAGGCAGCCTTGGAGAGCCCCA
GGCCAGCCCTGGTGAGATCCGCCTCCAGTGACACCAGCGAGGAGCTGAATTCCCAAGACAGCCCCCCAAAACAGGACTCCACAGCGCCCT
CGTCTACCTCCTCCTCCGACCCCATCCTAGACTTCAACATCTCCCTGGCCATGGCCAAAGAGAGGGCCCACCAGAAACGCAGCAGCAAAC
GGGCCCCGCAGATGGACTGGAGCAAGAAAAACGAACTCTTCAGCAACCTCTGAGCGCCCTGCTGCCACCCAGTGACTGGCAGGGCCGAGC
CAGCATTCCACCCCACCTTTTTCCTTCTCCCCAATTACTCCCCTGAATCAATGTACAAATCAGCACCCACATCCCCTTTCTTGACAAATG
ATTTTTCTAGAGAACTATGTTCTTCCCTGACTTTAGGGAAGGTGAATGTGTTCCCGTCCTCCCGCAGTCAGAAAGGAGACTCTGCCTCCC
TCCTCCTCACTGAGTGCCTCATCCTACCGGGTGTCCCTTTGCCACCCTGCCTGGGACATCGCTGGAACCTGCACCATGCCAGGATCATGG
GACCAGGCGAGAGGGCACCCTCCCTTCCTCCCCCATGTGATAAATGGGTCCAGGGCTGATCAAAGAACTCTGACTGCAGAACTGCCGCTC
TCAGTGGACAGGGCATCTGTTACCCTGAGACCTGTGGCAGACACGTCTTGTTTTCATTTGATTTTTGTTAAGAGTGCAGTATTGCAGAGT
CTAGAGGAATTTTTGTTTCCTTGATTAACATGATTTTCCTGGTTGTTACATCCAGGGCATGGCAGTGGCCTCAGCCTTAAACTTTTGTTC
CTACTCCCACCCTCAGCGAACTGGGCAGCACGGGGAGGGTTTGGCTACCCCTGCCCATCCCTGAGCCAGGTACCACCATTGTAAGGAAAC

>In-frame_RARA_ENST00000394081_chr17_38508759_+_SLC9A3R1_ENST00000262613_chr17_72758151_+_2467nt
AGCCGCTGTACTCTGCCTCGGACGCCACGAGACTCTAGACGGGAGTCCCCTCGAGGTGAAGCCGCTGAGTTCCCGGGCCCCGCCAGGCTT
CCCTGGGAGAGCCGACGGACCCCCCCTCCCAGCACACACAACTTCCCTGCTTTTCACCGGGACTGGCGGAGCGGCCGGCGGACTTAGACG
CGGGGACTTCAGGGCAGGGGGCGCCCCCTGCCCGGGTCACCAGTCGGGGCGAGGGGACGTCTCCTCTCCCCCAGCTGCTCTGCTCGGATG
GCGCCGCCGGCTGAGTGACGGGGGCGGCGCGCAGGACTTCCCAGCTCGGACCTCTTGCCTTCGAGGGGAAAGATGTACGAGAGTGTAGAA
GTGGGGGGTCCCACCCCTAATCCCTTCCTAGTGGTGGATTTTTATAACCAGAACCGGGCCTGTTTGCTCCCAGAGAAGGGGCTCCCCGCC
CCGGGTCCGTACTCCACCCCGCTCCGGACTCCGCTTTGGAATGGCTCAAACCACTCCATTGAGACCCAGAGCAGCAGTTCTGAAGAGATA
GTGCCCAGCCCTCCCTCGCCACCCCCTCTACCCCGCATCTACAAGCCTTGCTTTGTCTGTCAGGACAAGTCCTCAGGCTACCACTATGGG
GTCAGCGCCTGTGAGGGCTGCAAGGGCTTCTTCCGCCGCAGCATCCAGAAGAACATGGTGTACACGTGTCACCGGGACAAGAACTGCATC
ATCAACAAGGTGACCCGGAACCGCTGCCAGTACTGCCGACTGCAGAAGTGCTTTGAAGTGGGCATGTCCAAGGAGTCTGTGAGAAACGAC
CGAAACAAGAAGAAGAAGGAGGTGCCCAAGCCCGAGTGCTCTGAGAGCTACACGCTGACGCCGGAGGTGGGGGAGCTCATTGAGAAGGTG
CGCAAAGCGCACCAGGAAACCTTCCCTGCCCTCTGCCAGCTGGGCAAATACACTACGAACAACAGCTCAGAACAACGTGTCTCTCTGGAC
ATTGACCTCTGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCATTAAGACTGTGGAGTTCGCCAAGCAGCTGCCCGGCTTCACCACC
CTCACCATCGCCGACCAGATCACCCTCCTCAAGGCTGCCTGCCTGGACATCCTGCGCGAGCTTCGGCCTCGGCTCTGTACCATGAAGAAG
GGCCCCAGTGGCTATGGCTTCAACCTGCACAGCGACAAGTCCAAGCCAGGCCAGTTCATCCGGTCAGTGGACCCAGACTCCCCGGCTGAG
GCTTCAGGGCTCCGGGCCCAGGATCGCATTGTGGAGGTGAACGGGGTCTGCATGGAGGGGAAGCAGCATGGGGACGTGGTGTCCGCCATC
AGGGCTGGCGGGGACGAGACCAAGCTGCTGGTGGTGGACAGGGAAACTGACGAGTTCTTCAAGAAATGCAGAGTGATCCCATCTCAGGAG
CACCTGAATGGTCCCCTGCCTGTGCCCTTCACCAATGGGGAGATACAGAAGGAGAACAGTCGTGAAGCCCTGGCAGAGGCAGCCTTGGAG
AGCCCCAGGCCAGCCCTGGTGAGATCCGCCTCCAGTGACACCAGCGAGGAGCTGAATTCCCAAGACAGCCCCCCAAAACAGGACTCCACA
GCGCCCTCGTCTACCTCCTCCTCCGACCCCATCCTAGACTTCAACATCTCCCTGGCCATGGCCAAAGAGAGGGCCCACCAGAAACGCAGC
AGCAAACGGGCCCCGCAGATGGACTGGAGCAAGAAAAACGAACTCTTCAGCAACCTCTGAGCGCCCTGCTGCCACCCAGTGACTGGCAGG
GCCGAGCCAGCATTCCACCCCACCTTTTTCCTTCTCCCCAATTACTCCCCTGAATCAATGTACAAATCAGCACCCACATCCCCTTTCTTG
ACAAATGATTTTTCTAGAGAACTATGTTCTTCCCTGACTTTAGGGAAGGTGAATGTGTTCCCGTCCTCCCGCAGTCAGAAAGGAGACTCT
GCCTCCCTCCTCCTCACTGAGTGCCTCATCCTACCGGGTGTCCCTTTGCCACCCTGCCTGGGACATCGCTGGAACCTGCACCATGCCAGG
ATCATGGGACCAGGCGAGAGGGCACCCTCCCTTCCTCCCCCATGTGATAAATGGGTCCAGGGCTGATCAAAGAACTCTGACTGCAGAACT
GCCGCTCTCAGTGGACAGGGCATCTGTTACCCTGAGACCTGTGGCAGACACGTCTTGTTTTCATTTGATTTTTGTTAAGAGTGCAGTATT
GCAGAGTCTAGAGGAATTTTTGTTTCCTTGATTAACATGATTTTCCTGGTTGTTACATCCAGGGCATGGCAGTGGCCTCAGCCTTAAACT
TTTGTTCCTACTCCCACCCTCAGCGAACTGGGCAGCACGGGGAGGGTTTGGCTACCCCTGCCCATCCCTGAGCCAGGTACCACCATTGTA


Top

FusionGenePPI for RARA_SLC9A3R1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RARANRBF2, ZBTB16, MECR, RXRG, RXRB, NCOA6, GADD45G, GADD45A, NRIP1, KAT2B, HDAC3, HDAC4, TDG, PML, TRIP4, KDM5A, RXRA, POU2F1, NCOR2, NR0B2, BAG1, TADA3, NCOR1, NKX2-1, TRIM24, IRX4, SP1, NPAS2, CLOCK, ARNTL, NR2E3, CCND3, NCOA2, SRC, AJUBA, LIMD1, WTIP, SKI, HR, PIN1, SUV39H1, PSMC5, EP300, PARP1, MED6, TOP2B, SAP130, HNRNPU, RFC4, NPM1, MRTO4, SNRNP40, MED1, NCOA1, HMGA1, RUVBL1, RUNX1, SIAH1, RARA, HDAC2, NCOA3, CREBBP, LRIF1, KLF5, SMARCD3, ARID1A, SPI1, PRDX6, NR1H2, ITGB1BP2, MED25, MAPK6, FOXO1, MAPK1, TRIM32, PHF8, TNIP1, HACE1, SQSTM1, UBQLN1, ARID5A, UBE3A, PRAM1, FAS, PRAME, TBL1XR1, SUZ12, EZH2, USP7, TMEM54, MMS19, AKT1, FN1, WWOX, E2F1, MBD3, MTA2, CBX5, CEBPA, HDAC1, NSD1, TEKT4, SNW1, SIRT1, ACTN4, SRF, MDM2, ZNF131, RARG, RARB, TRIM25SLC9A3R1KCNJ1, OPRK1, SLC9A3R1, SLC9A3, PDZK1, CTNNB1, ABCC2, CFTR, PLCB1, YAP1, YES1, ADRB2, GNB2L1, SLC4A8, NOS2, MSN, NF2, TBC1D10A, CLCN3, PTH1R, PDGFRA, PDGFRB, P2RY1, PAG1, EZR, SCN4A, PHLPP2, MME, PTEN, TCF3, UQCRFS1P1, RNASET2, TACC1, UQCRFS1, MDH1, PCYOX1, RPS3, PPME1, PALM2, EPHB1, ABCC4, BCL10, ZNF468, GNA11, CAPN1, CKB, G6PD, LDHB, NANS, RPL23, CNDP2, CSE1L, DAK, ECHS1, FTO, GDA, LDHAL6B, NPEPPS, PDIA3, RPS6KA3, SMEK2, SMS, YWHAB, TGM2, UBFD1, YWHAQ, YWHAZ, SKP2, AKT1, IREB2, NTRK1, SLC4A7, PRKCA, CDCA5, U2AF2, PHLPP1, CDH1, SNRNP27, MAPK1, CDH2, PTPRQ


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RARA_SLC9A3R1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneRARAP10276DB00210AdapaleneRetinoic acid receptor alphasmall moleculeapproved
HgeneRARAP10276DB00459AcitretinRetinoic acid receptor alphasmall moleculeapproved
HgeneRARAP10276DB00982IsotretinoinRetinoic acid receptor alphasmall moleculeapproved
HgeneRARAP10276DB00523AlitretinoinRetinoic acid receptor alphasmall moleculeapproved|investigational
HgeneRARAP10276DB00799TazaroteneRetinoic acid receptor alphasmall moleculeapproved|investigational
HgeneRARAP10276DB00755TretinoinRetinoic acid receptor alphasmall moleculeapproved|investigational|nutraceutical

Top

RelatedDiseases for RARA_SLC9A3R1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRARAC0023487Acute Promyelocytic Leukemia22CTD_human;HPO;ORPHANET
HgeneRARAC0036341Schizophrenia3PSYGENET
HgeneRARAC0005586Bipolar Disorder1PSYGENET
HgeneRARAC0010701Phyllodes Tumor1CTD_human
HgeneRARAC0085183Neoplasms, Second Primary1CTD_human
HgeneRARAC0149940Sciatic Neuropathy1CTD_human
HgeneRARAC0206650Fibroadenoma1CTD_human
HgeneRARAC0525045Mood Disorders1PSYGENET
HgeneRARAC1458155Mammary Neoplasms1CTD_human
HgeneRARAC2239176Liver carcinoma1CTD_human
TgeneSLC9A3R1C2676782Nephrolithiasis-Osteoporosis, Hypophosphatemic, 22CTD_human;UNIPROT