FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30483

FusionGeneSummary for RARA_SKAP1

check button Fusion gene summary
Fusion gene informationFusion gene name: RARA_SKAP1
Fusion gene ID: 30483
HgeneTgene
Gene symbol

RARA

SKAP1

Gene ID

5914

8631

Gene nameretinoic acid receptor alphasrc kinase associated phosphoprotein 1
SynonymsNR1B1|RARHEL-S-81p|SCAP1|SKAP55
Cytomap

17q21.2

17q21.32

Type of geneprotein-codingprotein-coding
Descriptionretinoic acid receptor alphaRAR-alphanuclear receptor subfamily 1 group B member 1nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long formretinoic acid nuclear receptor alpha variant 1retinoic acid nuclear receptor alpha variant 2src kinase-associated phosphoprotein 1SKAP-55epididymis secretory sperm binding protein Li 81ppp55src family-associated phosphoprotein 1src kinase-associated phosphoprotein of 55 kDa
Modification date2018052320180523
UniProtAcc

P10276

Q86WV1

Ensembl transtripts involved in fusion geneENST00000254066, ENST00000394089, 
ENST00000425707, ENST00000394086, 
ENST00000394081, ENST00000420042, 
ENST00000336915, ENST00000584924, 
Fusion gene scores* DoF score29 X 12 X 7=243622 X 8 X 9=1584
# samples 4222
** MAII scorelog2(42/2436*10)=-2.53605290024021
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(22/1584*10)=-2.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RARA [Title/Abstract] AND SKAP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRARA

GO:0007165

signal transduction

2825025

HgeneRARA

GO:0030853

negative regulation of granulocyte differentiation

19917671

HgeneRARA

GO:0032689

negative regulation of interferon-gamma production

18416830

HgeneRARA

GO:0032720

negative regulation of tumor necrosis factor production

18416830

HgeneRARA

GO:0032736

positive regulation of interleukin-13 production

18416830

HgeneRARA

GO:0032753

positive regulation of interleukin-4 production

18416830

HgeneRARA

GO:0032754

positive regulation of interleukin-5 production

18416830

HgeneRARA

GO:0045630

positive regulation of T-helper 2 cell differentiation

18416830

HgeneRARA

GO:0045892

negative regulation of transcription, DNA-templated

20080953

HgeneRARA

GO:0045893

positive regulation of transcription, DNA-templated

18845237|19850744|20080953

HgeneRARA

GO:0045944

positive regulation of transcription by RNA polymerase II

19850744

HgeneRARA

GO:0071300

cellular response to retinoic acid

19917671

HgeneRARA

GO:0071391

cellular response to estrogen stimulus

20080953

TgeneSKAP1

GO:0045944

positive regulation of transcription by RNA polymerase II

11909961


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-B6-A0IN-01ARARAchr17

38487648

+SKAP1chr17

46214699

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000254066ENST00000336915RARAchr17

38487648

+SKAP1chr17

46214699

-
Frame-shitENST00000254066ENST00000584924RARAchr17

38487648

+SKAP1chr17

46214699

-
In-frameENST00000394089ENST00000336915RARAchr17

38487648

+SKAP1chr17

46214699

-
Frame-shitENST00000394089ENST00000584924RARAchr17

38487648

+SKAP1chr17

46214699

-
In-frameENST00000425707ENST00000336915RARAchr17

38487648

+SKAP1chr17

46214699

-
Frame-shitENST00000425707ENST00000584924RARAchr17

38487648

+SKAP1chr17

46214699

-
intron-3CDSENST00000394086ENST00000336915RARAchr17

38487648

+SKAP1chr17

46214699

-
intron-3CDSENST00000394086ENST00000584924RARAchr17

38487648

+SKAP1chr17

46214699

-
intron-3CDSENST00000394081ENST00000336915RARAchr17

38487648

+SKAP1chr17

46214699

-
intron-3CDSENST00000394081ENST00000584924RARAchr17

38487648

+SKAP1chr17

46214699

-
intron-3CDSENST00000420042ENST00000336915RARAchr17

38487648

+SKAP1chr17

46214699

-
intron-3CDSENST00000420042ENST00000584924RARAchr17

38487648

+SKAP1chr17

46214699

-

Top

FusionProtFeatures for RARA_SKAP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RARA

P10276

SKAP1

Q86WV1

Receptor for retinoic acid. Retinoic acid receptors bindas heterodimers to their target response elements in response totheir ligands, all-trans or 9-cis retinoic acid, and regulate geneexpression in various biological processes. The RXR/RARheterodimers bind to the retinoic acid response elements (RARE)composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In theabsence of ligand, the RXR-RAR heterodimers associate with amultiprotein complex containing transcription corepressors thatinduce histone acetylation, chromatin condensation andtranscriptional suppression. On ligand binding, the corepressorsdissociate from the receptors and associate with the coactivatorsleading to transcriptional activation. RARA plays an essentialrole in the regulation of retinoic acid-induced germ celldevelopment during spermatogenesis. Has a role in the survival ofearly spermatocytes at the beginning prophase of meiosis. InSertoli cells, may promote the survival and development of earlymeiotic prophase spermatocytes. In concert with RARG, required forskeletal growth, matrix homeostasis and growth plate function (Bysimilarity). {ECO:0000250|UniProtKB:P11416,ECO:0000269|PubMed:16417524, ECO:0000269|PubMed:19850744,ECO:0000269|PubMed:20215566}. Positively regulates T-cell receptor signaling byenhancing the MAP kinase pathway. Required for optimal conjugationbetween T-cells and antigen-presenting cells by promoting theclustering of integrin ITGAL on the surface of T-cells. May beinvolved in high affinity immunoglobulin epsilon receptorsignaling in mast cells. {ECO:0000269|PubMed:10856234,ECO:0000269|PubMed:11909961, ECO:0000269|PubMed:12652296,ECO:0000269|PubMed:15939789, ECO:0000269|PubMed:16980616}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRARAchr17:38487648chr17:46214699ENST00000254066+2988_15359463DNA bindingNuclear receptor
HgeneRARAchr17:38487648chr17:46214699ENST00000394081+1888_153-114458DNA bindingNuclear receptor
HgeneRARAchr17:38487648chr17:46214699ENST00000394089+2988_15359463DNA bindingNuclear receptor
HgeneRARAchr17:38487648chr17:46214699ENST00000425707+2788_15359366DNA bindingNuclear receptor
HgeneRARAchr17:38487648chr17:46214699ENST00000254066+29183_41759463DomainNR LBD
HgeneRARAchr17:38487648chr17:46214699ENST00000394081+18183_417-114458DomainNR LBD
HgeneRARAchr17:38487648chr17:46214699ENST00000394089+29183_41759463DomainNR LBD
HgeneRARAchr17:38487648chr17:46214699ENST00000425707+27183_41759366DomainNR LBD
HgeneRARAchr17:38487648chr17:46214699ENST00000254066+29154_18259463RegionNote=Hinge
HgeneRARAchr17:38487648chr17:46214699ENST00000254066+291_8759463RegionNote=Modulating
HgeneRARAchr17:38487648chr17:46214699ENST00000254066+29404_41959463RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38487648chr17:46214699ENST00000394081+18154_182-114458RegionNote=Hinge
HgeneRARAchr17:38487648chr17:46214699ENST00000394081+181_87-114458RegionNote=Modulating
HgeneRARAchr17:38487648chr17:46214699ENST00000394081+18404_419-114458RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38487648chr17:46214699ENST00000394089+29154_18259463RegionNote=Hinge
HgeneRARAchr17:38487648chr17:46214699ENST00000394089+291_8759463RegionNote=Modulating
HgeneRARAchr17:38487648chr17:46214699ENST00000394089+29404_41959463RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38487648chr17:46214699ENST00000425707+27154_18259366RegionNote=Hinge
HgeneRARAchr17:38487648chr17:46214699ENST00000425707+271_8759366RegionNote=Modulating
HgeneRARAchr17:38487648chr17:46214699ENST00000425707+27404_41959366RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38487648chr17:46214699ENST00000254066+29124_14859463Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr17:46214699ENST00000254066+2988_10859463Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr17:46214699ENST00000394081+18124_148-114458Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr17:46214699ENST00000394081+1888_108-114458Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr17:46214699ENST00000394089+29124_14859463Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr17:46214699ENST00000394089+2988_10859463Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr17:46214699ENST00000425707+27124_14859366Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr17:46214699ENST00000425707+2788_10859366Zinc fingerNR C4-type
TgeneSKAP1chr17:38487648chr17:46214699ENST00000336915-1013220_230326448Compositional biasNote=Poly-Glu
TgeneSKAP1chr17:38487648chr17:46214699ENST00000584924-1012220_230326360Compositional biasNote=Poly-Glu
TgeneSKAP1chr17:38487648chr17:46214699ENST00000336915-1013107_210326448DomainPH
TgeneSKAP1chr17:38487648chr17:46214699ENST00000336915-1013294_355326448DomainSH3
TgeneSKAP1chr17:38487648chr17:46214699ENST00000584924-1012107_210326360DomainPH
TgeneSKAP1chr17:38487648chr17:46214699ENST00000584924-1012294_355326360DomainSH3


Top

FusionGeneSequence for RARA_SKAP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RARA_ENST00000254066_chr17_38487648_+_SKAP1_ENST00000336915_chr17_46214699_-_93aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPARV_HVWLVGGRTEQPRWDCSKGVSHHCL_SG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_SKAP1_ENST00000336915_chr17_46214699_-_93aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPARV_HVWLVGGRTEQPRWDCSKGVSHHCL_SG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_SKAP1_ENST00000336915_chr17_46214699_-_93aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPARV_HVWLVGGRTEQPRWDCSKGVSHHCL_SG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RARA_ENST00000254066_chr17_38487648_+_SKAP1_ENST00000336915_chr17_46214699_-_280nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAGA
GTATAACATGTATGGCTGGTGGGTGGGAGAACTGAACAGCCTCGTTGGGATTGTTCCAAAGGAGTATCTCACCACTGCCTTTGAAGTGGA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_SKAP1_ENST00000336915_chr17_46214699_-_280nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAGA
GTATAACATGTATGGCTGGTGGGTGGGAGAACTGAACAGCCTCGTTGGGATTGTTCCAAAGGAGTATCTCACCACTGCCTTTGAAGTGGA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_SKAP1_ENST00000336915_chr17_46214699_-_280nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAGA
GTATAACATGTATGGCTGGTGGGTGGGAGAACTGAACAGCCTCGTTGGGATTGTTCCAAAGGAGTATCTCACCACTGCCTTTGAAGTGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_RARA_ENST00000254066_chr17_38487648_+_SKAP1_ENST00000336915_chr17_46214699_-_1119nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAGAGTATAACATGTATGGCTGGTGGGTGGGAGAACTGAACAGCCTCGTTGGGATTGTTCCAAAGGAGTATCTCACCACTGCCTTTGAA
GTGGAAGAAAGATGAAACCCAGGAAATATATTCTTCCCTCTCTCCTGCCTTTATGAGGAAACTGATCATCAAAAGTTCCCACTCCCTACT
TCTGCCACCCCACCAACGCCTTGGACTCCTCTCTTTGCTGAAGAGACCCAAGTCTCTTGACACCTCAGAGTGACTGTAAGCTACCAGTAA
GACAAGTGGGAAGAGGCACGTTCATCAAACCTGTTACTAAACCAGCCTAGTCATAGCTCATCCCCATCTCTAAATGTGTCCACACAACCA
CATCTGCCTTTTCCACAAGCTTTTCACAAAGAAGGTGAGAGAGAAGGAAACCTTGGGAGGAGGACATTACTGGTTGTTCTGGCTGGTTTG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_SKAP1_ENST00000336915_chr17_46214699_-_1194nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAGAGTATAACATG
TATGGCTGGTGGGTGGGAGAACTGAACAGCCTCGTTGGGATTGTTCCAAAGGAGTATCTCACCACTGCCTTTGAAGTGGAAGAAAGATGA
AACCCAGGAAATATATTCTTCCCTCTCTCCTGCCTTTATGAGGAAACTGATCATCAAAAGTTCCCACTCCCTACTTCTGCCACCCCACCA
ACGCCTTGGACTCCTCTCTTTGCTGAAGAGACCCAAGTCTCTTGACACCTCAGAGTGACTGTAAGCTACCAGTAAGACAAGTGGGAAGAG
GCACGTTCATCAAACCTGTTACTAAACCAGCCTAGTCATAGCTCATCCCCATCTCTAAATGTGTCCACACAACCACATCTGCCTTTTCCA
CAAGCTTTTCACAAAGAAGGTGAGAGAGAAGGAAACCTTGGGAGGAGGACATTACTGGTTGTTCTGGCTGGTTTGAAAAGCACAAATAAA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_SKAP1_ENST00000336915_chr17_46214699_-_1190nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAGAGTATAACATGTATG
GCTGGTGGGTGGGAGAACTGAACAGCCTCGTTGGGATTGTTCCAAAGGAGTATCTCACCACTGCCTTTGAAGTGGAAGAAAGATGAAACC
CAGGAAATATATTCTTCCCTCTCTCCTGCCTTTATGAGGAAACTGATCATCAAAAGTTCCCACTCCCTACTTCTGCCACCCCACCAACGC
CTTGGACTCCTCTCTTTGCTGAAGAGACCCAAGTCTCTTGACACCTCAGAGTGACTGTAAGCTACCAGTAAGACAAGTGGGAAGAGGCAC
GTTCATCAAACCTGTTACTAAACCAGCCTAGTCATAGCTCATCCCCATCTCTAAATGTGTCCACACAACCACATCTGCCTTTTCCACAAG
CTTTTCACAAAGAAGGTGAGAGAGAAGGAAACCTTGGGAGGAGGACATTACTGGTTGTTCTGGCTGGTTTGAAAAGCACAAATAAACTTG


Top

FusionGenePPI for RARA_SKAP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RARANRBF2, ZBTB16, MECR, RXRG, RXRB, NCOA6, GADD45G, GADD45A, NRIP1, KAT2B, HDAC3, HDAC4, TDG, PML, TRIP4, KDM5A, RXRA, POU2F1, NCOR2, NR0B2, BAG1, TADA3, NCOR1, NKX2-1, TRIM24, IRX4, SP1, NPAS2, CLOCK, ARNTL, NR2E3, CCND3, NCOA2, SRC, AJUBA, LIMD1, WTIP, SKI, HR, PIN1, SUV39H1, PSMC5, EP300, PARP1, MED6, TOP2B, SAP130, HNRNPU, RFC4, NPM1, MRTO4, SNRNP40, MED1, NCOA1, HMGA1, RUVBL1, RUNX1, SIAH1, RARA, HDAC2, NCOA3, CREBBP, LRIF1, KLF5, SMARCD3, ARID1A, SPI1, PRDX6, NR1H2, ITGB1BP2, MED25, MAPK6, FOXO1, MAPK1, TRIM32, PHF8, TNIP1, HACE1, SQSTM1, UBQLN1, ARID5A, UBE3A, PRAM1, FAS, PRAME, TBL1XR1, SUZ12, EZH2, USP7, TMEM54, MMS19, AKT1, FN1, WWOX, E2F1, MBD3, MTA2, CBX5, CEBPA, HDAC1, NSD1, TEKT4, SNW1, SIRT1, ACTN4, SRF, MDM2, ZNF131, RARG, RARB, TRIM25SKAP1PTPRC, FYB, SRC, LYN, FYN, LCK, SKAP1, GRB2, APP, BLCAP, SH2D4A, PRAM1, FAM102A, AP3M1, MYO9B, MYO9A, POLR1B, LOC81691, EML3, WRN, ASPM, JPH1, POLR1A, POLR3A, RECQL4, HPS3, ZNF324, FAM208A, UXT, NCAPD3, MYCBP2, CUL2, PIP5K1A, NEK1, PLEKHH3, PHLDB3, PIK3C3, SEC63, SKAP2, GTF3C1, URI1, PIK3R2, PIK3R3, POLRMT, PLD2, UCKL1, PRR14L, KSR1, ZNHIT6, PDRG1, SETX, NEFL, ALMS1, APPBP2, DDX11L8, UTP15, SENP5, NCAPH2, PAX3, TBL2, ZNHIT2, ZNF644, SUGCT, PKN3, TTF2, PPHLN1, NPHP4, MTMR1, PKN2, C21orf2, POLA1, POLR3B, POLR2L, CCP110, SETD5, ELP3, DOCK7, USP54, POLR1E, TRMT44, POLR1D, EXPH5, NEK4, ATXN2, SBF1, GTPBP6, TRMT1, CD3EAP, PER1, SUPT6H, MCM8, RTEL1, TIGD5, PUSL1, KLHDC3, DYNLL2, MAP7D1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneSKAP1chr17:38487648chr17:46214699ENST00000336915-1013290_295326448FYB1
TgeneSKAP1chr17:38487648chr17:46214699ENST00000584924-1012290_295326360FYB1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RARA_SKAP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneRARAP10276DB00210AdapaleneRetinoic acid receptor alphasmall moleculeapproved
HgeneRARAP10276DB00459AcitretinRetinoic acid receptor alphasmall moleculeapproved
HgeneRARAP10276DB00982IsotretinoinRetinoic acid receptor alphasmall moleculeapproved
HgeneRARAP10276DB00523AlitretinoinRetinoic acid receptor alphasmall moleculeapproved|investigational
HgeneRARAP10276DB00799TazaroteneRetinoic acid receptor alphasmall moleculeapproved|investigational
HgeneRARAP10276DB00755TretinoinRetinoic acid receptor alphasmall moleculeapproved|investigational|nutraceutical

Top

RelatedDiseases for RARA_SKAP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRARAC0023487Acute Promyelocytic Leukemia22CTD_human;HPO;ORPHANET
HgeneRARAC0036341Schizophrenia3PSYGENET
HgeneRARAC0005586Bipolar Disorder1PSYGENET
HgeneRARAC0010701Phyllodes Tumor1CTD_human
HgeneRARAC0085183Neoplasms, Second Primary1CTD_human
HgeneRARAC0149940Sciatic Neuropathy1CTD_human
HgeneRARAC0206650Fibroadenoma1CTD_human
HgeneRARAC0525045Mood Disorders1PSYGENET
HgeneRARAC1458155Mammary Neoplasms1CTD_human
HgeneRARAC2239176Liver carcinoma1CTD_human
TgeneSKAP1C0919267ovarian neoplasm1CTD_human