FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30477

FusionGeneSummary for RARA_PML

check button Fusion gene summary
Fusion gene informationFusion gene name: RARA_PML
Fusion gene ID: 30477
HgeneTgene
Gene symbol

RARA

PML

Gene ID

5914

5371

Gene nameretinoic acid receptor alphapromyelocytic leukemia
SynonymsNR1B1|RARMYL|PP8675|RNF71|TRIM19
Cytomap

17q21.2

15q24.1

Type of geneprotein-codingprotein-coding
Descriptionretinoic acid receptor alphaRAR-alphanuclear receptor subfamily 1 group B member 1nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long formretinoic acid nuclear receptor alpha variant 1retinoic acid nuclear receptor alpha variant 2protein PMLPML/RARA fusionRING finger protein 71probable transcription factor PMLpromyelocytic leukemia proteinpromyelocytic leukemia, inducer oftripartite motif protein TRIM19tripartite motif-containing protein 19
Modification date2018052320180523
UniProtAcc

P10276

P29590

Ensembl transtripts involved in fusion geneENST00000254066, ENST00000394089, 
ENST00000425707, ENST00000394086, 
ENST00000394081, ENST00000420042, 
ENST00000395135, ENST00000395132, 
ENST00000268059, ENST00000354026, 
ENST00000268058, ENST00000565898, 
ENST00000569477, ENST00000569965, 
ENST00000567543, ENST00000435786, 
ENST00000436891, ENST00000564428, 
ENST00000359928, ENST00000563500, 
ENST00000569161, 
Fusion gene scores* DoF score29 X 12 X 7=24364 X 8 X 2=64
# samples 4215
** MAII scorelog2(42/2436*10)=-2.53605290024021
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/64*10)=1.22881869049588
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RARA [Title/Abstract] AND PML [Title/Abstract] AND fusion [Title/Abstract]

Diagnosis of acute promyelocytic leukaemia by RT-PCR: detection of PML-RARA and RARA-PML fusion transcripts (pmid: 1486033)
Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRARA

GO:0007165

signal transduction

2825025

HgeneRARA

GO:0030853

negative regulation of granulocyte differentiation

19917671

HgeneRARA

GO:0032689

negative regulation of interferon-gamma production

18416830

HgeneRARA

GO:0032720

negative regulation of tumor necrosis factor production

18416830

HgeneRARA

GO:0032736

positive regulation of interleukin-13 production

18416830

HgeneRARA

GO:0032753

positive regulation of interleukin-4 production

18416830

HgeneRARA

GO:0032754

positive regulation of interleukin-5 production

18416830

HgeneRARA

GO:0045630

positive regulation of T-helper 2 cell differentiation

18416830

HgeneRARA

GO:0045892

negative regulation of transcription, DNA-templated

20080953

HgeneRARA

GO:0045893

positive regulation of transcription, DNA-templated

18845237|19850744|20080953

HgeneRARA

GO:0045944

positive regulation of transcription by RNA polymerase II

19850744

HgeneRARA

GO:0071300

cellular response to retinoic acid

19917671

HgeneRARA

GO:0071391

cellular response to estrogen stimulus

20080953

TgenePML

GO:0001666

response to hypoxia

16915281

TgenePML

GO:0030308

negative regulation of cell growth

9448006

TgenePML

GO:0034097

response to cytokine

9412458

TgenePML

GO:0043161

proteasome-mediated ubiquitin-dependent protein catabolic process

22406621

TgenePML

GO:0045087

innate immune response

18248090

TgenePML

GO:0045892

negative regulation of transcription, DNA-templated

9448006

TgenePML

GO:0051457

maintenance of protein location in nucleus

17332504

TgenePML

GO:0065003

protein-containing complex assembly

12915590

TgenePML

GO:0090398

cellular senescence

22002537|22117195|23431171

TgenePML

GO:1902187

negative regulation of viral release from host cell

18248090


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLAMLTCGA-AB-2991-03ARARAchr17

38487648

+PMLchr15

74317198

+
TCGARVLAMLTCGA-AB-3001-03ARARAchr17

38487648

+PMLchr15

74317198

+
TCGARVLAMLTCGA-AB-3012-03ARARAchr17

38499119

+PMLchr15

74326819

+
TCGARVLAMLTCGA-AB-2980-03ARARAchr17

38487648

+PMLchr15

74317198

+
TCGARVLAMLTCGA-AB-2998-03ARARAchr17

38487648

+PMLchr15

74325497

+
TCGARVLAMLTCGA-AB-2823-03ARARAchr17

38487648

+PMLchr15

74317198

+
TCGARVLAMLTCGA-AB-2840-03ARARAchr17

38487648

+PMLchr15

74317198

+
TCGARVLAMLTCGA-AB-2841-03BRARAchr17

38487648

+PMLchr15

74326819

+
TCGARVLAMLTCGA-AB-2994-03ARARAchr17

38487648

+PMLchr15

74326819

+
ChiTaRS3.1M82827RARAchr17

38487648

+PMLchr15

74317198

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000254066ENST00000395135RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000395132RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000268059RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000354026RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000268058RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000565898RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000569477RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000569965RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000567543RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000435786RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000436891RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000564428RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000359928RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000563500RARAchr17

38487648

+PMLchr15

74317198

+
5CDS-3UTRENST00000254066ENST00000569161RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000395135RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000395132RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000268059RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000354026RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000268058RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000565898RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000569477RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000569965RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000567543RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000435786RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000436891RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000564428RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000359928RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000563500RARAchr17

38487648

+PMLchr15

74317198

+
5CDS-3UTRENST00000394089ENST00000569161RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000395135RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000395132RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000268059RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000354026RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000268058RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000565898RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000569477RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000569965RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000567543RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000435786RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000436891RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000564428RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000359928RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000563500RARAchr17

38487648

+PMLchr15

74317198

+
5CDS-3UTRENST00000425707ENST00000569161RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000395135RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000395132RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000268059RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000354026RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000268058RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000565898RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000569477RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000569965RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000567543RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000435786RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000436891RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000564428RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000359928RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000563500RARAchr17

38487648

+PMLchr15

74317198

+
intron-3UTRENST00000394086ENST00000569161RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000395135RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000395132RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000268059RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000354026RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000268058RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000565898RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000569477RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000569965RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000567543RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000435786RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000436891RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000564428RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000359928RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000563500RARAchr17

38487648

+PMLchr15

74317198

+
intron-3UTRENST00000394081ENST00000569161RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000395135RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000395132RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000268059RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000354026RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000268058RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000565898RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000569477RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000569965RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000567543RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000435786RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000436891RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000564428RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000359928RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000563500RARAchr17

38487648

+PMLchr15

74317198

+
intron-3UTRENST00000420042ENST00000569161RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000254066ENST00000395135RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000254066ENST00000395132RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000254066ENST00000268059RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000254066ENST00000354026RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000254066ENST00000268058RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000254066ENST00000565898RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000254066ENST00000569477RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000254066ENST00000569965RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000254066ENST00000567543RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000254066ENST00000435786RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000254066ENST00000436891RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000254066ENST00000564428RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000254066ENST00000359928RARAchr17

38499119

+PMLchr15

74326819

+
intron-3UTRENST00000254066ENST00000563500RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000254066ENST00000569161RARAchr17

38499119

+PMLchr15

74326819

+
intron-3CDSENST00000394089ENST00000395135RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394089ENST00000395132RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394089ENST00000268059RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394089ENST00000354026RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394089ENST00000268058RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394089ENST00000565898RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394089ENST00000569477RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394089ENST00000569965RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394089ENST00000567543RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394089ENST00000435786RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394089ENST00000436891RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394089ENST00000564428RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394089ENST00000359928RARAchr17

38499119

+PMLchr15

74326819

+
intron-3UTRENST00000394089ENST00000563500RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394089ENST00000569161RARAchr17

38499119

+PMLchr15

74326819

+
intron-3CDSENST00000425707ENST00000395135RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000425707ENST00000395132RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000425707ENST00000268059RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000425707ENST00000354026RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000425707ENST00000268058RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000425707ENST00000565898RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000425707ENST00000569477RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000425707ENST00000569965RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000425707ENST00000567543RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000425707ENST00000435786RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000425707ENST00000436891RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000425707ENST00000564428RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000425707ENST00000359928RARAchr17

38499119

+PMLchr15

74326819

+
intron-3UTRENST00000425707ENST00000563500RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000425707ENST00000569161RARAchr17

38499119

+PMLchr15

74326819

+
intron-3CDSENST00000394086ENST00000395135RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000395132RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000268059RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000354026RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000268058RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000565898RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000569477RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000569965RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000567543RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000435786RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000436891RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000564428RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000359928RARAchr17

38499119

+PMLchr15

74326819

+
intron-3UTRENST00000394086ENST00000563500RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000569161RARAchr17

38499119

+PMLchr15

74326819

+
In-frameENST00000394081ENST00000395135RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-intronENST00000394081ENST00000395132RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-intronENST00000394081ENST00000268059RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-intronENST00000394081ENST00000354026RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-intronENST00000394081ENST00000268058RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-intronENST00000394081ENST00000565898RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-intronENST00000394081ENST00000569477RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-intronENST00000394081ENST00000569965RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-intronENST00000394081ENST00000567543RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-intronENST00000394081ENST00000435786RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-intronENST00000394081ENST00000436891RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-intronENST00000394081ENST00000564428RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-intronENST00000394081ENST00000359928RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-3UTRENST00000394081ENST00000563500RARAchr17

38499119

+PMLchr15

74326819

+
5CDS-intronENST00000394081ENST00000569161RARAchr17

38499119

+PMLchr15

74326819

+
intron-3CDSENST00000420042ENST00000395135RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000395132RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000268059RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000354026RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000268058RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000565898RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000569477RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000569965RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000567543RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000435786RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000436891RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000564428RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000359928RARAchr17

38499119

+PMLchr15

74326819

+
intron-3UTRENST00000420042ENST00000563500RARAchr17

38499119

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000569161RARAchr17

38499119

+PMLchr15

74326819

+
Frame-shitENST00000254066ENST00000395135RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000395132RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000268059RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000354026RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000268058RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000565898RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000569477RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000569965RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000567543RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000435786RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000436891RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000564428RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000359928RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000563500RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000254066ENST00000569161RARAchr17

38487648

+PMLchr15

74325497

+
Frame-shitENST00000394089ENST00000395135RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000395132RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000268059RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000354026RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000268058RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000565898RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000569477RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000569965RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000567543RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000435786RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000436891RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000564428RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000359928RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000563500RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000394089ENST00000569161RARAchr17

38487648

+PMLchr15

74325497

+
Frame-shitENST00000425707ENST00000395135RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000395132RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000268059RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000354026RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000268058RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000565898RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000569477RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000569965RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000567543RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000435786RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000436891RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000564428RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000359928RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000563500RARAchr17

38487648

+PMLchr15

74325497

+
5CDS-intronENST00000425707ENST00000569161RARAchr17

38487648

+PMLchr15

74325497

+
intron-3CDSENST00000394086ENST00000395135RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000395132RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000268059RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000354026RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000268058RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000565898RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000569477RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000569965RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000567543RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000435786RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000436891RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000564428RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000359928RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000563500RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394086ENST00000569161RARAchr17

38487648

+PMLchr15

74325497

+
intron-3CDSENST00000394081ENST00000395135RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000395132RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000268059RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000354026RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000268058RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000565898RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000569477RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000569965RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000567543RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000435786RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000436891RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000564428RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000359928RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000563500RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000394081ENST00000569161RARAchr17

38487648

+PMLchr15

74325497

+
intron-3CDSENST00000420042ENST00000395135RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000395132RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000268059RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000354026RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000268058RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000565898RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000569477RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000569965RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000567543RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000435786RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000436891RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000564428RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000359928RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000563500RARAchr17

38487648

+PMLchr15

74325497

+
intron-intronENST00000420042ENST00000569161RARAchr17

38487648

+PMLchr15

74325497

+
In-frameENST00000254066ENST00000395135RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000254066ENST00000395132RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000254066ENST00000268059RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000254066ENST00000354026RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000254066ENST00000268058RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000254066ENST00000565898RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000254066ENST00000569477RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000254066ENST00000569965RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000254066ENST00000567543RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000254066ENST00000435786RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000254066ENST00000436891RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000254066ENST00000564428RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000254066ENST00000359928RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-3UTRENST00000254066ENST00000563500RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000254066ENST00000569161RARAchr17

38487648

+PMLchr15

74326819

+
In-frameENST00000394089ENST00000395135RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000394089ENST00000395132RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000394089ENST00000268059RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000394089ENST00000354026RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000394089ENST00000268058RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000394089ENST00000565898RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000394089ENST00000569477RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000394089ENST00000569965RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000394089ENST00000567543RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000394089ENST00000435786RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000394089ENST00000436891RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000394089ENST00000564428RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000394089ENST00000359928RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-3UTRENST00000394089ENST00000563500RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000394089ENST00000569161RARAchr17

38487648

+PMLchr15

74326819

+
In-frameENST00000425707ENST00000395135RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000425707ENST00000395132RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000425707ENST00000268059RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000425707ENST00000354026RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000425707ENST00000268058RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000425707ENST00000565898RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000425707ENST00000569477RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000425707ENST00000569965RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000425707ENST00000567543RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000425707ENST00000435786RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000425707ENST00000436891RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000425707ENST00000564428RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000425707ENST00000359928RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-3UTRENST00000425707ENST00000563500RARAchr17

38487648

+PMLchr15

74326819

+
5CDS-intronENST00000425707ENST00000569161RARAchr17

38487648

+PMLchr15

74326819

+
intron-3CDSENST00000394086ENST00000395135RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000395132RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000268059RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000354026RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000268058RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000565898RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000569477RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000569965RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000567543RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000435786RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000436891RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000564428RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000359928RARAchr17

38487648

+PMLchr15

74326819

+
intron-3UTRENST00000394086ENST00000563500RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394086ENST00000569161RARAchr17

38487648

+PMLchr15

74326819

+
intron-3CDSENST00000394081ENST00000395135RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394081ENST00000395132RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394081ENST00000268059RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394081ENST00000354026RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394081ENST00000268058RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394081ENST00000565898RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394081ENST00000569477RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394081ENST00000569965RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394081ENST00000567543RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394081ENST00000435786RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394081ENST00000436891RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394081ENST00000564428RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394081ENST00000359928RARAchr17

38487648

+PMLchr15

74326819

+
intron-3UTRENST00000394081ENST00000563500RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000394081ENST00000569161RARAchr17

38487648

+PMLchr15

74326819

+
intron-3CDSENST00000420042ENST00000395135RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000395132RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000268059RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000354026RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000268058RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000565898RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000569477RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000569965RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000567543RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000435786RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000436891RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000564428RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000359928RARAchr17

38487648

+PMLchr15

74326819

+
intron-3UTRENST00000420042ENST00000563500RARAchr17

38487648

+PMLchr15

74326819

+
intron-intronENST00000420042ENST00000569161RARAchr17

38487648

+PMLchr15

74326819

+
In-frameENST00000254066ENST00000395135RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000395132RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000268059RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000354026RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000268058RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000565898RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000569477RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000569965RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000567543RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000435786RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000436891RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000564428RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000359928RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000254066ENST00000563500RARAchr17

38487648

+PMLchr15

74317198

+
5CDS-3UTRENST00000254066ENST00000569161RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000395135RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000395132RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000268059RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000354026RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000268058RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000565898RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000569477RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000569965RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000567543RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000435786RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000436891RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000564428RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000359928RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000394089ENST00000563500RARAchr17

38487648

+PMLchr15

74317198

+
5CDS-3UTRENST00000394089ENST00000569161RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000395135RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000395132RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000268059RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000354026RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000268058RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000565898RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000569477RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000569965RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000567543RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000435786RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000436891RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000564428RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000359928RARAchr17

38487648

+PMLchr15

74317198

+
In-frameENST00000425707ENST00000563500RARAchr17

38487648

+PMLchr15

74317198

+
5CDS-3UTRENST00000425707ENST00000569161RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000395135RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000395132RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000268059RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000354026RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000268058RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000565898RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000569477RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000569965RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000567543RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000435786RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000436891RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000564428RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000359928RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394086ENST00000563500RARAchr17

38487648

+PMLchr15

74317198

+
intron-3UTRENST00000394086ENST00000569161RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000395135RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000395132RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000268059RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000354026RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000268058RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000565898RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000569477RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000569965RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000567543RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000435786RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000436891RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000564428RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000359928RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000394081ENST00000563500RARAchr17

38487648

+PMLchr15

74317198

+
intron-3UTRENST00000394081ENST00000569161RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000395135RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000395132RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000268059RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000354026RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000268058RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000565898RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000569477RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000569965RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000567543RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000435786RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000436891RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000564428RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000359928RARAchr17

38487648

+PMLchr15

74317198

+
intron-3CDSENST00000420042ENST00000563500RARAchr17

38487648

+PMLchr15

74317198

+
intron-3UTRENST00000420042ENST00000569161RARAchr17

38487648

+PMLchr15

74317198

+

Top

FusionProtFeatures for RARA_PML


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RARA

P10276

PML

P29590

Receptor for retinoic acid. Retinoic acid receptors bindas heterodimers to their target response elements in response totheir ligands, all-trans or 9-cis retinoic acid, and regulate geneexpression in various biological processes. The RXR/RARheterodimers bind to the retinoic acid response elements (RARE)composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In theabsence of ligand, the RXR-RAR heterodimers associate with amultiprotein complex containing transcription corepressors thatinduce histone acetylation, chromatin condensation andtranscriptional suppression. On ligand binding, the corepressorsdissociate from the receptors and associate with the coactivatorsleading to transcriptional activation. RARA plays an essentialrole in the regulation of retinoic acid-induced germ celldevelopment during spermatogenesis. Has a role in the survival ofearly spermatocytes at the beginning prophase of meiosis. InSertoli cells, may promote the survival and development of earlymeiotic prophase spermatocytes. In concert with RARG, required forskeletal growth, matrix homeostasis and growth plate function (Bysimilarity). {ECO:0000250|UniProtKB:P11416,ECO:0000269|PubMed:16417524, ECO:0000269|PubMed:19850744,ECO:0000269|PubMed:20215566}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePMLchr17:38487648chr15:74326819ENST00000395132+05228_253-32436Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74326819ENST00000395132+053_46-32436Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74317198ENST00000268058+29476_490394883MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74317198ENST00000268059+28476_490394830MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74317198ENST00000354026+27476_490394782MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74317198ENST00000359928+26476_490394474MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74317198ENST00000395132+25476_490394436MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74317198ENST00000395135+28476_490394634MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74317198ENST00000435786+27476_490394612MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74317198ENST00000436891+28476_490394902MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74317198ENST00000564428+27476_490394586MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74317198ENST00000565898+28476_490394835MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74317198ENST00000567543+25476_490394424MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74317198ENST00000569477+28476_490394642MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74317198ENST00000569965+28476_490394608MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74326819ENST00000359928+36476_490418474MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74326819ENST00000395132+05476_490-32436MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74326819ENST00000567543+35476_490418424MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74326819ENST00000395132+05124_166-32436Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74326819ENST00000395132+05183_236-32436Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74326819ENST00000395132+0557_92-32436Zinc fingerRING-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRARAchr17:38487648chr15:74317198ENST00000254066+2988_15359463DNA bindingNuclear receptor
HgeneRARAchr17:38487648chr15:74317198ENST00000394081+1888_153-114458DNA bindingNuclear receptor
HgeneRARAchr17:38487648chr15:74317198ENST00000394089+2988_15359463DNA bindingNuclear receptor
HgeneRARAchr17:38487648chr15:74317198ENST00000425707+2788_15359366DNA bindingNuclear receptor
HgeneRARAchr17:38487648chr15:74326819ENST00000254066+2988_15359463DNA bindingNuclear receptor
HgeneRARAchr17:38487648chr15:74326819ENST00000394081+1888_153-114458DNA bindingNuclear receptor
HgeneRARAchr17:38487648chr15:74326819ENST00000394089+2988_15359463DNA bindingNuclear receptor
HgeneRARAchr17:38487648chr15:74326819ENST00000425707+2788_15359366DNA bindingNuclear receptor
HgeneRARAchr17:38487648chr15:74317198ENST00000254066+29183_41759463DomainNR LBD
HgeneRARAchr17:38487648chr15:74317198ENST00000394081+18183_417-114458DomainNR LBD
HgeneRARAchr17:38487648chr15:74317198ENST00000394089+29183_41759463DomainNR LBD
HgeneRARAchr17:38487648chr15:74317198ENST00000425707+27183_41759366DomainNR LBD
HgeneRARAchr17:38487648chr15:74326819ENST00000254066+29183_41759463DomainNR LBD
HgeneRARAchr17:38487648chr15:74326819ENST00000394081+18183_417-114458DomainNR LBD
HgeneRARAchr17:38487648chr15:74326819ENST00000394089+29183_41759463DomainNR LBD
HgeneRARAchr17:38487648chr15:74326819ENST00000425707+27183_41759366DomainNR LBD
HgeneRARAchr17:38487648chr15:74317198ENST00000254066+29154_18259463RegionNote=Hinge
HgeneRARAchr17:38487648chr15:74317198ENST00000254066+291_8759463RegionNote=Modulating
HgeneRARAchr17:38487648chr15:74317198ENST00000254066+29404_41959463RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38487648chr15:74317198ENST00000394081+18154_182-114458RegionNote=Hinge
HgeneRARAchr17:38487648chr15:74317198ENST00000394081+181_87-114458RegionNote=Modulating
HgeneRARAchr17:38487648chr15:74317198ENST00000394081+18404_419-114458RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38487648chr15:74317198ENST00000394089+29154_18259463RegionNote=Hinge
HgeneRARAchr17:38487648chr15:74317198ENST00000394089+291_8759463RegionNote=Modulating
HgeneRARAchr17:38487648chr15:74317198ENST00000394089+29404_41959463RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38487648chr15:74317198ENST00000425707+27154_18259366RegionNote=Hinge
HgeneRARAchr17:38487648chr15:74317198ENST00000425707+271_8759366RegionNote=Modulating
HgeneRARAchr17:38487648chr15:74317198ENST00000425707+27404_41959366RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38487648chr15:74326819ENST00000254066+29154_18259463RegionNote=Hinge
HgeneRARAchr17:38487648chr15:74326819ENST00000254066+291_8759463RegionNote=Modulating
HgeneRARAchr17:38487648chr15:74326819ENST00000254066+29404_41959463RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38487648chr15:74326819ENST00000394081+18154_182-114458RegionNote=Hinge
HgeneRARAchr17:38487648chr15:74326819ENST00000394081+181_87-114458RegionNote=Modulating
HgeneRARAchr17:38487648chr15:74326819ENST00000394081+18404_419-114458RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38487648chr15:74326819ENST00000394089+29154_18259463RegionNote=Hinge
HgeneRARAchr17:38487648chr15:74326819ENST00000394089+291_8759463RegionNote=Modulating
HgeneRARAchr17:38487648chr15:74326819ENST00000394089+29404_41959463RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38487648chr15:74326819ENST00000425707+27154_18259366RegionNote=Hinge
HgeneRARAchr17:38487648chr15:74326819ENST00000425707+271_8759366RegionNote=Modulating
HgeneRARAchr17:38487648chr15:74326819ENST00000425707+27404_41959366RegionNote=Required for binding corepressor NCOR1
HgeneRARAchr17:38487648chr15:74317198ENST00000254066+29124_14859463Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74317198ENST00000254066+2988_10859463Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74317198ENST00000394081+18124_148-114458Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74317198ENST00000394081+1888_108-114458Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74317198ENST00000394089+29124_14859463Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74317198ENST00000394089+2988_10859463Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74317198ENST00000425707+27124_14859366Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74317198ENST00000425707+2788_10859366Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74326819ENST00000254066+29124_14859463Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74326819ENST00000254066+2988_10859463Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74326819ENST00000394081+18124_148-114458Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74326819ENST00000394081+1888_108-114458Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74326819ENST00000394089+29124_14859463Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74326819ENST00000394089+2988_10859463Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74326819ENST00000425707+27124_14859366Zinc fingerNR C4-type
HgeneRARAchr17:38487648chr15:74326819ENST00000425707+2788_10859366Zinc fingerNR C4-type
TgenePMLchr17:38487648chr15:74317198ENST00000268058+29228_253394883Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74317198ENST00000268059+28228_253394830Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74317198ENST00000354026+27228_253394782Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74317198ENST00000359928+26228_253394474Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74317198ENST00000395132+25228_253394436Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74317198ENST00000395135+28228_253394634Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74317198ENST00000435786+27228_253394612Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74317198ENST00000436891+28228_253394902Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74317198ENST00000564428+27228_253394586Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74317198ENST00000565898+28228_253394835Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74317198ENST00000567543+25228_253394424Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74317198ENST00000569477+28228_253394642Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74317198ENST00000569965+28228_253394608Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74326819ENST00000268058+59228_253552883Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74326819ENST00000268059+58228_253552830Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74326819ENST00000354026+47228_253504782Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74326819ENST00000359928+36228_253418474Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74326819ENST00000395135+58228_253552634Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74326819ENST00000435786+57228_253552612Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74326819ENST00000436891+58228_253555902Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74326819ENST00000564428+47228_253504586Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74326819ENST00000565898+48228_253504835Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74326819ENST00000567543+35228_253418424Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74326819ENST00000569477+58228_253552642Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74326819ENST00000569965+58228_253555608Coiled coilOntology_term=ECO:0000255
TgenePMLchr17:38487648chr15:74317198ENST00000268058+293_46394883Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74317198ENST00000268059+283_46394830Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74317198ENST00000354026+273_46394782Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74317198ENST00000359928+263_46394474Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74317198ENST00000395132+253_46394436Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74317198ENST00000395135+283_46394634Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74317198ENST00000435786+273_46394612Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74317198ENST00000436891+283_46394902Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74317198ENST00000564428+273_46394586Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74317198ENST00000565898+283_46394835Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74317198ENST00000567543+253_46394424Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74317198ENST00000569477+283_46394642Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74317198ENST00000569965+283_46394608Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74326819ENST00000268058+593_46552883Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74326819ENST00000268059+583_46552830Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74326819ENST00000354026+473_46504782Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74326819ENST00000359928+363_46418474Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74326819ENST00000395135+583_46552634Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74326819ENST00000435786+573_46552612Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74326819ENST00000436891+583_46555902Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74326819ENST00000564428+473_46504586Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74326819ENST00000565898+483_46504835Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74326819ENST00000567543+353_46418424Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74326819ENST00000569477+583_46552642Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74326819ENST00000569965+583_46555608Compositional biasNote=Pro-rich
TgenePMLchr17:38487648chr15:74326819ENST00000268058+59476_490552883MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74326819ENST00000268059+58476_490552830MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74326819ENST00000354026+47476_490504782MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74326819ENST00000395135+58476_490552634MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74326819ENST00000435786+57476_490552612MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74326819ENST00000436891+58476_490555902MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74326819ENST00000564428+47476_490504586MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74326819ENST00000565898+48476_490504835MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74326819ENST00000569477+58476_490552642MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74326819ENST00000569965+58476_490555608MotifNote=Nuclear localization signal
TgenePMLchr17:38487648chr15:74317198ENST00000268058+29124_166394883Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74317198ENST00000268058+29183_236394883Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74317198ENST00000268058+2957_92394883Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74317198ENST00000268059+28124_166394830Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74317198ENST00000268059+28183_236394830Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74317198ENST00000268059+2857_92394830Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74317198ENST00000354026+27124_166394782Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74317198ENST00000354026+27183_236394782Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74317198ENST00000354026+2757_92394782Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74317198ENST00000359928+26124_166394474Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74317198ENST00000359928+26183_236394474Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74317198ENST00000359928+2657_92394474Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74317198ENST00000395132+25124_166394436Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74317198ENST00000395132+25183_236394436Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74317198ENST00000395132+2557_92394436Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74317198ENST00000395135+28124_166394634Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74317198ENST00000395135+28183_236394634Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74317198ENST00000395135+2857_92394634Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74317198ENST00000435786+27124_166394612Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74317198ENST00000435786+27183_236394612Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74317198ENST00000435786+2757_92394612Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74317198ENST00000436891+28124_166394902Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74317198ENST00000436891+28183_236394902Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74317198ENST00000436891+2857_92394902Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74317198ENST00000564428+27124_166394586Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74317198ENST00000564428+27183_236394586Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74317198ENST00000564428+2757_92394586Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74317198ENST00000565898+28124_166394835Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74317198ENST00000565898+28183_236394835Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74317198ENST00000565898+2857_92394835Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74317198ENST00000567543+25124_166394424Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74317198ENST00000567543+25183_236394424Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74317198ENST00000567543+2557_92394424Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74317198ENST00000569477+28124_166394642Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74317198ENST00000569477+28183_236394642Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74317198ENST00000569477+2857_92394642Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74317198ENST00000569965+28124_166394608Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74317198ENST00000569965+28183_236394608Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74317198ENST00000569965+2857_92394608Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74326819ENST00000268058+59124_166552883Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74326819ENST00000268058+59183_236552883Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74326819ENST00000268058+5957_92552883Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74326819ENST00000268059+58124_166552830Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74326819ENST00000268059+58183_236552830Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74326819ENST00000268059+5857_92552830Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74326819ENST00000354026+47124_166504782Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74326819ENST00000354026+47183_236504782Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74326819ENST00000354026+4757_92504782Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74326819ENST00000359928+36124_166418474Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74326819ENST00000359928+36183_236418474Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74326819ENST00000359928+3657_92418474Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74326819ENST00000395135+58124_166552634Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74326819ENST00000395135+58183_236552634Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74326819ENST00000395135+5857_92552634Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74326819ENST00000435786+57124_166552612Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74326819ENST00000435786+57183_236552612Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74326819ENST00000435786+5757_92552612Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74326819ENST00000436891+58124_166555902Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74326819ENST00000436891+58183_236555902Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74326819ENST00000436891+5857_92555902Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74326819ENST00000564428+47124_166504586Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74326819ENST00000564428+47183_236504586Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74326819ENST00000564428+4757_92504586Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74326819ENST00000565898+48124_166504835Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74326819ENST00000565898+48183_236504835Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74326819ENST00000565898+4857_92504835Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74326819ENST00000567543+35124_166418424Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74326819ENST00000567543+35183_236418424Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74326819ENST00000567543+3557_92418424Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74326819ENST00000569477+58124_166552642Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74326819ENST00000569477+58183_236552642Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74326819ENST00000569477+5857_92552642Zinc fingerRING-type
TgenePMLchr17:38487648chr15:74326819ENST00000569965+58124_166555608Zinc fingerB box-type 1%3B atypical
TgenePMLchr17:38487648chr15:74326819ENST00000569965+58183_236555608Zinc fingerB box-type 2
TgenePMLchr17:38487648chr15:74326819ENST00000569965+5857_92555608Zinc fingerRING-type


Top

FusionGeneSequence for RARA_PML


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_299aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_101aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLLPPPAHA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_495aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSCMEPMETAEPQSSPAHSSPAHSSPAHSSPVQSLLR
AQGASSLPCGTYHPPAWPPHQPAEQAATPDAEPHSEPPDHQERPAVHRGIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQAST
PAITGPLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLSQWLNNFFALPFSSMASQLDMSSVVGAGESRAQTLGAGVPPGD

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_447aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE
DSDAENSCMEPMETAEPQSSPAHSSPAHSSPAHSSPVQSLLRAQGASSLPCGTYHPPAWPPHQPAEQAATPDAEPHSEPPDHQERPAVHR
GIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQASTPAITGPLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLS

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_548aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQA
EDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDIN
RLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLV
QAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRTLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_500aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE
DSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAV
SLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSA
MAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRTLSLQTTT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_307aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSSSPQSEVLTWKVHGAHGDRRATVLASPLLASPL

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_226aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_89aa

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_277aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSGPEVQPRTPASPHFRSQGAQPQQVTLRLALRLG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_226aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_251aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_89aa

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_234aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAGREVGRAVAWV

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_299aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_101aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLLPPPAHA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_495aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSCMEPMETAEPQSSPAHSSPAHSSPAHSSPVQSLLR
AQGASSLPCGTYHPPAWPPHQPAEQAATPDAEPHSEPPDHQERPAVHRGIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQAST
PAITGPLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLSQWLNNFFALPFSSMASQLDMSSVVGAGESRAQTLGAGVPPGD

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_447aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE
DSDAENSCMEPMETAEPQSSPAHSSPAHSSPAHSSPVQSLLRAQGASSLPCGTYHPPAWPPHQPAEQAATPDAEPHSEPPDHQERPAVHR
GIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQASTPAITGPLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLS

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_548aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQA
EDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDIN
RLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLV
QAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRTLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_500aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE
DSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAV
SLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSA
MAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRTLSLQTTT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_307aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSSSPQSEVLTWKVHGAHGDRRATVLASPLLASPL

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_226aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_89aa

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_277aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSGPEVQPRTPASPHFRSQGAQPQQVTLRLALRLG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_226aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_251aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_89aa

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_234aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAGREVGRAVAWV

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_299aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_101aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLLPPPAHA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_495aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSCMEPMETAEPQSSPAHSSPAHSSPAHSSPVQSLLR
AQGASSLPCGTYHPPAWPPHQPAEQAATPDAEPHSEPPDHQERPAVHRGIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQAST
PAITGPLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLSQWLNNFFALPFSSMASQLDMSSVVGAGESRAQTLGAGVPPGD

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_447aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE
DSDAENSCMEPMETAEPQSSPAHSSPAHSSPAHSSPVQSLLRAQGASSLPCGTYHPPAWPPHQPAEQAATPDAEPHSEPPDHQERPAVHR
GIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQASTPAITGPLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLS

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_548aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQA
EDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDIN
RLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLV
QAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRTLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_500aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE
DSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAV
SLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSA
MAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRTLSLQTTT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_307aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSSSPQSEVLTWKVHGAHGDRRATVLASPLLASPL

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_226aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_89aa

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_277aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSGPEVQPRTPASPHFRSQGAQPQQVTLRLALRLG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_226aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_251aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_89aa

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_234aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAGREVGRAVAWV

>In-frame_RARA_ENST00000394081_chr17_38499119_+_PML_ENST00000395135_chr15_74326819_+_136aa
MYESVEVGGPTPNPFLVVDFTNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNH_ERVVVISSSEDSDAENSSSRELDDSSSESSDLQLE

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395135_chr15_74326819_+_141aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPAKERVVVISSSEDSDAENSSSRELDDSSSESS

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395135_chr15_74326819_+_141aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPAKERVVVISSSEDSDAENSSSRELDDSSSESS

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395135_chr15_74326819_+_141aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPAKERVVVISSSEDSDAENSSSRELDDSSSESS

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_299aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_101aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLLPPPAHA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_495aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSCMEPMETAEPQSSPAHSSPAHSSPAHSSPVQSLLR
AQGASSLPCGTYHPPAWPPHQPAEQAATPDAEPHSEPPDHQERPAVHRGIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQAST
PAITGPLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLSQWLNNFFALPFSSMASQLDMSSVVGAGESRAQTLGAGVPPGD

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_447aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE
DSDAENSCMEPMETAEPQSSPAHSSPAHSSPAHSSPVQSLLRAQGASSLPCGTYHPPAWPPHQPAEQAATPDAEPHSEPPDHQERPAVHR
GIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQASTPAITGPLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLS

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_548aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQA
EDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDIN
RLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLV
QAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRTLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_500aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE
DSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAV
SLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSA
MAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRTLSLQTTT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_307aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSSSPQSEVLTWKVHGAHGDRRATVLASPLLASPL

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_226aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_89aa

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_277aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSGPEVQPRTPASPHFRSQGAQPQQVTLRLALRLG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_226aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_251aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_89aa

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_234aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAGREVGRAVAWV

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_299aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_101aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLLPPPAHA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_495aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSCMEPMETAEPQSSPAHSSPAHSSPAHSSPVQSLLR
AQGASSLPCGTYHPPAWPPHQPAEQAATPDAEPHSEPPDHQERPAVHRGIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQAST
PAITGPLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLSQWLNNFFALPFSSMASQLDMSSVVGAGESRAQTLGAGVPPGD

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_447aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE
DSDAENSCMEPMETAEPQSSPAHSSPAHSSPAHSSPVQSLLRAQGASSLPCGTYHPPAWPPHQPAEQAATPDAEPHSEPPDHQERPAVHR
GIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQASTPAITGPLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLS

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_548aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQA
EDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDIN
RLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLV
QAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRTLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_500aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE
DSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAV
SLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSA
MAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRTLSLQTTT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_307aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSSSPQSEVLTWKVHGAHGDRRATVLASPLLASPL

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_226aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_89aa

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_277aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSGPEVQPRTPASPHFRSQGAQPQQVTLRLALRLG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_226aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_251aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_89aa

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_234aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAGREVGRAVAWV

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_299aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_101aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLLPPPAHA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_495aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSCMEPMETAEPQSSPAHSSPAHSSPAHSSPVQSLLR
AQGASSLPCGTYHPPAWPPHQPAEQAATPDAEPHSEPPDHQERPAVHRGIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQAST
PAITGPLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLSQWLNNFFALPFSSMASQLDMSSVVGAGESRAQTLGAGVPPGD

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_447aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE
DSDAENSCMEPMETAEPQSSPAHSSPAHSSPAHSSPVQSLLRAQGASSLPCGTYHPPAWPPHQPAEQAATPDAEPHSEPPDHQERPAVHR
GIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQASTPAITGPLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLS

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_548aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQA
EDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDIN
RLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLV
QAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRTLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_500aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE
DSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAV
SLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSA
MAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRTLSLQTTT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_307aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSSSPQSEVLTWKVHGAHGDRRATVLASPLLASPL

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_226aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_89aa

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_277aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK
AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSGPEVQPRTPASPHFRSQGAQPQQVTLRLALRLG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_226aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLPEEAERV
KAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSTGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSK

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_251aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSE

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_89aa

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_234aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGTSTPSPANAAVSKKASPEAASTPRDPIDVDLDVSNTTT
AQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAGREVGRAVAWV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_897nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTG
GATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_303nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCTGCCTCCTCCAGCCCATGCT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_1485nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATG
GAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGA
GCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGAT
GCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCC
ATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACT
CCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATA
CGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCC
TCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGAC
TCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_1341nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCG
CCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCT
CCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGT
GGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATT
CGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCC
CAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCC
CAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGA
GCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_1644nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTG
GATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCA
GAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAG
TTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTT
CTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAAC
AGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAA
CTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGC
CTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTG
CAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGAC
CGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCT
CTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCTTGGCA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_1500nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTC
AGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAG
ATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTG
TCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGC
CTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTC
ATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCC
ATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGT
AGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTG
AGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACG
TTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_921nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTCTCTTCCAGCCCT
CAGTCTGAGGTTCTGTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTC
CTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_678nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_267nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_831nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCCCAGAA
GTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCCTGGGG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_678nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_753nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTC
AGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTC

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_267nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_702nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGGTGGGTAGGGCAGTGGCCTGGGTG
CTGCCCGCCAGGGTCTGGGCGGTGCCCCTCTTCTGTATTTTGGCCCCATCCAGAAAGCCCAAAGCCAACAGGAGTCCCTTATTCCCACTG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_897nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTG
GATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_303nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCTGCCTCCTCCAGCCCATGCT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_1485nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATG
GAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGA
GCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGAT
GCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCC
ATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACT
CCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATA
CGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCC
TCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGAC
TCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_1341nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCG
CCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCT
CCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGT
GGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATT
CGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCC
CAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCC
CAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGA
GCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_1644nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTG
GATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCA
GAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAG
TTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTT
CTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAAC
AGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAA
CTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGC
CTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTG
CAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGAC
CGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCT
CTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCTTGGCA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_1500nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTC
AGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAG
ATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTG
TCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGC
CTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTC
ATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCC
ATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGT
AGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTG
AGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACG
TTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_921nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTCTCTTCCAGCCCT
CAGTCTGAGGTTCTGTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTC
CTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_678nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_267nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_831nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCCCAGAA
GTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCCTGGGG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_678nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_753nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTC
AGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTC

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_267nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_702nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGGTGGGTAGGGCAGTGGCCTGGGTG
CTGCCCGCCAGGGTCTGGGCGGTGCCCCTCTTCTGTATTTTGGCCCCATCCAGAAAGCCCAAAGCCAACAGGAGTCCCTTATTCCCACTG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_897nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTG
GATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_303nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCTGCCTCCTCCAGCCCATGCT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_1485nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATG
GAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGA
GCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGAT
GCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCC
ATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACT
CCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATA
CGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCC
TCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGAC
TCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_1341nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCG
CCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCT
CCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGT
GGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATT
CGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCC
CAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCC
CAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGA
GCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_1644nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTG
GATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCA
GAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAG
TTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTT
CTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAAC
AGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAA
CTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGC
CTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTG
CAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGAC
CGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCT
CTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCTTGGCA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_1500nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTC
AGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAG
ATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTG
TCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGC
CTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTC
ATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCC
ATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGT
AGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTG
AGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACG
TTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_921nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTCTCTTCCAGCCCT
CAGTCTGAGGTTCTGTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTC
CTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_678nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_267nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_831nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCCCAGAA
GTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCCTGGGG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_678nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_753nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTC
AGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTC

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_267nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_702nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGGTGGGTAGGGCAGTGGCCTGGGTG
CTGCCCGCCAGGGTCTGGGCGGTGCCCCTCTTCTGTATTTTGGCCCCATCCAGAAAGCCCAAAGCCAACAGGAGTCCCTTATTCCCACTG

>In-frame_RARA_ENST00000394081_chr17_38499119_+_PML_ENST00000395135_chr15_74326819_+_408nt
ATGTACGAGAGTGTAGAAGTGGGGGGTCCCACCCCTAATCCCTTCCTAGTGGTGGATTTTTATAACCAGAACCGGGCCTGTTTGCTCCCA
GAGAAGGGGCTCCCCGCCCCGGGTCCGTACTCCACCCCGCTCCGGACTCCGCTTTGGAATGGCTCAAACCACTAGGAACGCGTTGTGGTG
ATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAA
GGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGAC

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395135_chr15_74326819_+_423nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAG
GAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGT
GACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395135_chr15_74326819_+_423nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAG
GAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGT
GACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395135_chr15_74326819_+_423nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAG
GAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGT
GACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_897nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTG
GATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_303nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCTGCCTCCTCCAGCCCATGCT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_1485nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATG
GAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGA
GCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGAT
GCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCC
ATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACT
CCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATA
CGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCC
TCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGAC
TCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_1341nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCG
CCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCT
CCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGT
GGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATT
CGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCC
CAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCC
CAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGA
GCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_1644nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTG
GATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCA
GAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAG
TTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTT
CTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAAC
AGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAA
CTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGC
CTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTG
CAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGAC
CGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCT
CTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCTTGGCA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_1500nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTC
AGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAG
ATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTG
TCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGC
CTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTC
ATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCC
ATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGT
AGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTG
AGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACG
TTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_921nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTCTCTTCCAGCCCT
CAGTCTGAGGTTCTGTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTC
CTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_678nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_267nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_831nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCCCAGAA
GTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCCTGGGG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_678nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_753nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTC
AGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTC

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_267nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_702nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGGTGGGTAGGGCAGTGGCCTGGGTG
CTGCCCGCCAGGGTCTGGGCGGTGCCCCTCTTCTGTATTTTGGCCCCATCCAGAAAGCCCAAAGCCAACAGGAGTCCCTTATTCCCACTG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_897nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTG
GATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_303nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCTGCCTCCTCCAGCCCATGCT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_1485nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATG
GAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGA
GCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGAT
GCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCC
ATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACT
CCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATA
CGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCC
TCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGAC
TCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_1341nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCG
CCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCT
CCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGT
GGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATT
CGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCC
CAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCC
CAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGA
GCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_1644nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTG
GATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCA
GAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAG
TTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTT
CTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAAC
AGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAA
CTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGC
CTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTG
CAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGAC
CGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCT
CTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCTTGGCA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_1500nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTC
AGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAG
ATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTG
TCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGC
CTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTC
ATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCC
ATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGT
AGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTG
AGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACG
TTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_921nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTCTCTTCCAGCCCT
CAGTCTGAGGTTCTGTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTC
CTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_678nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_267nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_831nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCCCAGAA
GTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCCTGGGG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_678nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_753nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTC
AGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTC

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_267nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_702nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGGTGGGTAGGGCAGTGGCCTGGGTG
CTGCCCGCCAGGGTCTGGGCGGTGCCCCTCTTCTGTATTTTGGCCCCATCCAGAAAGCCCAAAGCCAACAGGAGTCCCTTATTCCCACTG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_897nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTG
GATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_303nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCTGCCTCCTCCAGCCCATGCT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_1485nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATG
GAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGA
GCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGAT
GCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCC
ATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACT
CCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATA
CGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCC
TCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGAC
TCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_1341nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCG
CCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCT
CCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGT
GGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATT
CGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCC
CAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCC
CAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGA
GCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_1644nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTG
GATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCA
GAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAG
TTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTT
CTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAAC
AGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAA
CTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGC
CTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTG
CAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGAC
CGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCT
CTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCTTGGCA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_1500nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTC
AGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAG
ATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTG
TCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGC
CTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTC
ATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCC
ATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGT
AGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTG
AGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACG
TTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_921nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTCTCTTCCAGCCCT
CAGTCTGAGGTTCTGTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTC
CTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_678nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_267nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_831nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG
GCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCCCAGAA
GTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCCTGGGG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_678nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTG
AAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTAC
GCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCC
AGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAG
GCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_753nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAA
GACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTC
AGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTC

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_267nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_702nt
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCT
ATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAT
GCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACA
GCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGG
AGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATA
GGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGGTGGGTAGGGCAGTGGCCTGGGTG
CTGCCCGCCAGGGTCTGGGCGGTGCCCCTCTTCTGTATTTTGGCCCCATCCAGAAAGCCCAAAGCCAACAGGAGTCCCTTATTCCCACTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_1509nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAG
AGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCC
AAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTT
AGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_1092nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCTGCCTCCTCCAGCCC
ATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGG
GCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGA
AAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCT
CTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTGGCAGATGTGGCTGCTCAATAAACACTT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_2383nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGC
CCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGC
TGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCC
CCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGA
GAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCA
GCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACC
GGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCT
TCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTG
GGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAG
AAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCC
TGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATC
AACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTC
AAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAG
CCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_2239nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAA
CGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGG
CTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCG
TCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCT
CGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACT
CCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTT
GGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCC
ACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCC
CTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATC
CTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATT
TATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAA
GCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAG
CCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGT
GCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAG
AGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCT
GGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCA
CTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGAT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_3862nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAG
AGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCC
AAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAA
GCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCA
GCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACA
TTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCT
TCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGT
GCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCC
TGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCC
GTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGC
AGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCT
TGGCAGAGAGGGCCTCCCAGCAGAGCTGAGAGGAGGGGGTGACCAGCTTGGAGTCTCTGGTGGGCAGAGAGGGATGGGGTCCCTGAGCCA
GGCCCCACCCATCACAGCATTCCCAGGTCCTGGTACCCAGCCCTCAGTTGTCATTTGGTTCAGAATCAGTTCCCTTTCTCTGGGACCAAA
TTTCCCTTCTCTAAACATCCTACAGAGAAGGTTCCAAAGCTGAGCACCCATCACCCTAGGTGTGCACCAGACTCCTATTAGCCCCTCCTT
CCAGGAGCTAGAACCAGGGAGGTCCTGAGTGAGGAAGGCATGACCTCTGGGCTCTCTAGGTGGCCCTGGTCTTGCCCCATCCATCCCACC
TGCCACTACCTTGGGTGTCCTTACAGCTCTGCCCTGACCCCAGCCCCTGCCCCTGGACACCTGCTGACAGCTCCCACACAGAACAGTCTG
AGGTGATGCTGGCTACAGCCCTGGCAGCCCATGGCAACTCAAAGTGCCTTCCAAACCAAACTGCCCCTCATGAGGTTAGGGTCCCCCACC
CTCCACCTGCCCAGAGGCCAACTCTGTTCCCTTCTCCTTTCATCCCAGAGGGGCCTCATCAGCAAAGACAGAAACTGATGTTCCATGCAT
GTCCCTGCTTCCAAAGCCTGACCTTCCAAAGCTTGCTTCCTTCCTCCTGGCTGCACAGACACCTCTGCTTGGCCACAGCTTTGCTCTTTG
GTCCTCAGGCCACCAGACCCCTCACAGCATGGCCCTTGGCTCTTCCTGCACTGCCCTCACCCTCAGCCGTCCCAAGGAGTGCCCAGCACT
ACTCAGCATGTAGTCCAGGACCTGCGGCATCAGCATCCCCTGGGAGCTTCTTAGAAATGCAGACCTGTGGGCTCTACCACAGGCCTCTGG
AATCAGAATCTTCAGGGTGGGGCCCAGCAGTCTGTGTTTTAACAGGTTCTCCCGGTGATGCTGGTGCATGCTCAAGTTTGAGAACCGCTG
CTCTCATAGACTGCTCCTCCAAGGGGAAGCAGTGTGGAACAGCAGAGAAAGTCCCGTCCCTATCTCTGACTGTGCAGTGAGTGTGGCCTA
GGAACAGGTCCCTTCCTAAGCTCTAGTGTCCCCATCTGTAAAATGGGCTGATTGGCCTCCACGGTCAGAGCGGCCATCTGGCTGTGCCAT
CCTGCATTTTTAGGAATGGAAAGCAGGCCTCTGAGGCAGTGGACAGGAAGACTTCTCATCCTTGAATTCTAGCTCCCATTCCAAACTGTT
AGTCCCCAACCTTGTGGTCACATCAGAGGTCAACAGCAGAACAGAGGCAGGTCAGGGTTGTCCGCTCTGATTAGCAGAACGACAGCCCCT
TCCTCCTCCTCCCTCCTTCCCATCCCTACTCATTAGCTCCCTGCTCCTGGGATGCTTCCCAAGCAGCCCAGGCCTCTAGCCTCCATGGCT
GATGACCTCAGCTTTCACACTGGTGAAGTCTGTGTACCCATACTGCAGCCCCATCCCATGGGGCCCCTGAAGACCCACTGAGGAATTCCG
TAGGGTCTTGTTCCCACGACCGGAGTGCTGGCTCTCACAGTGAATTTTGATGCATTTAAAATAAGATTCTGATGCCAGACTGTTAAAACA
GGCGCTGGTTCTGAAGCACCGATGGAAACAGATTGATGCAGATGGAAGGAGGAAGGGAGACTGGGCCCACTGATTTCCAGCCCCACCATG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_4759nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAA
CGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGG
CTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCG
TCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCT
CGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCA
CCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCC
AGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGG
CCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGC
CTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGC
CTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCA
GCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCT
TCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACA
ACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCA
CCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGG
CAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCTTGGCAGAGAGGGCCTCCCAGCAGAGCTGAGAGGAGGGGGTGACCAGCTTGGAGT
CTCTGGTGGGCAGAGAGGGATGGGGTCCCTGAGCCAGGCCCCACCCATCACAGCATTCCCAGGTCCTGGTACCCAGCCCTCAGTTGTCAT
TTGGTTCAGAATCAGTTCCCTTTCTCTGGGACCAAATTTCCCTTCTCTAAACATCCTACAGAGAAGGTTCCAAAGCTGAGCACCCATCAC
CCTAGGTGTGCACCAGACTCCTATTAGCCCCTCCTTCCAGGAGCTAGAACCAGGGAGGTCCTGAGTGAGGAAGGCATGACCTCTGGGCTC
TCTAGGTGGCCCTGGTCTTGCCCCATCCATCCCACCTGCCACTACCTTGGGTGTCCTTACAGCTCTGCCCTGACCCCAGCCCCTGCCCCT
GGACACCTGCTGACAGCTCCCACACAGAACAGTCTGAGGTGATGCTGGCTACAGCCCTGGCAGCCCATGGCAACTCAAAGTGCCTTCCAA
ACCAAACTGCCCCTCATGAGGTTAGGGTCCCCCACCCTCCACCTGCCCAGAGGCCAACTCTGTTCCCTTCTCCTTTCATCCCAGAGGGGC
CTCATCAGCAAAGACAGAAACTGATGTTCCATGCATGTCCCTGCTTCCAAAGCCTGACCTTCCAAAGCTTGCTTCCTTCCTCCTGGCTGC
ACAGACACCTCTGCTTGGCCACAGCTTTGCTCTTTGGTCCTCAGGCCACCAGACCCCTCACAGCATGGCCCTTGGCTCTTCCTGCACTGC
CCTCACCCTCAGCCGTCCCAAGGAGTGCCCAGCACTACTCAGCATGTAGTCCAGGACCTGCGGCATCAGCATCCCCTGGGAGCTTCTTAG
AAATGCAGACCTGTGGGCTCTACCACAGGCCTCTGGAATCAGAATCTTCAGGGTGGGGCCCAGCAGTCTGTGTTTTAACAGGTTCTCCCG
GTGATGCTGGTGCATGCTCAAGTTTGAGAACCGCTGCTCTCATAGACTGCTCCTCCAAGGGGAAGCAGTGTGGAACAGCAGAGAAAGTCC
CGTCCCTATCTCTGACTGTGCAGTGAGTGTGGCCTAGGAACAGGTCCCTTCCTAAGCTCTAGTGTCCCCATCTGTAAAATGGGCTGATTG
GCCTCCACGGTCAGAGCGGCCATCTGGCTGTGCCATCCTGCATTTTTAGGAATGGAAAGCAGGCCTCTGAGGCAGTGGACAGGAAGACTT
CTCATCCTTGAATTCTAGCTCCCATTCCAAACTGTTAGTCCCCAACCTTGTGGTCACATCAGAGGTCAACAGCAGAACAGAGGCAGGTCA
GGGTTGTCCGCTCTGATTAGCAGAACGACAGCCCCTTCCTCCTCCTCCCTCCTTCCCATCCCTACTCATTAGCTCCCTGCTCCTGGGATG
CTTCCCAAGCAGCCCAGGCCTCTAGCCTCCATGGCTGATGACCTCAGCTTTCACACTGGTGAAGTCTGTGTACCCATACTGCAGCCCCAT
CCCATGGGGCCCCTGAAGACCCACTGAGGAATTCCGTAGGGTCTTGTTCCCACGACCGGAGTGCTGGCTCTCACAGTGAATTTTGATGCA
TTTAAAATAAGATTCTGATGCCAGACTGTTAAAACAGGCGCTGGTTCTGAAGCACCGATGGAAACAGATTGATGCAGATGGAAGGAGGAA
GGGAGACTGGGCCCACTGATTTCCAGCCCCACCATGTGTGCTGTTTTCAGATGTGATTGAGGGGTGTTCTGCCCTGCCTCCACTGTCACA
GCCTTTAATAAAGATGTGAATCTTGAAAGCCTGATGCTCCAATCACAGACTCTGCTCAGCATCCCCAGAGGAACCACTGAGAAGCCTTTT
GCCTGGATAGGAGGGGGCTCTCCCAGGCATAGGCTTGTGGCCACTTGCCCAGCACAACTGTGTTTTGTGGGGCGTCTTTTAGGACTTAGC
AGAGCTGAGAGCCCTTTGTTGCTCAATGCTGTGAGCCTTAAGCATGTGAATCCCCCCACATGACAAGTGGGGAGACCCAGGGTAGGCTTT
CCTTTGGATCATCTCCAAATGGGAGTGCCATGTGGCAGGAAAGAAGCACCGATTTCAAGAATTACTTCCTAGAGAAAGTCAGGAACTAGA
GACCAGAGTCTGCAGGAACTTTGCCACTGCCCTTCACTGGCTAATCCTGTACTTCTCTCTGTGTTCCTTGAGTGACAGGTGGTAAAACCC
TTAAAAAGGGAGGTGTGGGAGGCCCAGGACTTTGGTAACAGGTGATGAATGTGTTGTCTTGGCCATCACAGGTGGAGCTTCAGTTAGTAC
CCGAGGGATTCCCCTGGCACAAGCATTATAGGAATTAGTCCACCACTGGCGTGGGTGAGCAGCCAGGTAATGGGAATTGATCAGTGCCAC
CACCCTTGACCCCAACTACCATCCCAGATGCCCAGATTCCAGTCCTGGAGTTTTATTCTCTCAGCTTGATCCTTTGACCAAGAAGATCCA
GTCCCAATATGTCACCTGTGCTTCATCTTTGGACTATATCTCAGGTGTTTACGTGTCAACTAATGGGAGCTTACTGGGTTAGAAGTCAGG
ACACTGAGTTTCAATCCTCACTTAGTAGTCTGTGGCCCTCTTTGGCACATTAACCTCCCTCCTTGATCCTCAGGCTGCACCTCTGGCAAA
TGGGAGAATGCGGCTCCTTTTGACTTCAAGGGATCTTTGTGGGAACCAATGAGAAAATGTGTGTGAAGATAGCTTTTTGGTATATTTTAA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_1619nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTCTCTTCCA
GCCCTCAGTCTGAGGTTCTGTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCC
CACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCA
GCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCC
GTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_1518nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTC
CTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGC
TGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTT
TCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_785nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGAGGAACGCGTTGTGGT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_3024nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCC
CAGAAGTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCC
TGGGGAATTTTCCAGTGAGGCATTGAGTCCCAAGCTGTGCTGAGGACAGTCTCCAAATGACAGCTGCATGCCTGGACCACCCCAGCCCTC
CCACTACACCAGGGCCAGGAGCTCTTCTGAAATGCTGATAGCATGTGTCCAGAGCCCTGTCTCTTTTCTGGAATGTCCAAGACCTTTGTC
TGGAGCTTCCTTATGCATTTTCTGTCCTCTAAGTCCTCAGTGAGGAGGGCTGGACAAGAATCCATTCCTTGGTTTATTACAGCCAGTGGG
GGCCAGTGAAGGGGTGTCAGGCCACAGGGCAGCTATATAGGGGCCAAACAAGTGAGGTTTGACTCCATCCATGTAGAAAGATATATAAAT
CCATTCCACAGTGAAACAGGTGGCCTCGTGGGTAGTGACCCTTCTGTCCCTAGAGGTTTATTACTAGAGGCTGGACTATCACCTGTCCAG
GGGAAAAGGGGATCTGAATAGAGTGAAAGGTTGGACTGGGTGGCCCCTGAGGTCTCTTCCAGCCCTCAGTCTGAGGTTCTGTATTGGAAA
GTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGT
CCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCA
GGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTA
CAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGT
GGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAG
CCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTT
TGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGG
TGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACC
CTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCA
GCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTA
AGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCAT
GGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGC
CAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_2391nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTG
CATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCA
GTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGC
TGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAG
AGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGT
CCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCC
ACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGC
CCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGT
TCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTG
TGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCC
AACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGG
AATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGC
TGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAA
TAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_1366nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAA
CGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGG
CTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCG
TCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCT
CGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCA
CCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTG
GGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAG
AGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGGGCTCCTGGCGTGTCATTTGCTGGCTTGAAT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_1107nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGAGGAACGCGTTGTGGT
GATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGA
AGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGA
CAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCC
AGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGGGCTCCTGGCGTGTCATTTG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_3942nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAA
CGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGG
CTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCG
TCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGGTGGGTAGGGCAGTGGCCT
GGGTGCTGCCCGCCAGGGTCTGGGCGGTGCCCCTCTTCTGTATTTTGGCCCCATCCAGAAAGCCCAAAGCCAACAGGAGTCCCTTATTCC
CACTGAATAAGATAGGGAAAGTTCACAGTGTGCGTGGGGGTGAGAGTGGACACAGTTTACCATGTGTTTTGCCATGATTGAGGTGTGGGG
AGCCTGACAGGCTAAAATGCACAGTTCTATGAGTCCTTTCTCCCAAACACTACTGTGCCTTTGCACAGGGCAGGTCTCCACAAGAAGTTT
GTTGGCTGATGCCTAGCATACTCCCAGAGAGGGCTTGGGCATACCATAACAGGAAACTGGACTCCCCATGACCTTAACTCTGCTCTCTCA
GTCTACACCCATCATTTCCCCAAGTGTTTCTGCAAAGGCCACCTACCTAAGTATCTCATTTGTCAGAGTTATCTTCTATGAACACTGCCA
GGCAGGTAGTCAGTTGGGCAGGAGTTGAGGTCAACCCAGAGGAATCTGGAACAAGAGAGTTCTAAGGATCTGCTTCACCCAGAGTACAGC
TTTGTTCCTCATTCTGACTGAGCCCTAGCCTTGGTCACACACTGAGCACTGACTGATATTCCTTACCCACAAATGCTATTGGTAATCGAT
GGGTTTTGATTAACTAAATGAAGCGTCTTTTAACTCTAGACATCCCAGCTCATGGAGCTGAGAATGGGGACAGTGTGCTTCTTTAGGATT
GCAGAAGGTTCCAGACCAGGTAGCAGTTGTCAGGCCTCCTGTACAGGGGGCAAATTCTGAATTCTGGGCAGATAACTTAATTGAATATTC
ATAGATAAGGCACAGCAAGAAATTATGGAAACCCATTTGTGAATTACTCAAATCCAAATGCAAAGCAGAGTCACATTGGCACACACAGTG
GCTGTTCCCGTCCCCCTGCAGGGCATCCGTTTCCCCCAGCCGACTGGCCTGCAAGGATTCCCATAGGTGCACACCCACACCCCTCCCAGC
ATGCATCCTAGGCAGTTCATAATGCATCTCCCCTTCCCCGTTTCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCC
GAAAACTCGGTGAGTGGCCCAGAAGTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACT
CTCAGACTTGCCTTGCGCCTGGGGAATTTTCCAGTGAGGCATTGAGTCCCAAGCTGTGCTGAGGACAGTCTCCAAATGACAGCTGCATGC
CTGGACCACCCCAGCCCTCCCACTACACCAGGGCCAGGAGCTCTTCTGAAATGCTGATAGCATGTGTCCAGAGCCCTGTCTCTTTTCTGG
AATGTCCAAGACCTTTGTCTGGAGCTTCCTTATGCATTTTCTGTCCTCTAAGTCCTCAGTGAGGAGGGCTGGACAAGAATCCATTCCTTG
GTTTATTACAGCCAGTGGGGGCCAGTGAAGGGGTGTCAGGCCACAGGGCAGCTATATAGGGGCCAAACAAGTGAGGTTTGACTCCATCCA
TGTAGAAAGATATATAAATCCATTCCACAGTGAAACAGGTGGCCTCGTGGGTAGTGACCCTTCTGTCCCTAGAGGTTTATTACTAGAGGC
TGGACTATCACCTGTCCAGGGGAAAAGGGGATCTGAATAGAGTGAAAGGTTGGACTGGGTGGCCCCTGAGGTCTCTTCCAGCCCTCAGTC
TGAGGTTCTGTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGC
CAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTC
CCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTG
GGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTC
GGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCC
AGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCC
AGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAG
CCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTC
CAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACC
CTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGC
ACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGA
GAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCC
TGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGC

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_1584nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCA
GCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGAC
CTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCA
AAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_1167nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCTGCCTCCTCCAGCCCATGCTCTTACAGGCC
CTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGG
TCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCA
CCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_2458nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCG
AGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAG
CCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTC
ACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTC
GCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCA
CAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTG
TGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTT
CCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAG
GCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCCCCCCATCA
GCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGGCCCCTGAG
CTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCT
ATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAG
GCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGA
CCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTGGCAGATGTGGC

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_2314nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGA
GGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGG
AGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGG
TCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATG
CCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACT
CCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGC
CCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCT
ACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGT
CTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAA
GGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCA
ACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTC
TTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACAT
TCCCACCACCCTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTG
TAACCTTGCAGCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAA
TTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAG
GCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTG
AGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_3937nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCA
GCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGAC
CTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGG
TCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCA
TGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGG
AATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACC
TGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGG
TCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTG
TGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGG
GCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCT
ACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCTTGGCAGAGAGGGCCT
CCCAGCAGAGCTGAGAGGAGGGGGTGACCAGCTTGGAGTCTCTGGTGGGCAGAGAGGGATGGGGTCCCTGAGCCAGGCCCCACCCATCAC
AGCATTCCCAGGTCCTGGTACCCAGCCCTCAGTTGTCATTTGGTTCAGAATCAGTTCCCTTTCTCTGGGACCAAATTTCCCTTCTCTAAA
CATCCTACAGAGAAGGTTCCAAAGCTGAGCACCCATCACCCTAGGTGTGCACCAGACTCCTATTAGCCCCTCCTTCCAGGAGCTAGAACC
AGGGAGGTCCTGAGTGAGGAAGGCATGACCTCTGGGCTCTCTAGGTGGCCCTGGTCTTGCCCCATCCATCCCACCTGCCACTACCTTGGG
TGTCCTTACAGCTCTGCCCTGACCCCAGCCCCTGCCCCTGGACACCTGCTGACAGCTCCCACACAGAACAGTCTGAGGTGATGCTGGCTA
CAGCCCTGGCAGCCCATGGCAACTCAAAGTGCCTTCCAAACCAAACTGCCCCTCATGAGGTTAGGGTCCCCCACCCTCCACCTGCCCAGA
GGCCAACTCTGTTCCCTTCTCCTTTCATCCCAGAGGGGCCTCATCAGCAAAGACAGAAACTGATGTTCCATGCATGTCCCTGCTTCCAAA
GCCTGACCTTCCAAAGCTTGCTTCCTTCCTCCTGGCTGCACAGACACCTCTGCTTGGCCACAGCTTTGCTCTTTGGTCCTCAGGCCACCA
GACCCCTCACAGCATGGCCCTTGGCTCTTCCTGCACTGCCCTCACCCTCAGCCGTCCCAAGGAGTGCCCAGCACTACTCAGCATGTAGTC
CAGGACCTGCGGCATCAGCATCCCCTGGGAGCTTCTTAGAAATGCAGACCTGTGGGCTCTACCACAGGCCTCTGGAATCAGAATCTTCAG
GGTGGGGCCCAGCAGTCTGTGTTTTAACAGGTTCTCCCGGTGATGCTGGTGCATGCTCAAGTTTGAGAACCGCTGCTCTCATAGACTGCT
CCTCCAAGGGGAAGCAGTGTGGAACAGCAGAGAAAGTCCCGTCCCTATCTCTGACTGTGCAGTGAGTGTGGCCTAGGAACAGGTCCCTTC
CTAAGCTCTAGTGTCCCCATCTGTAAAATGGGCTGATTGGCCTCCACGGTCAGAGCGGCCATCTGGCTGTGCCATCCTGCATTTTTAGGA
ATGGAAAGCAGGCCTCTGAGGCAGTGGACAGGAAGACTTCTCATCCTTGAATTCTAGCTCCCATTCCAAACTGTTAGTCCCCAACCTTGT
GGTCACATCAGAGGTCAACAGCAGAACAGAGGCAGGTCAGGGTTGTCCGCTCTGATTAGCAGAACGACAGCCCCTTCCTCCTCCTCCCTC
CTTCCCATCCCTACTCATTAGCTCCCTGCTCCTGGGATGCTTCCCAAGCAGCCCAGGCCTCTAGCCTCCATGGCTGATGACCTCAGCTTT
CACACTGGTGAAGTCTGTGTACCCATACTGCAGCCCCATCCCATGGGGCCCCTGAAGACCCACTGAGGAATTCCGTAGGGTCTTGTTCCC
ACGACCGGAGTGCTGGCTCTCACAGTGAATTTTGATGCATTTAAAATAAGATTCTGATGCCAGACTGTTAAAACAGGCGCTGGTTCTGAA
GCACCGATGGAAACAGATTGATGCAGATGGAAGGAGGAAGGGAGACTGGGCCCACTGATTTCCAGCCCCACCATGTGTGCTGTTTTCAGA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_4834nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGA
GGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGG
AGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGG
TCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATG
CCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGG
ACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGC
TGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGG
TGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACT
TCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGC
GTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCG
TGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGT
GCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGG
AGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTG
CCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCA
CCCCACTTGCTGGCCGTGGCTTGGCAGAGAGGGCCTCCCAGCAGAGCTGAGAGGAGGGGGTGACCAGCTTGGAGTCTCTGGTGGGCAGAG
AGGGATGGGGTCCCTGAGCCAGGCCCCACCCATCACAGCATTCCCAGGTCCTGGTACCCAGCCCTCAGTTGTCATTTGGTTCAGAATCAG
TTCCCTTTCTCTGGGACCAAATTTCCCTTCTCTAAACATCCTACAGAGAAGGTTCCAAAGCTGAGCACCCATCACCCTAGGTGTGCACCA
GACTCCTATTAGCCCCTCCTTCCAGGAGCTAGAACCAGGGAGGTCCTGAGTGAGGAAGGCATGACCTCTGGGCTCTCTAGGTGGCCCTGG
TCTTGCCCCATCCATCCCACCTGCCACTACCTTGGGTGTCCTTACAGCTCTGCCCTGACCCCAGCCCCTGCCCCTGGACACCTGCTGACA
GCTCCCACACAGAACAGTCTGAGGTGATGCTGGCTACAGCCCTGGCAGCCCATGGCAACTCAAAGTGCCTTCCAAACCAAACTGCCCCTC
ATGAGGTTAGGGTCCCCCACCCTCCACCTGCCCAGAGGCCAACTCTGTTCCCTTCTCCTTTCATCCCAGAGGGGCCTCATCAGCAAAGAC
AGAAACTGATGTTCCATGCATGTCCCTGCTTCCAAAGCCTGACCTTCCAAAGCTTGCTTCCTTCCTCCTGGCTGCACAGACACCTCTGCT
TGGCCACAGCTTTGCTCTTTGGTCCTCAGGCCACCAGACCCCTCACAGCATGGCCCTTGGCTCTTCCTGCACTGCCCTCACCCTCAGCCG
TCCCAAGGAGTGCCCAGCACTACTCAGCATGTAGTCCAGGACCTGCGGCATCAGCATCCCCTGGGAGCTTCTTAGAAATGCAGACCTGTG
GGCTCTACCACAGGCCTCTGGAATCAGAATCTTCAGGGTGGGGCCCAGCAGTCTGTGTTTTAACAGGTTCTCCCGGTGATGCTGGTGCAT
GCTCAAGTTTGAGAACCGCTGCTCTCATAGACTGCTCCTCCAAGGGGAAGCAGTGTGGAACAGCAGAGAAAGTCCCGTCCCTATCTCTGA
CTGTGCAGTGAGTGTGGCCTAGGAACAGGTCCCTTCCTAAGCTCTAGTGTCCCCATCTGTAAAATGGGCTGATTGGCCTCCACGGTCAGA
GCGGCCATCTGGCTGTGCCATCCTGCATTTTTAGGAATGGAAAGCAGGCCTCTGAGGCAGTGGACAGGAAGACTTCTCATCCTTGAATTC
TAGCTCCCATTCCAAACTGTTAGTCCCCAACCTTGTGGTCACATCAGAGGTCAACAGCAGAACAGAGGCAGGTCAGGGTTGTCCGCTCTG
ATTAGCAGAACGACAGCCCCTTCCTCCTCCTCCCTCCTTCCCATCCCTACTCATTAGCTCCCTGCTCCTGGGATGCTTCCCAAGCAGCCC
AGGCCTCTAGCCTCCATGGCTGATGACCTCAGCTTTCACACTGGTGAAGTCTGTGTACCCATACTGCAGCCCCATCCCATGGGGCCCCTG
AAGACCCACTGAGGAATTCCGTAGGGTCTTGTTCCCACGACCGGAGTGCTGGCTCTCACAGTGAATTTTGATGCATTTAAAATAAGATTC
TGATGCCAGACTGTTAAAACAGGCGCTGGTTCTGAAGCACCGATGGAAACAGATTGATGCAGATGGAAGGAGGAAGGGAGACTGGGCCCA
CTGATTTCCAGCCCCACCATGTGTGCTGTTTTCAGATGTGATTGAGGGGTGTTCTGCCCTGCCTCCACTGTCACAGCCTTTAATAAAGAT
GTGAATCTTGAAAGCCTGATGCTCCAATCACAGACTCTGCTCAGCATCCCCAGAGGAACCACTGAGAAGCCTTTTGCCTGGATAGGAGGG
GGCTCTCCCAGGCATAGGCTTGTGGCCACTTGCCCAGCACAACTGTGTTTTGTGGGGCGTCTTTTAGGACTTAGCAGAGCTGAGAGCCCT
TTGTTGCTCAATGCTGTGAGCCTTAAGCATGTGAATCCCCCCACATGACAAGTGGGGAGACCCAGGGTAGGCTTTCCTTTGGATCATCTC
CAAATGGGAGTGCCATGTGGCAGGAAAGAAGCACCGATTTCAAGAATTACTTCCTAGAGAAAGTCAGGAACTAGAGACCAGAGTCTGCAG
GAACTTTGCCACTGCCCTTCACTGGCTAATCCTGTACTTCTCTCTGTGTTCCTTGAGTGACAGGTGGTAAAACCCTTAAAAAGGGAGGTG
TGGGAGGCCCAGGACTTTGGTAACAGGTGATGAATGTGTTGTCTTGGCCATCACAGGTGGAGCTTCAGTTAGTACCCGAGGGATTCCCCT
GGCACAAGCATTATAGGAATTAGTCCACCACTGGCGTGGGTGAGCAGCCAGGTAATGGGAATTGATCAGTGCCACCACCCTTGACCCCAA
CTACCATCCCAGATGCCCAGATTCCAGTCCTGGAGTTTTATTCTCTCAGCTTGATCCTTTGACCAAGAAGATCCAGTCCCAATATGTCAC
CTGTGCTTCATCTTTGGACTATATCTCAGGTGTTTACGTGTCAACTAATGGGAGCTTACTGGGTTAGAAGTCAGGACACTGAGTTTCAAT
CCTCACTTAGTAGTCTGTGGCCCTCTTTGGCACATTAACCTCCCTCCTTGATCCTCAGGCTGCACCTCTGGCAAATGGGAGAATGCGGCT
CCTTTTGACTTCAAGGGATCTTTGTGGGAACCAATGAGAAAATGTGTGTGAAGATAGCTTTTTGGTATATTTTAAAAGTGCACAAATTTA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_1694nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTCTCTTCCAGCCCTCAGTCTGAGG
TTCTGTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCC
CACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCAC
CAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATC
CGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_1593nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGGTAGGGAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGA
TGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGA
AGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCT
GAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_860nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGAGGAACGCGTTGTGGTGATCAGCAGCTCGGA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_3099nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCCCAGAAGTTCAGCCCA
GGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCCTGGGGAATTTTCCAG
TGAGGCATTGAGTCCCAAGCTGTGCTGAGGACAGTCTCCAAATGACAGCTGCATGCCTGGACCACCCCAGCCCTCCCACTACACCAGGGC
CAGGAGCTCTTCTGAAATGCTGATAGCATGTGTCCAGAGCCCTGTCTCTTTTCTGGAATGTCCAAGACCTTTGTCTGGAGCTTCCTTATG
CATTTTCTGTCCTCTAAGTCCTCAGTGAGGAGGGCTGGACAAGAATCCATTCCTTGGTTTATTACAGCCAGTGGGGGCCAGTGAAGGGGT
GTCAGGCCACAGGGCAGCTATATAGGGGCCAAACAAGTGAGGTTTGACTCCATCCATGTAGAAAGATATATAAATCCATTCCACAGTGAA
ACAGGTGGCCTCGTGGGTAGTGACCCTTCTGTCCCTAGAGGTTTATTACTAGAGGCTGGACTATCACCTGTCCAGGGGAAAAGGGGATCT
GAATAGAGTGAAAGGTTGGACTGGGTGGCCCCTGAGGTCTCTTCCAGCCCTCAGTCTGAGGTTCTGTATTGGAAAGTGCATGGAGCCCAT
GGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAG
AGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGA
TGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGC
CATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCAC
TCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGAT
ACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTC
CTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGA
CTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAG
GCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCC
CGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACG
AATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGC
CACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTT
CCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_2466nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGGTAGGGAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGA
GACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGC
ACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGC
TGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCAT
CCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCC
TGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACG
AGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTC
CATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTC
TGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCC
CCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGG
CCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAAT
GAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCAC
CATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCA
TGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTGGCA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_1441nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGA
GGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGG
AGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGG
TCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATG
CCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGG
ACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCT
ACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGG
CCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGGGCTCCTGGCGTGTCATTTGCTGGCTTGAATAAAGATGTCCGCCTT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_1182nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGAGGAACGCGTTGTGGTGATCAGCAGCTCGGA
AGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCT
CAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTT
CTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCT
CTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGGGCTCCTGGCGTGTCATTTGCTGGCTTGAATAAAG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_4017nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGA
GGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGG
AGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGG
TCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGGTGGGTAGGGCAGTGGCCTGGGTGCTGCCCGCCA
GGGTCTGGGCGGTGCCCCTCTTCTGTATTTTGGCCCCATCCAGAAAGCCCAAAGCCAACAGGAGTCCCTTATTCCCACTGAATAAGATAG
GGAAAGTTCACAGTGTGCGTGGGGGTGAGAGTGGACACAGTTTACCATGTGTTTTGCCATGATTGAGGTGTGGGGAGCCTGACAGGCTAA
AATGCACAGTTCTATGAGTCCTTTCTCCCAAACACTACTGTGCCTTTGCACAGGGCAGGTCTCCACAAGAAGTTTGTTGGCTGATGCCTA
GCATACTCCCAGAGAGGGCTTGGGCATACCATAACAGGAAACTGGACTCCCCATGACCTTAACTCTGCTCTCTCAGTCTACACCCATCAT
TTCCCCAAGTGTTTCTGCAAAGGCCACCTACCTAAGTATCTCATTTGTCAGAGTTATCTTCTATGAACACTGCCAGGCAGGTAGTCAGTT
GGGCAGGAGTTGAGGTCAACCCAGAGGAATCTGGAACAAGAGAGTTCTAAGGATCTGCTTCACCCAGAGTACAGCTTTGTTCCTCATTCT
GACTGAGCCCTAGCCTTGGTCACACACTGAGCACTGACTGATATTCCTTACCCACAAATGCTATTGGTAATCGATGGGTTTTGATTAACT
AAATGAAGCGTCTTTTAACTCTAGACATCCCAGCTCATGGAGCTGAGAATGGGGACAGTGTGCTTCTTTAGGATTGCAGAAGGTTCCAGA
CCAGGTAGCAGTTGTCAGGCCTCCTGTACAGGGGGCAAATTCTGAATTCTGGGCAGATAACTTAATTGAATATTCATAGATAAGGCACAG
CAAGAAATTATGGAAACCCATTTGTGAATTACTCAAATCCAAATGCAAAGCAGAGTCACATTGGCACACACAGTGGCTGTTCCCGTCCCC
CTGCAGGGCATCCGTTTCCCCCAGCCGACTGGCCTGCAAGGATTCCCATAGGTGCACACCCACACCCCTCCCAGCATGCATCCTAGGCAG
TTCATAATGCATCTCCCCTTCCCCGTTTCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGT
GGCCCAGAAGTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTG
CGCCTGGGGAATTTTCCAGTGAGGCATTGAGTCCCAAGCTGTGCTGAGGACAGTCTCCAAATGACAGCTGCATGCCTGGACCACCCCAGC
CCTCCCACTACACCAGGGCCAGGAGCTCTTCTGAAATGCTGATAGCATGTGTCCAGAGCCCTGTCTCTTTTCTGGAATGTCCAAGACCTT
TGTCTGGAGCTTCCTTATGCATTTTCTGTCCTCTAAGTCCTCAGTGAGGAGGGCTGGACAAGAATCCATTCCTTGGTTTATTACAGCCAG
TGGGGGCCAGTGAAGGGGTGTCAGGCCACAGGGCAGCTATATAGGGGCCAAACAAGTGAGGTTTGACTCCATCCATGTAGAAAGATATAT
AAATCCATTCCACAGTGAAACAGGTGGCCTCGTGGGTAGTGACCCTTCTGTCCCTAGAGGTTTATTACTAGAGGCTGGACTATCACCTGT
CCAGGGGAAAAGGGGATCTGAATAGAGTGAAAGGTTGGACTGGGTGGCCCCTGAGGTCTCTTCCAGCCCTCAGTCTGAGGTTCTGTATTG
GAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGC
CAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTG
AGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGT
TGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCC
ATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCA
TCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACT
TTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAG
CAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCAC
CACCCTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCT
TGCAGCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTG
GTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAG
GCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCC
TGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_1580nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAG
TGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCT
GGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAA
GAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_1163nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGC
ACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTT
CTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCT
TGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_2454nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCC
ACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTC
CAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAG
CGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCA
TGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGG
GCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCG
ATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCA
GCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTC
CATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCCCCCCATCAGCCC
AGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGGCCCCTGAGCTGC
CTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGC
ATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCT
CTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCC
CACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTGGCAGATGTGGCTGCT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_2310nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAA
GTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCA
GCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTT
CCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGA
AAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTC
GCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGC
TGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCT
GTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCC
CCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGG
CATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAA
CTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGG
AGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCC
ACCACCCTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAAC
CTTGCAGCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCT
TGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTA
AGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTC
CCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_3933nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAG
TGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCT
GGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCAT
CCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCG
CCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATT
CCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGC
CCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTC
CCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCT
GCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCT
GAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTT
TGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCTTGGCAGAGAGGGCCTCCCA
GCAGAGCTGAGAGGAGGGGGTGACCAGCTTGGAGTCTCTGGTGGGCAGAGAGGGATGGGGTCCCTGAGCCAGGCCCCACCCATCACAGCA
TTCCCAGGTCCTGGTACCCAGCCCTCAGTTGTCATTTGGTTCAGAATCAGTTCCCTTTCTCTGGGACCAAATTTCCCTTCTCTAAACATC
CTACAGAGAAGGTTCCAAAGCTGAGCACCCATCACCCTAGGTGTGCACCAGACTCCTATTAGCCCCTCCTTCCAGGAGCTAGAACCAGGG
AGGTCCTGAGTGAGGAAGGCATGACCTCTGGGCTCTCTAGGTGGCCCTGGTCTTGCCCCATCCATCCCACCTGCCACTACCTTGGGTGTC
CTTACAGCTCTGCCCTGACCCCAGCCCCTGCCCCTGGACACCTGCTGACAGCTCCCACACAGAACAGTCTGAGGTGATGCTGGCTACAGC
CCTGGCAGCCCATGGCAACTCAAAGTGCCTTCCAAACCAAACTGCCCCTCATGAGGTTAGGGTCCCCCACCCTCCACCTGCCCAGAGGCC
AACTCTGTTCCCTTCTCCTTTCATCCCAGAGGGGCCTCATCAGCAAAGACAGAAACTGATGTTCCATGCATGTCCCTGCTTCCAAAGCCT
GACCTTCCAAAGCTTGCTTCCTTCCTCCTGGCTGCACAGACACCTCTGCTTGGCCACAGCTTTGCTCTTTGGTCCTCAGGCCACCAGACC
CCTCACAGCATGGCCCTTGGCTCTTCCTGCACTGCCCTCACCCTCAGCCGTCCCAAGGAGTGCCCAGCACTACTCAGCATGTAGTCCAGG
ACCTGCGGCATCAGCATCCCCTGGGAGCTTCTTAGAAATGCAGACCTGTGGGCTCTACCACAGGCCTCTGGAATCAGAATCTTCAGGGTG
GGGCCCAGCAGTCTGTGTTTTAACAGGTTCTCCCGGTGATGCTGGTGCATGCTCAAGTTTGAGAACCGCTGCTCTCATAGACTGCTCCTC
CAAGGGGAAGCAGTGTGGAACAGCAGAGAAAGTCCCGTCCCTATCTCTGACTGTGCAGTGAGTGTGGCCTAGGAACAGGTCCCTTCCTAA
GCTCTAGTGTCCCCATCTGTAAAATGGGCTGATTGGCCTCCACGGTCAGAGCGGCCATCTGGCTGTGCCATCCTGCATTTTTAGGAATGG
AAAGCAGGCCTCTGAGGCAGTGGACAGGAAGACTTCTCATCCTTGAATTCTAGCTCCCATTCCAAACTGTTAGTCCCCAACCTTGTGGTC
ACATCAGAGGTCAACAGCAGAACAGAGGCAGGTCAGGGTTGTCCGCTCTGATTAGCAGAACGACAGCCCCTTCCTCCTCCTCCCTCCTTC
CCATCCCTACTCATTAGCTCCCTGCTCCTGGGATGCTTCCCAAGCAGCCCAGGCCTCTAGCCTCCATGGCTGATGACCTCAGCTTTCACA
CTGGTGAAGTCTGTGTACCCATACTGCAGCCCCATCCCATGGGGCCCCTGAAGACCCACTGAGGAATTCCGTAGGGTCTTGTTCCCACGA
CCGGAGTGCTGGCTCTCACAGTGAATTTTGATGCATTTAAAATAAGATTCTGATGCCAGACTGTTAAAACAGGCGCTGGTTCTGAAGCAC
CGATGGAAACAGATTGATGCAGATGGAAGGAGGAAGGGAGACTGGGCCCACTGATTTCCAGCCCCACCATGTGTGCTGTTTTCAGATGTG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_4830nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAA
GTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCA
GCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTT
CCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGA
AAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGA
GAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGC
TGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGG
GCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTT
CCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGT
GCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCT
GGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTT
TGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCT
GCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCA
GCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCC
ACTTGCTGGCCGTGGCTTGGCAGAGAGGGCCTCCCAGCAGAGCTGAGAGGAGGGGGTGACCAGCTTGGAGTCTCTGGTGGGCAGAGAGGG
ATGGGGTCCCTGAGCCAGGCCCCACCCATCACAGCATTCCCAGGTCCTGGTACCCAGCCCTCAGTTGTCATTTGGTTCAGAATCAGTTCC
CTTTCTCTGGGACCAAATTTCCCTTCTCTAAACATCCTACAGAGAAGGTTCCAAAGCTGAGCACCCATCACCCTAGGTGTGCACCAGACT
CCTATTAGCCCCTCCTTCCAGGAGCTAGAACCAGGGAGGTCCTGAGTGAGGAAGGCATGACCTCTGGGCTCTCTAGGTGGCCCTGGTCTT
GCCCCATCCATCCCACCTGCCACTACCTTGGGTGTCCTTACAGCTCTGCCCTGACCCCAGCCCCTGCCCCTGGACACCTGCTGACAGCTC
CCACACAGAACAGTCTGAGGTGATGCTGGCTACAGCCCTGGCAGCCCATGGCAACTCAAAGTGCCTTCCAAACCAAACTGCCCCTCATGA
GGTTAGGGTCCCCCACCCTCCACCTGCCCAGAGGCCAACTCTGTTCCCTTCTCCTTTCATCCCAGAGGGGCCTCATCAGCAAAGACAGAA
ACTGATGTTCCATGCATGTCCCTGCTTCCAAAGCCTGACCTTCCAAAGCTTGCTTCCTTCCTCCTGGCTGCACAGACACCTCTGCTTGGC
CACAGCTTTGCTCTTTGGTCCTCAGGCCACCAGACCCCTCACAGCATGGCCCTTGGCTCTTCCTGCACTGCCCTCACCCTCAGCCGTCCC
AAGGAGTGCCCAGCACTACTCAGCATGTAGTCCAGGACCTGCGGCATCAGCATCCCCTGGGAGCTTCTTAGAAATGCAGACCTGTGGGCT
CTACCACAGGCCTCTGGAATCAGAATCTTCAGGGTGGGGCCCAGCAGTCTGTGTTTTAACAGGTTCTCCCGGTGATGCTGGTGCATGCTC
AAGTTTGAGAACCGCTGCTCTCATAGACTGCTCCTCCAAGGGGAAGCAGTGTGGAACAGCAGAGAAAGTCCCGTCCCTATCTCTGACTGT
GCAGTGAGTGTGGCCTAGGAACAGGTCCCTTCCTAAGCTCTAGTGTCCCCATCTGTAAAATGGGCTGATTGGCCTCCACGGTCAGAGCGG
CCATCTGGCTGTGCCATCCTGCATTTTTAGGAATGGAAAGCAGGCCTCTGAGGCAGTGGACAGGAAGACTTCTCATCCTTGAATTCTAGC
TCCCATTCCAAACTGTTAGTCCCCAACCTTGTGGTCACATCAGAGGTCAACAGCAGAACAGAGGCAGGTCAGGGTTGTCCGCTCTGATTA
GCAGAACGACAGCCCCTTCCTCCTCCTCCCTCCTTCCCATCCCTACTCATTAGCTCCCTGCTCCTGGGATGCTTCCCAAGCAGCCCAGGC
CTCTAGCCTCCATGGCTGATGACCTCAGCTTTCACACTGGTGAAGTCTGTGTACCCATACTGCAGCCCCATCCCATGGGGCCCCTGAAGA
CCCACTGAGGAATTCCGTAGGGTCTTGTTCCCACGACCGGAGTGCTGGCTCTCACAGTGAATTTTGATGCATTTAAAATAAGATTCTGAT
GCCAGACTGTTAAAACAGGCGCTGGTTCTGAAGCACCGATGGAAACAGATTGATGCAGATGGAAGGAGGAAGGGAGACTGGGCCCACTGA
TTTCCAGCCCCACCATGTGTGCTGTTTTCAGATGTGATTGAGGGGTGTTCTGCCCTGCCTCCACTGTCACAGCCTTTAATAAAGATGTGA
ATCTTGAAAGCCTGATGCTCCAATCACAGACTCTGCTCAGCATCCCCAGAGGAACCACTGAGAAGCCTTTTGCCTGGATAGGAGGGGGCT
CTCCCAGGCATAGGCTTGTGGCCACTTGCCCAGCACAACTGTGTTTTGTGGGGCGTCTTTTAGGACTTAGCAGAGCTGAGAGCCCTTTGT
TGCTCAATGCTGTGAGCCTTAAGCATGTGAATCCCCCCACATGACAAGTGGGGAGACCCAGGGTAGGCTTTCCTTTGGATCATCTCCAAA
TGGGAGTGCCATGTGGCAGGAAAGAAGCACCGATTTCAAGAATTACTTCCTAGAGAAAGTCAGGAACTAGAGACCAGAGTCTGCAGGAAC
TTTGCCACTGCCCTTCACTGGCTAATCCTGTACTTCTCTCTGTGTTCCTTGAGTGACAGGTGGTAAAACCCTTAAAAAGGGAGGTGTGGG
AGGCCCAGGACTTTGGTAACAGGTGATGAATGTGTTGTCTTGGCCATCACAGGTGGAGCTTCAGTTAGTACCCGAGGGATTCCCCTGGCA
CAAGCATTATAGGAATTAGTCCACCACTGGCGTGGGTGAGCAGCCAGGTAATGGGAATTGATCAGTGCCACCACCCTTGACCCCAACTAC
CATCCCAGATGCCCAGATTCCAGTCCTGGAGTTTTATTCTCTCAGCTTGATCCTTTGACCAAGAAGATCCAGTCCCAATATGTCACCTGT
GCTTCATCTTTGGACTATATCTCAGGTGTTTACGTGTCAACTAATGGGAGCTTACTGGGTTAGAAGTCAGGACACTGAGTTTCAATCCTC
ACTTAGTAGTCTGTGGCCCTCTTTGGCACATTAACCTCCCTCCTTGATCCTCAGGCTGCACCTCTGGCAAATGGGAGAATGCGGCTCCTT
TTGACTTCAAGGGATCTTTGTGGGAACCAATGAGAAAATGTGTGTGAAGATAGCTTTTTGGTATATTTTAAAAGTGCACAAATTTAAGAT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_1690nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTCTCTTCCAGCCCTCAGTCTGAGGTTCT
GTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACT
CCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGC
CCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCT
ACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_1589nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGGTAGGGAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGAC
AGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGAC
AGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGT
CCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_856nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGAC

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_3095nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCCCAGAAGTTCAGCCCAGGAC
TCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCCTGGGGAATTTTCCAGTGAG
GCATTGAGTCCCAAGCTGTGCTGAGGACAGTCTCCAAATGACAGCTGCATGCCTGGACCACCCCAGCCCTCCCACTACACCAGGGCCAGG
AGCTCTTCTGAAATGCTGATAGCATGTGTCCAGAGCCCTGTCTCTTTTCTGGAATGTCCAAGACCTTTGTCTGGAGCTTCCTTATGCATT
TTCTGTCCTCTAAGTCCTCAGTGAGGAGGGCTGGACAAGAATCCATTCCTTGGTTTATTACAGCCAGTGGGGGCCAGTGAAGGGGTGTCA
GGCCACAGGGCAGCTATATAGGGGCCAAACAAGTGAGGTTTGACTCCATCCATGTAGAAAGATATATAAATCCATTCCACAGTGAAACAG
GTGGCCTCGTGGGTAGTGACCCTTCTGTCCCTAGAGGTTTATTACTAGAGGCTGGACTATCACCTGTCCAGGGGAAAAGGGGATCTGAAT
AGAGTGAAAGGTTGGACTGGGTGGCCCCTGAGGTCTCTTCCAGCCCTCAGTCTGAGGTTCTGTATTGGAAAGTGCATGGAGCCCATGGAG
ACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCA
CAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCT
GAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATC
CGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCT
GCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGA
GGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCC
ATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCT
GTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCCC
CCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGGC
CCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATG
AATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACC
ATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCAT
GCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTGGCAG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_2462nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGGTAGGGAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACC
GCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAA
GGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAG
CCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGC
CTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCC
ATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGG
GCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATG
GCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTC
AGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCCCCCC
ATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGGCCCC
TGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAAT
GGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATT
CCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCC
CCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTGGCAGATG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_1437nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAA
GTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCA
GCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTT
CCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGA
AAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGA
GAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCC
CCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_1178nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGAC
TCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGG
GTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCC
TGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGA
GCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGGGCTCCTGGCGTGTCATTTGCTGGCTTGAATAAAGATGT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_4013nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAA
GTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCA
GCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTT
CCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGGTGGGTAGGGCAGTGGCCTGGGTGCTGCCCGCCAGGGT
CTGGGCGGTGCCCCTCTTCTGTATTTTGGCCCCATCCAGAAAGCCCAAAGCCAACAGGAGTCCCTTATTCCCACTGAATAAGATAGGGAA
AGTTCACAGTGTGCGTGGGGGTGAGAGTGGACACAGTTTACCATGTGTTTTGCCATGATTGAGGTGTGGGGAGCCTGACAGGCTAAAATG
CACAGTTCTATGAGTCCTTTCTCCCAAACACTACTGTGCCTTTGCACAGGGCAGGTCTCCACAAGAAGTTTGTTGGCTGATGCCTAGCAT
ACTCCCAGAGAGGGCTTGGGCATACCATAACAGGAAACTGGACTCCCCATGACCTTAACTCTGCTCTCTCAGTCTACACCCATCATTTCC
CCAAGTGTTTCTGCAAAGGCCACCTACCTAAGTATCTCATTTGTCAGAGTTATCTTCTATGAACACTGCCAGGCAGGTAGTCAGTTGGGC
AGGAGTTGAGGTCAACCCAGAGGAATCTGGAACAAGAGAGTTCTAAGGATCTGCTTCACCCAGAGTACAGCTTTGTTCCTCATTCTGACT
GAGCCCTAGCCTTGGTCACACACTGAGCACTGACTGATATTCCTTACCCACAAATGCTATTGGTAATCGATGGGTTTTGATTAACTAAAT
GAAGCGTCTTTTAACTCTAGACATCCCAGCTCATGGAGCTGAGAATGGGGACAGTGTGCTTCTTTAGGATTGCAGAAGGTTCCAGACCAG
GTAGCAGTTGTCAGGCCTCCTGTACAGGGGGCAAATTCTGAATTCTGGGCAGATAACTTAATTGAATATTCATAGATAAGGCACAGCAAG
AAATTATGGAAACCCATTTGTGAATTACTCAAATCCAAATGCAAAGCAGAGTCACATTGGCACACACAGTGGCTGTTCCCGTCCCCCTGC
AGGGCATCCGTTTCCCCCAGCCGACTGGCCTGCAAGGATTCCCATAGGTGCACACCCACACCCCTCCCAGCATGCATCCTAGGCAGTTCA
TAATGCATCTCCCCTTCCCCGTTTCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCC
CAGAAGTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCC
TGGGGAATTTTCCAGTGAGGCATTGAGTCCCAAGCTGTGCTGAGGACAGTCTCCAAATGACAGCTGCATGCCTGGACCACCCCAGCCCTC
CCACTACACCAGGGCCAGGAGCTCTTCTGAAATGCTGATAGCATGTGTCCAGAGCCCTGTCTCTTTTCTGGAATGTCCAAGACCTTTGTC
TGGAGCTTCCTTATGCATTTTCTGTCCTCTAAGTCCTCAGTGAGGAGGGCTGGACAAGAATCCATTCCTTGGTTTATTACAGCCAGTGGG
GGCCAGTGAAGGGGTGTCAGGCCACAGGGCAGCTATATAGGGGCCAAACAAGTGAGGTTTGACTCCATCCATGTAGAAAGATATATAAAT
CCATTCCACAGTGAAACAGGTGGCCTCGTGGGTAGTGACCCTTCTGTCCCTAGAGGTTTATTACTAGAGGCTGGACTATCACCTGTCCAG
GGGAAAAGGGGATCTGAATAGAGTGAAAGGTTGGACTGGGTGGCCCCTGAGGTCTCTTCCAGCCCTCAGTCTGAGGTTCTGTATTGGAAA
GTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGT
CCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCA
GGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTA
CAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGT
GGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAG
CCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTT
TGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGG
TGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACC
CTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCA
GCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTA
AGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCAT
GGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGC
CAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGG

>In-frame_RARA_ENST00000394081_chr17_38499119_+_PML_ENST00000395135_chr15_74326819_+_907nt
AGCCGCTGTACTCTGCCTCGGACGCCACGAGACTCTAGACGGGAGTCCCCTCGAGGTGAAGCCGCTGAGTTCCCGGGCCCCGCCAGGCTT
CCCTGGGAGAGCCGACGGACCCCCCCTCCCAGCACACACAACTTCCCTGCTTTTCACCGGGACTGGCGGAGCGGCCGGCGGACTTAGACG
CGGGGACTTCAGGGCAGGGGGCGCCCCCTGCCCGGGTCACCAGTCGGGGCGAGGGGACGTCTCCTCTCCCCCAGCTGCTCTGCTCGGATG
GCGCCGCCGGCTGAGTGACGGGGGCGGCGCGCAGGACTTCCCAGCTCGGACCTCTTGCCTTCGAGGGGAAAGATGTACGAGAGTGTAGAA
GTGGGGGGTCCCACCCCTAATCCCTTCCTAGTGGTGGATTTTTATAACCAGAACCGGGCCTGTTTGCTCCCAGAGAAGGGGCTCCCCGCC
CCGGGTCCGTACTCCACCCCGCTCCGGACTCCGCTTTGGAATGGCTCAAACCACTAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGAC
TCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGG
GTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCC
TGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGA
GCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGGGCTCCTGGCGTGTCATTTGCTGGCTTGAATAAAGATGT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395135_chr15_74326819_+_1035nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGT
CCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTT
TCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGT
GCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395135_chr15_74326819_+_1110nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAGGAACGCGTTG
TGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGC
TGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGA
TTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATC
TGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGGGCTCCTGGCGTGTCA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395135_chr15_74326819_+_1106nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAAGGAACGCGTTGTGGT
GATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGA
AGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGA
CAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCC
AGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGGGCTCCTGGCGTGTCATTTG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_1509nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAG
AGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCC
AAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTT
AGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_1092nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCTGCCTCCTCCAGCCC
ATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGG
GCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGA
AAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCT
CTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTGGCAGATGTGGCTGCTCAATAAACACTT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_2383nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGC
CCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGC
TGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCC
CCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGA
GAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCA
GCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACC
GGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCT
TCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTG
GGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAG
AAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCC
TGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATC
AACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTC
AAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAG
CCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_2239nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAA
CGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGG
CTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCG
TCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCT
CGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACT
CCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTT
GGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCC
ACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCC
CTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATC
CTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATT
TATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAA
GCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAG
CCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGT
GCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAG
AGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCT
GGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCA
CTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGAT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_3862nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAG
AGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCC
AAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAA
GCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCA
GCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACA
TTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCT
TCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGT
GCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCC
TGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCC
GTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGC
AGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCT
TGGCAGAGAGGGCCTCCCAGCAGAGCTGAGAGGAGGGGGTGACCAGCTTGGAGTCTCTGGTGGGCAGAGAGGGATGGGGTCCCTGAGCCA
GGCCCCACCCATCACAGCATTCCCAGGTCCTGGTACCCAGCCCTCAGTTGTCATTTGGTTCAGAATCAGTTCCCTTTCTCTGGGACCAAA
TTTCCCTTCTCTAAACATCCTACAGAGAAGGTTCCAAAGCTGAGCACCCATCACCCTAGGTGTGCACCAGACTCCTATTAGCCCCTCCTT
CCAGGAGCTAGAACCAGGGAGGTCCTGAGTGAGGAAGGCATGACCTCTGGGCTCTCTAGGTGGCCCTGGTCTTGCCCCATCCATCCCACC
TGCCACTACCTTGGGTGTCCTTACAGCTCTGCCCTGACCCCAGCCCCTGCCCCTGGACACCTGCTGACAGCTCCCACACAGAACAGTCTG
AGGTGATGCTGGCTACAGCCCTGGCAGCCCATGGCAACTCAAAGTGCCTTCCAAACCAAACTGCCCCTCATGAGGTTAGGGTCCCCCACC
CTCCACCTGCCCAGAGGCCAACTCTGTTCCCTTCTCCTTTCATCCCAGAGGGGCCTCATCAGCAAAGACAGAAACTGATGTTCCATGCAT
GTCCCTGCTTCCAAAGCCTGACCTTCCAAAGCTTGCTTCCTTCCTCCTGGCTGCACAGACACCTCTGCTTGGCCACAGCTTTGCTCTTTG
GTCCTCAGGCCACCAGACCCCTCACAGCATGGCCCTTGGCTCTTCCTGCACTGCCCTCACCCTCAGCCGTCCCAAGGAGTGCCCAGCACT
ACTCAGCATGTAGTCCAGGACCTGCGGCATCAGCATCCCCTGGGAGCTTCTTAGAAATGCAGACCTGTGGGCTCTACCACAGGCCTCTGG
AATCAGAATCTTCAGGGTGGGGCCCAGCAGTCTGTGTTTTAACAGGTTCTCCCGGTGATGCTGGTGCATGCTCAAGTTTGAGAACCGCTG
CTCTCATAGACTGCTCCTCCAAGGGGAAGCAGTGTGGAACAGCAGAGAAAGTCCCGTCCCTATCTCTGACTGTGCAGTGAGTGTGGCCTA
GGAACAGGTCCCTTCCTAAGCTCTAGTGTCCCCATCTGTAAAATGGGCTGATTGGCCTCCACGGTCAGAGCGGCCATCTGGCTGTGCCAT
CCTGCATTTTTAGGAATGGAAAGCAGGCCTCTGAGGCAGTGGACAGGAAGACTTCTCATCCTTGAATTCTAGCTCCCATTCCAAACTGTT
AGTCCCCAACCTTGTGGTCACATCAGAGGTCAACAGCAGAACAGAGGCAGGTCAGGGTTGTCCGCTCTGATTAGCAGAACGACAGCCCCT
TCCTCCTCCTCCCTCCTTCCCATCCCTACTCATTAGCTCCCTGCTCCTGGGATGCTTCCCAAGCAGCCCAGGCCTCTAGCCTCCATGGCT
GATGACCTCAGCTTTCACACTGGTGAAGTCTGTGTACCCATACTGCAGCCCCATCCCATGGGGCCCCTGAAGACCCACTGAGGAATTCCG
TAGGGTCTTGTTCCCACGACCGGAGTGCTGGCTCTCACAGTGAATTTTGATGCATTTAAAATAAGATTCTGATGCCAGACTGTTAAAACA
GGCGCTGGTTCTGAAGCACCGATGGAAACAGATTGATGCAGATGGAAGGAGGAAGGGAGACTGGGCCCACTGATTTCCAGCCCCACCATG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_4759nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAA
CGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGG
CTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCG
TCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCT
CGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCA
CCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCC
AGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGG
CCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGC
CTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGC
CTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCA
GCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCT
TCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACA
ACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCA
CCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGG
CAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCTTGGCAGAGAGGGCCTCCCAGCAGAGCTGAGAGGAGGGGGTGACCAGCTTGGAGT
CTCTGGTGGGCAGAGAGGGATGGGGTCCCTGAGCCAGGCCCCACCCATCACAGCATTCCCAGGTCCTGGTACCCAGCCCTCAGTTGTCAT
TTGGTTCAGAATCAGTTCCCTTTCTCTGGGACCAAATTTCCCTTCTCTAAACATCCTACAGAGAAGGTTCCAAAGCTGAGCACCCATCAC
CCTAGGTGTGCACCAGACTCCTATTAGCCCCTCCTTCCAGGAGCTAGAACCAGGGAGGTCCTGAGTGAGGAAGGCATGACCTCTGGGCTC
TCTAGGTGGCCCTGGTCTTGCCCCATCCATCCCACCTGCCACTACCTTGGGTGTCCTTACAGCTCTGCCCTGACCCCAGCCCCTGCCCCT
GGACACCTGCTGACAGCTCCCACACAGAACAGTCTGAGGTGATGCTGGCTACAGCCCTGGCAGCCCATGGCAACTCAAAGTGCCTTCCAA
ACCAAACTGCCCCTCATGAGGTTAGGGTCCCCCACCCTCCACCTGCCCAGAGGCCAACTCTGTTCCCTTCTCCTTTCATCCCAGAGGGGC
CTCATCAGCAAAGACAGAAACTGATGTTCCATGCATGTCCCTGCTTCCAAAGCCTGACCTTCCAAAGCTTGCTTCCTTCCTCCTGGCTGC
ACAGACACCTCTGCTTGGCCACAGCTTTGCTCTTTGGTCCTCAGGCCACCAGACCCCTCACAGCATGGCCCTTGGCTCTTCCTGCACTGC
CCTCACCCTCAGCCGTCCCAAGGAGTGCCCAGCACTACTCAGCATGTAGTCCAGGACCTGCGGCATCAGCATCCCCTGGGAGCTTCTTAG
AAATGCAGACCTGTGGGCTCTACCACAGGCCTCTGGAATCAGAATCTTCAGGGTGGGGCCCAGCAGTCTGTGTTTTAACAGGTTCTCCCG
GTGATGCTGGTGCATGCTCAAGTTTGAGAACCGCTGCTCTCATAGACTGCTCCTCCAAGGGGAAGCAGTGTGGAACAGCAGAGAAAGTCC
CGTCCCTATCTCTGACTGTGCAGTGAGTGTGGCCTAGGAACAGGTCCCTTCCTAAGCTCTAGTGTCCCCATCTGTAAAATGGGCTGATTG
GCCTCCACGGTCAGAGCGGCCATCTGGCTGTGCCATCCTGCATTTTTAGGAATGGAAAGCAGGCCTCTGAGGCAGTGGACAGGAAGACTT
CTCATCCTTGAATTCTAGCTCCCATTCCAAACTGTTAGTCCCCAACCTTGTGGTCACATCAGAGGTCAACAGCAGAACAGAGGCAGGTCA
GGGTTGTCCGCTCTGATTAGCAGAACGACAGCCCCTTCCTCCTCCTCCCTCCTTCCCATCCCTACTCATTAGCTCCCTGCTCCTGGGATG
CTTCCCAAGCAGCCCAGGCCTCTAGCCTCCATGGCTGATGACCTCAGCTTTCACACTGGTGAAGTCTGTGTACCCATACTGCAGCCCCAT
CCCATGGGGCCCCTGAAGACCCACTGAGGAATTCCGTAGGGTCTTGTTCCCACGACCGGAGTGCTGGCTCTCACAGTGAATTTTGATGCA
TTTAAAATAAGATTCTGATGCCAGACTGTTAAAACAGGCGCTGGTTCTGAAGCACCGATGGAAACAGATTGATGCAGATGGAAGGAGGAA
GGGAGACTGGGCCCACTGATTTCCAGCCCCACCATGTGTGCTGTTTTCAGATGTGATTGAGGGGTGTTCTGCCCTGCCTCCACTGTCACA
GCCTTTAATAAAGATGTGAATCTTGAAAGCCTGATGCTCCAATCACAGACTCTGCTCAGCATCCCCAGAGGAACCACTGAGAAGCCTTTT
GCCTGGATAGGAGGGGGCTCTCCCAGGCATAGGCTTGTGGCCACTTGCCCAGCACAACTGTGTTTTGTGGGGCGTCTTTTAGGACTTAGC
AGAGCTGAGAGCCCTTTGTTGCTCAATGCTGTGAGCCTTAAGCATGTGAATCCCCCCACATGACAAGTGGGGAGACCCAGGGTAGGCTTT
CCTTTGGATCATCTCCAAATGGGAGTGCCATGTGGCAGGAAAGAAGCACCGATTTCAAGAATTACTTCCTAGAGAAAGTCAGGAACTAGA
GACCAGAGTCTGCAGGAACTTTGCCACTGCCCTTCACTGGCTAATCCTGTACTTCTCTCTGTGTTCCTTGAGTGACAGGTGGTAAAACCC
TTAAAAAGGGAGGTGTGGGAGGCCCAGGACTTTGGTAACAGGTGATGAATGTGTTGTCTTGGCCATCACAGGTGGAGCTTCAGTTAGTAC
CCGAGGGATTCCCCTGGCACAAGCATTATAGGAATTAGTCCACCACTGGCGTGGGTGAGCAGCCAGGTAATGGGAATTGATCAGTGCCAC
CACCCTTGACCCCAACTACCATCCCAGATGCCCAGATTCCAGTCCTGGAGTTTTATTCTCTCAGCTTGATCCTTTGACCAAGAAGATCCA
GTCCCAATATGTCACCTGTGCTTCATCTTTGGACTATATCTCAGGTGTTTACGTGTCAACTAATGGGAGCTTACTGGGTTAGAAGTCAGG
ACACTGAGTTTCAATCCTCACTTAGTAGTCTGTGGCCCTCTTTGGCACATTAACCTCCCTCCTTGATCCTCAGGCTGCACCTCTGGCAAA
TGGGAGAATGCGGCTCCTTTTGACTTCAAGGGATCTTTGTGGGAACCAATGAGAAAATGTGTGTGAAGATAGCTTTTTGGTATATTTTAA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_1619nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTCTCTTCCA
GCCCTCAGTCTGAGGTTCTGTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCC
CACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCA
GCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCC
GTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_1518nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTC
CTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGC
TGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTT
TCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_785nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGAGGAACGCGTTGTGGT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_3024nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCC
CAGAAGTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCC
TGGGGAATTTTCCAGTGAGGCATTGAGTCCCAAGCTGTGCTGAGGACAGTCTCCAAATGACAGCTGCATGCCTGGACCACCCCAGCCCTC
CCACTACACCAGGGCCAGGAGCTCTTCTGAAATGCTGATAGCATGTGTCCAGAGCCCTGTCTCTTTTCTGGAATGTCCAAGACCTTTGTC
TGGAGCTTCCTTATGCATTTTCTGTCCTCTAAGTCCTCAGTGAGGAGGGCTGGACAAGAATCCATTCCTTGGTTTATTACAGCCAGTGGG
GGCCAGTGAAGGGGTGTCAGGCCACAGGGCAGCTATATAGGGGCCAAACAAGTGAGGTTTGACTCCATCCATGTAGAAAGATATATAAAT
CCATTCCACAGTGAAACAGGTGGCCTCGTGGGTAGTGACCCTTCTGTCCCTAGAGGTTTATTACTAGAGGCTGGACTATCACCTGTCCAG
GGGAAAAGGGGATCTGAATAGAGTGAAAGGTTGGACTGGGTGGCCCCTGAGGTCTCTTCCAGCCCTCAGTCTGAGGTTCTGTATTGGAAA
GTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGT
CCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCA
GGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTA
CAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGT
GGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAG
CCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTT
TGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGG
TGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACC
CTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCA
GCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTA
AGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCAT
GGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGC
CAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_2391nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGA
GAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGT
GCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACC
ACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTG
CATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCA
GTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGC
TGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAG
AGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGT
CCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCC
ACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGC
CCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGT
TCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTG
TGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCC
AACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGG
AATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGC
TGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAA
TAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTA

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_1366nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAA
CGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGG
CTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCG
TCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCT
CGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCA
CCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTG
GGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAG
AGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGGGCTCCTGGCGTGTCATTTGCTGGCTTGAAT

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_1107nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGAGGAACGCGTTGTGGT
GATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGA
AGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGA
CAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCC
AGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGGGCTCCTGGCGTGTCATTTG

>In-frame_RARA_ENST00000254066_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_3942nt
CAGAAGCAGGGGGGAATCCTGAATCGAGCTGAGAGGGCTTCCCCGGTTCTCCTGGGAACCCCATCGGCCCCCTGCCAGCACACACCTGAG
CAGCATCACAGGACATGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGA
CCTTCCCAGGAAAAGTGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGG
GTGGGGGCTCCAGGAGACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCT
GGGCCCAGGCCCCATGCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGC
TTGGCATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCC
CCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAG
CCAATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAA
CGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGG
CTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCG
TCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGGTGGGTAGGGCAGTGGCCT
GGGTGCTGCCCGCCAGGGTCTGGGCGGTGCCCCTCTTCTGTATTTTGGCCCCATCCAGAAAGCCCAAAGCCAACAGGAGTCCCTTATTCC
CACTGAATAAGATAGGGAAAGTTCACAGTGTGCGTGGGGGTGAGAGTGGACACAGTTTACCATGTGTTTTGCCATGATTGAGGTGTGGGG
AGCCTGACAGGCTAAAATGCACAGTTCTATGAGTCCTTTCTCCCAAACACTACTGTGCCTTTGCACAGGGCAGGTCTCCACAAGAAGTTT
GTTGGCTGATGCCTAGCATACTCCCAGAGAGGGCTTGGGCATACCATAACAGGAAACTGGACTCCCCATGACCTTAACTCTGCTCTCTCA
GTCTACACCCATCATTTCCCCAAGTGTTTCTGCAAAGGCCACCTACCTAAGTATCTCATTTGTCAGAGTTATCTTCTATGAACACTGCCA
GGCAGGTAGTCAGTTGGGCAGGAGTTGAGGTCAACCCAGAGGAATCTGGAACAAGAGAGTTCTAAGGATCTGCTTCACCCAGAGTACAGC
TTTGTTCCTCATTCTGACTGAGCCCTAGCCTTGGTCACACACTGAGCACTGACTGATATTCCTTACCCACAAATGCTATTGGTAATCGAT
GGGTTTTGATTAACTAAATGAAGCGTCTTTTAACTCTAGACATCCCAGCTCATGGAGCTGAGAATGGGGACAGTGTGCTTCTTTAGGATT
GCAGAAGGTTCCAGACCAGGTAGCAGTTGTCAGGCCTCCTGTACAGGGGGCAAATTCTGAATTCTGGGCAGATAACTTAATTGAATATTC
ATAGATAAGGCACAGCAAGAAATTATGGAAACCCATTTGTGAATTACTCAAATCCAAATGCAAAGCAGAGTCACATTGGCACACACAGTG
GCTGTTCCCGTCCCCCTGCAGGGCATCCGTTTCCCCCAGCCGACTGGCCTGCAAGGATTCCCATAGGTGCACACCCACACCCCTCCCAGC
ATGCATCCTAGGCAGTTCATAATGCATCTCCCCTTCCCCGTTTCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCC
GAAAACTCGGTGAGTGGCCCAGAAGTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACT
CTCAGACTTGCCTTGCGCCTGGGGAATTTTCCAGTGAGGCATTGAGTCCCAAGCTGTGCTGAGGACAGTCTCCAAATGACAGCTGCATGC
CTGGACCACCCCAGCCCTCCCACTACACCAGGGCCAGGAGCTCTTCTGAAATGCTGATAGCATGTGTCCAGAGCCCTGTCTCTTTTCTGG
AATGTCCAAGACCTTTGTCTGGAGCTTCCTTATGCATTTTCTGTCCTCTAAGTCCTCAGTGAGGAGGGCTGGACAAGAATCCATTCCTTG
GTTTATTACAGCCAGTGGGGGCCAGTGAAGGGGTGTCAGGCCACAGGGCAGCTATATAGGGGCCAAACAAGTGAGGTTTGACTCCATCCA
TGTAGAAAGATATATAAATCCATTCCACAGTGAAACAGGTGGCCTCGTGGGTAGTGACCCTTCTGTCCCTAGAGGTTTATTACTAGAGGC
TGGACTATCACCTGTCCAGGGGAAAAGGGGATCTGAATAGAGTGAAAGGTTGGACTGGGTGGCCCCTGAGGTCTCTTCCAGCCCTCAGTC
TGAGGTTCTGTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGC
CAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTC
CCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTG
GGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTC
GGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCC
AGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCC
AGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAG
CCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTC
CAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACC
CTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGC
ACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGA
GAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCC
TGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGC

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_1584nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCA
GCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGAC
CTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCA
AAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_1167nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCTGCCTCCTCCAGCCCATGCTCTTACAGGCC
CTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGG
TCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCA
CCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_2458nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCG
AGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAG
CCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTC
ACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTC
GCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCA
CAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTG
TGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTT
CCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAG
GCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCCCCCCATCA
GCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGGCCCCTGAG
CTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCT
ATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAG
GCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGA
CCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTGGCAGATGTGGC

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_2314nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGA
GGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGG
AGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGG
TCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATG
CCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACT
CCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGC
CCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCT
ACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGT
CTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAA
GGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCA
ACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTC
TTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACAT
TCCCACCACCCTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTG
TAACCTTGCAGCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAA
TTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAG
GCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTG
AGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_3937nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCA
GCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGAC
CTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGG
TCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCA
TGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGG
AATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACC
TGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGG
TCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTG
TGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGG
GCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCT
ACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCTTGGCAGAGAGGGCCT
CCCAGCAGAGCTGAGAGGAGGGGGTGACCAGCTTGGAGTCTCTGGTGGGCAGAGAGGGATGGGGTCCCTGAGCCAGGCCCCACCCATCAC
AGCATTCCCAGGTCCTGGTACCCAGCCCTCAGTTGTCATTTGGTTCAGAATCAGTTCCCTTTCTCTGGGACCAAATTTCCCTTCTCTAAA
CATCCTACAGAGAAGGTTCCAAAGCTGAGCACCCATCACCCTAGGTGTGCACCAGACTCCTATTAGCCCCTCCTTCCAGGAGCTAGAACC
AGGGAGGTCCTGAGTGAGGAAGGCATGACCTCTGGGCTCTCTAGGTGGCCCTGGTCTTGCCCCATCCATCCCACCTGCCACTACCTTGGG
TGTCCTTACAGCTCTGCCCTGACCCCAGCCCCTGCCCCTGGACACCTGCTGACAGCTCCCACACAGAACAGTCTGAGGTGATGCTGGCTA
CAGCCCTGGCAGCCCATGGCAACTCAAAGTGCCTTCCAAACCAAACTGCCCCTCATGAGGTTAGGGTCCCCCACCCTCCACCTGCCCAGA
GGCCAACTCTGTTCCCTTCTCCTTTCATCCCAGAGGGGCCTCATCAGCAAAGACAGAAACTGATGTTCCATGCATGTCCCTGCTTCCAAA
GCCTGACCTTCCAAAGCTTGCTTCCTTCCTCCTGGCTGCACAGACACCTCTGCTTGGCCACAGCTTTGCTCTTTGGTCCTCAGGCCACCA
GACCCCTCACAGCATGGCCCTTGGCTCTTCCTGCACTGCCCTCACCCTCAGCCGTCCCAAGGAGTGCCCAGCACTACTCAGCATGTAGTC
CAGGACCTGCGGCATCAGCATCCCCTGGGAGCTTCTTAGAAATGCAGACCTGTGGGCTCTACCACAGGCCTCTGGAATCAGAATCTTCAG
GGTGGGGCCCAGCAGTCTGTGTTTTAACAGGTTCTCCCGGTGATGCTGGTGCATGCTCAAGTTTGAGAACCGCTGCTCTCATAGACTGCT
CCTCCAAGGGGAAGCAGTGTGGAACAGCAGAGAAAGTCCCGTCCCTATCTCTGACTGTGCAGTGAGTGTGGCCTAGGAACAGGTCCCTTC
CTAAGCTCTAGTGTCCCCATCTGTAAAATGGGCTGATTGGCCTCCACGGTCAGAGCGGCCATCTGGCTGTGCCATCCTGCATTTTTAGGA
ATGGAAAGCAGGCCTCTGAGGCAGTGGACAGGAAGACTTCTCATCCTTGAATTCTAGCTCCCATTCCAAACTGTTAGTCCCCAACCTTGT
GGTCACATCAGAGGTCAACAGCAGAACAGAGGCAGGTCAGGGTTGTCCGCTCTGATTAGCAGAACGACAGCCCCTTCCTCCTCCTCCCTC
CTTCCCATCCCTACTCATTAGCTCCCTGCTCCTGGGATGCTTCCCAAGCAGCCCAGGCCTCTAGCCTCCATGGCTGATGACCTCAGCTTT
CACACTGGTGAAGTCTGTGTACCCATACTGCAGCCCCATCCCATGGGGCCCCTGAAGACCCACTGAGGAATTCCGTAGGGTCTTGTTCCC
ACGACCGGAGTGCTGGCTCTCACAGTGAATTTTGATGCATTTAAAATAAGATTCTGATGCCAGACTGTTAAAACAGGCGCTGGTTCTGAA
GCACCGATGGAAACAGATTGATGCAGATGGAAGGAGGAAGGGAGACTGGGCCCACTGATTTCCAGCCCCACCATGTGTGCTGTTTTCAGA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_4834nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGA
GGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGG
AGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGG
TCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATG
CCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGG
ACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGC
TGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGG
TGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACT
TCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGC
GTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCG
TGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGT
GCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGG
AGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTG
CCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCA
CCCCACTTGCTGGCCGTGGCTTGGCAGAGAGGGCCTCCCAGCAGAGCTGAGAGGAGGGGGTGACCAGCTTGGAGTCTCTGGTGGGCAGAG
AGGGATGGGGTCCCTGAGCCAGGCCCCACCCATCACAGCATTCCCAGGTCCTGGTACCCAGCCCTCAGTTGTCATTTGGTTCAGAATCAG
TTCCCTTTCTCTGGGACCAAATTTCCCTTCTCTAAACATCCTACAGAGAAGGTTCCAAAGCTGAGCACCCATCACCCTAGGTGTGCACCA
GACTCCTATTAGCCCCTCCTTCCAGGAGCTAGAACCAGGGAGGTCCTGAGTGAGGAAGGCATGACCTCTGGGCTCTCTAGGTGGCCCTGG
TCTTGCCCCATCCATCCCACCTGCCACTACCTTGGGTGTCCTTACAGCTCTGCCCTGACCCCAGCCCCTGCCCCTGGACACCTGCTGACA
GCTCCCACACAGAACAGTCTGAGGTGATGCTGGCTACAGCCCTGGCAGCCCATGGCAACTCAAAGTGCCTTCCAAACCAAACTGCCCCTC
ATGAGGTTAGGGTCCCCCACCCTCCACCTGCCCAGAGGCCAACTCTGTTCCCTTCTCCTTTCATCCCAGAGGGGCCTCATCAGCAAAGAC
AGAAACTGATGTTCCATGCATGTCCCTGCTTCCAAAGCCTGACCTTCCAAAGCTTGCTTCCTTCCTCCTGGCTGCACAGACACCTCTGCT
TGGCCACAGCTTTGCTCTTTGGTCCTCAGGCCACCAGACCCCTCACAGCATGGCCCTTGGCTCTTCCTGCACTGCCCTCACCCTCAGCCG
TCCCAAGGAGTGCCCAGCACTACTCAGCATGTAGTCCAGGACCTGCGGCATCAGCATCCCCTGGGAGCTTCTTAGAAATGCAGACCTGTG
GGCTCTACCACAGGCCTCTGGAATCAGAATCTTCAGGGTGGGGCCCAGCAGTCTGTGTTTTAACAGGTTCTCCCGGTGATGCTGGTGCAT
GCTCAAGTTTGAGAACCGCTGCTCTCATAGACTGCTCCTCCAAGGGGAAGCAGTGTGGAACAGCAGAGAAAGTCCCGTCCCTATCTCTGA
CTGTGCAGTGAGTGTGGCCTAGGAACAGGTCCCTTCCTAAGCTCTAGTGTCCCCATCTGTAAAATGGGCTGATTGGCCTCCACGGTCAGA
GCGGCCATCTGGCTGTGCCATCCTGCATTTTTAGGAATGGAAAGCAGGCCTCTGAGGCAGTGGACAGGAAGACTTCTCATCCTTGAATTC
TAGCTCCCATTCCAAACTGTTAGTCCCCAACCTTGTGGTCACATCAGAGGTCAACAGCAGAACAGAGGCAGGTCAGGGTTGTCCGCTCTG
ATTAGCAGAACGACAGCCCCTTCCTCCTCCTCCCTCCTTCCCATCCCTACTCATTAGCTCCCTGCTCCTGGGATGCTTCCCAAGCAGCCC
AGGCCTCTAGCCTCCATGGCTGATGACCTCAGCTTTCACACTGGTGAAGTCTGTGTACCCATACTGCAGCCCCATCCCATGGGGCCCCTG
AAGACCCACTGAGGAATTCCGTAGGGTCTTGTTCCCACGACCGGAGTGCTGGCTCTCACAGTGAATTTTGATGCATTTAAAATAAGATTC
TGATGCCAGACTGTTAAAACAGGCGCTGGTTCTGAAGCACCGATGGAAACAGATTGATGCAGATGGAAGGAGGAAGGGAGACTGGGCCCA
CTGATTTCCAGCCCCACCATGTGTGCTGTTTTCAGATGTGATTGAGGGGTGTTCTGCCCTGCCTCCACTGTCACAGCCTTTAATAAAGAT
GTGAATCTTGAAAGCCTGATGCTCCAATCACAGACTCTGCTCAGCATCCCCAGAGGAACCACTGAGAAGCCTTTTGCCTGGATAGGAGGG
GGCTCTCCCAGGCATAGGCTTGTGGCCACTTGCCCAGCACAACTGTGTTTTGTGGGGCGTCTTTTAGGACTTAGCAGAGCTGAGAGCCCT
TTGTTGCTCAATGCTGTGAGCCTTAAGCATGTGAATCCCCCCACATGACAAGTGGGGAGACCCAGGGTAGGCTTTCCTTTGGATCATCTC
CAAATGGGAGTGCCATGTGGCAGGAAAGAAGCACCGATTTCAAGAATTACTTCCTAGAGAAAGTCAGGAACTAGAGACCAGAGTCTGCAG
GAACTTTGCCACTGCCCTTCACTGGCTAATCCTGTACTTCTCTCTGTGTTCCTTGAGTGACAGGTGGTAAAACCCTTAAAAAGGGAGGTG
TGGGAGGCCCAGGACTTTGGTAACAGGTGATGAATGTGTTGTCTTGGCCATCACAGGTGGAGCTTCAGTTAGTACCCGAGGGATTCCCCT
GGCACAAGCATTATAGGAATTAGTCCACCACTGGCGTGGGTGAGCAGCCAGGTAATGGGAATTGATCAGTGCCACCACCCTTGACCCCAA
CTACCATCCCAGATGCCCAGATTCCAGTCCTGGAGTTTTATTCTCTCAGCTTGATCCTTTGACCAAGAAGATCCAGTCCCAATATGTCAC
CTGTGCTTCATCTTTGGACTATATCTCAGGTGTTTACGTGTCAACTAATGGGAGCTTACTGGGTTAGAAGTCAGGACACTGAGTTTCAAT
CCTCACTTAGTAGTCTGTGGCCCTCTTTGGCACATTAACCTCCCTCCTTGATCCTCAGGCTGCACCTCTGGCAAATGGGAGAATGCGGCT
CCTTTTGACTTCAAGGGATCTTTGTGGGAACCAATGAGAAAATGTGTGTGAAGATAGCTTTTTGGTATATTTTAAAAGTGCACAAATTTA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_1694nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTCTCTTCCAGCCCTCAGTCTGAGG
TTCTGTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCC
CACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCAC
CAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATC
CGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_1593nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGGTAGGGAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGA
TGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGA
AGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCT
GAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_860nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGAGGAACGCGTTGTGGTGATCAGCAGCTCGGA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_3099nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCCCAGAAGTTCAGCCCA
GGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCCTGGGGAATTTTCCAG
TGAGGCATTGAGTCCCAAGCTGTGCTGAGGACAGTCTCCAAATGACAGCTGCATGCCTGGACCACCCCAGCCCTCCCACTACACCAGGGC
CAGGAGCTCTTCTGAAATGCTGATAGCATGTGTCCAGAGCCCTGTCTCTTTTCTGGAATGTCCAAGACCTTTGTCTGGAGCTTCCTTATG
CATTTTCTGTCCTCTAAGTCCTCAGTGAGGAGGGCTGGACAAGAATCCATTCCTTGGTTTATTACAGCCAGTGGGGGCCAGTGAAGGGGT
GTCAGGCCACAGGGCAGCTATATAGGGGCCAAACAAGTGAGGTTTGACTCCATCCATGTAGAAAGATATATAAATCCATTCCACAGTGAA
ACAGGTGGCCTCGTGGGTAGTGACCCTTCTGTCCCTAGAGGTTTATTACTAGAGGCTGGACTATCACCTGTCCAGGGGAAAAGGGGATCT
GAATAGAGTGAAAGGTTGGACTGGGTGGCCCCTGAGGTCTCTTCCAGCCCTCAGTCTGAGGTTCTGTATTGGAAAGTGCATGGAGCCCAT
GGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAG
AGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGA
TGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGC
CATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCAC
TCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGAT
ACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTC
CTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGA
CTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAG
GCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCC
CGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACG
AATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGC
CACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTT
CCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_2466nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGG
TTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCA
TCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCA
TCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCAC
CACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCG
CCGGGGAGGCAGGTAGGGAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGA
GACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGC
ACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGC
TGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCAT
CCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCC
TGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACG
AGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTC
CATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTC
TGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCC
CCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGG
CCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAAT
GAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCAC
CATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCA
TGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTGGCA

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_1441nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGA
GGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGG
AGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGG
TCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATG
CCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGG
ACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCT
ACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGG
CCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGGGCTCCTGGCGTGTCATTTGCTGGCTTGAATAAAGATGTCCGCCTT

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_1182nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGAGGAACGCGTTGTGGTGATCAGCAGCTCGGA
AGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCT
CAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTT
CTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCT
CTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGGGCTCCTGGCGTGTCATTTGCTGGCTTGAATAAAG

>In-frame_RARA_ENST00000394089_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_4017nt
GTGACTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCC
GAGCAGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACA
TGGCCCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAG
TGCCAGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGA
GACTGAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCAT
GCCCCGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCA
ACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTG
GACTCTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTAT
CCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGA
GGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGG
AGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGG
TCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGGTGGGTAGGGCAGTGGCCTGGGTGCTGCCCGCCA
GGGTCTGGGCGGTGCCCCTCTTCTGTATTTTGGCCCCATCCAGAAAGCCCAAAGCCAACAGGAGTCCCTTATTCCCACTGAATAAGATAG
GGAAAGTTCACAGTGTGCGTGGGGGTGAGAGTGGACACAGTTTACCATGTGTTTTGCCATGATTGAGGTGTGGGGAGCCTGACAGGCTAA
AATGCACAGTTCTATGAGTCCTTTCTCCCAAACACTACTGTGCCTTTGCACAGGGCAGGTCTCCACAAGAAGTTTGTTGGCTGATGCCTA
GCATACTCCCAGAGAGGGCTTGGGCATACCATAACAGGAAACTGGACTCCCCATGACCTTAACTCTGCTCTCTCAGTCTACACCCATCAT
TTCCCCAAGTGTTTCTGCAAAGGCCACCTACCTAAGTATCTCATTTGTCAGAGTTATCTTCTATGAACACTGCCAGGCAGGTAGTCAGTT
GGGCAGGAGTTGAGGTCAACCCAGAGGAATCTGGAACAAGAGAGTTCTAAGGATCTGCTTCACCCAGAGTACAGCTTTGTTCCTCATTCT
GACTGAGCCCTAGCCTTGGTCACACACTGAGCACTGACTGATATTCCTTACCCACAAATGCTATTGGTAATCGATGGGTTTTGATTAACT
AAATGAAGCGTCTTTTAACTCTAGACATCCCAGCTCATGGAGCTGAGAATGGGGACAGTGTGCTTCTTTAGGATTGCAGAAGGTTCCAGA
CCAGGTAGCAGTTGTCAGGCCTCCTGTACAGGGGGCAAATTCTGAATTCTGGGCAGATAACTTAATTGAATATTCATAGATAAGGCACAG
CAAGAAATTATGGAAACCCATTTGTGAATTACTCAAATCCAAATGCAAAGCAGAGTCACATTGGCACACACAGTGGCTGTTCCCGTCCCC
CTGCAGGGCATCCGTTTCCCCCAGCCGACTGGCCTGCAAGGATTCCCATAGGTGCACACCCACACCCCTCCCAGCATGCATCCTAGGCAG
TTCATAATGCATCTCCCCTTCCCCGTTTCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGT
GGCCCAGAAGTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTG
CGCCTGGGGAATTTTCCAGTGAGGCATTGAGTCCCAAGCTGTGCTGAGGACAGTCTCCAAATGACAGCTGCATGCCTGGACCACCCCAGC
CCTCCCACTACACCAGGGCCAGGAGCTCTTCTGAAATGCTGATAGCATGTGTCCAGAGCCCTGTCTCTTTTCTGGAATGTCCAAGACCTT
TGTCTGGAGCTTCCTTATGCATTTTCTGTCCTCTAAGTCCTCAGTGAGGAGGGCTGGACAAGAATCCATTCCTTGGTTTATTACAGCCAG
TGGGGGCCAGTGAAGGGGTGTCAGGCCACAGGGCAGCTATATAGGGGCCAAACAAGTGAGGTTTGACTCCATCCATGTAGAAAGATATAT
AAATCCATTCCACAGTGAAACAGGTGGCCTCGTGGGTAGTGACCCTTCTGTCCCTAGAGGTTTATTACTAGAGGCTGGACTATCACCTGT
CCAGGGGAAAAGGGGATCTGAATAGAGTGAAAGGTTGGACTGGGTGGCCCCTGAGGTCTCTTCCAGCCCTCAGTCTGAGGTTCTGTATTG
GAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGC
CAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTG
AGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGT
TGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCC
ATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCA
TCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACT
TTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAG
CAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCAC
CACCCTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCT
TGCAGCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTG
GTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAG
GCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCC
TGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395135_chr15_74317198_+_1580nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAG
TGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCT
GGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAA
GAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000395132_chr15_74317198_+_1163nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGC
ACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTT
CTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCT
TGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000268059_chr15_74317198_+_2454nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCC
ACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTC
CAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAG
CGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCA
TGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGG
GCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGGGCTGTGCG
ATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCA
GCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTC
CATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCCCCCCATCAGCCC
AGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGGCCCCTGAGCTGC
CTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAATGGCTATGC
ATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCT
CTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCC
CACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTGGCAGATGTGGCTGCT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000354026_chr15_74317198_+_2310nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAA
GTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCA
GCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTT
CCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGA
AAACTCGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTC
GCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGC
TGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCT
GTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCC
CCATGTGGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGG
CATCAGCCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAA
CTTTTTTGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGG
AGCAGGTGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCC
ACCACCCTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAAC
CTTGCAGCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCT
TGGTTAAGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTA
AGGCATGGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTC
CCTGGCCAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000268058_chr15_74317198_+_3933nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAG
TGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCT
GGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCAT
CCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCG
CCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATT
CCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGC
CCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTC
CCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCT
GCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCT
GAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTT
TGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCTTGGCAGAGAGGGCCTCCCA
GCAGAGCTGAGAGGAGGGGGTGACCAGCTTGGAGTCTCTGGTGGGCAGAGAGGGATGGGGTCCCTGAGCCAGGCCCCACCCATCACAGCA
TTCCCAGGTCCTGGTACCCAGCCCTCAGTTGTCATTTGGTTCAGAATCAGTTCCCTTTCTCTGGGACCAAATTTCCCTTCTCTAAACATC
CTACAGAGAAGGTTCCAAAGCTGAGCACCCATCACCCTAGGTGTGCACCAGACTCCTATTAGCCCCTCCTTCCAGGAGCTAGAACCAGGG
AGGTCCTGAGTGAGGAAGGCATGACCTCTGGGCTCTCTAGGTGGCCCTGGTCTTGCCCCATCCATCCCACCTGCCACTACCTTGGGTGTC
CTTACAGCTCTGCCCTGACCCCAGCCCCTGCCCCTGGACACCTGCTGACAGCTCCCACACAGAACAGTCTGAGGTGATGCTGGCTACAGC
CCTGGCAGCCCATGGCAACTCAAAGTGCCTTCCAAACCAAACTGCCCCTCATGAGGTTAGGGTCCCCCACCCTCCACCTGCCCAGAGGCC
AACTCTGTTCCCTTCTCCTTTCATCCCAGAGGGGCCTCATCAGCAAAGACAGAAACTGATGTTCCATGCATGTCCCTGCTTCCAAAGCCT
GACCTTCCAAAGCTTGCTTCCTTCCTCCTGGCTGCACAGACACCTCTGCTTGGCCACAGCTTTGCTCTTTGGTCCTCAGGCCACCAGACC
CCTCACAGCATGGCCCTTGGCTCTTCCTGCACTGCCCTCACCCTCAGCCGTCCCAAGGAGTGCCCAGCACTACTCAGCATGTAGTCCAGG
ACCTGCGGCATCAGCATCCCCTGGGAGCTTCTTAGAAATGCAGACCTGTGGGCTCTACCACAGGCCTCTGGAATCAGAATCTTCAGGGTG
GGGCCCAGCAGTCTGTGTTTTAACAGGTTCTCCCGGTGATGCTGGTGCATGCTCAAGTTTGAGAACCGCTGCTCTCATAGACTGCTCCTC
CAAGGGGAAGCAGTGTGGAACAGCAGAGAAAGTCCCGTCCCTATCTCTGACTGTGCAGTGAGTGTGGCCTAGGAACAGGTCCCTTCCTAA
GCTCTAGTGTCCCCATCTGTAAAATGGGCTGATTGGCCTCCACGGTCAGAGCGGCCATCTGGCTGTGCCATCCTGCATTTTTAGGAATGG
AAAGCAGGCCTCTGAGGCAGTGGACAGGAAGACTTCTCATCCTTGAATTCTAGCTCCCATTCCAAACTGTTAGTCCCCAACCTTGTGGTC
ACATCAGAGGTCAACAGCAGAACAGAGGCAGGTCAGGGTTGTCCGCTCTGATTAGCAGAACGACAGCCCCTTCCTCCTCCTCCCTCCTTC
CCATCCCTACTCATTAGCTCCCTGCTCCTGGGATGCTTCCCAAGCAGCCCAGGCCTCTAGCCTCCATGGCTGATGACCTCAGCTTTCACA
CTGGTGAAGTCTGTGTACCCATACTGCAGCCCCATCCCATGGGGCCCCTGAAGACCCACTGAGGAATTCCGTAGGGTCTTGTTCCCACGA
CCGGAGTGCTGGCTCTCACAGTGAATTTTGATGCATTTAAAATAAGATTCTGATGCCAGACTGTTAAAACAGGCGCTGGTTCTGAAGCAC
CGATGGAAACAGATTGATGCAGATGGAAGGAGGAAGGGAGACTGGGCCCACTGATTTCCAGCCCCACCATGTGTGCTGTTTTCAGATGTG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000565898_chr15_74317198_+_4830nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAA
GTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCA
GCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTT
CCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGA
AAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGA
GAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGC
TGCGGTGAACCGGGAAAGCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGTCCCTGGAGGTGGG
GCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCGCCGCCCTATCTTGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTT
CCGGGCCCTGGAGGACATTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCATCCGGGAGCGTGT
GCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGCCCAGACCTACCTGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCT
GGCCATGCGTGACCTGTGCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTAGCCTGCAGTGCTT
TGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCTGCCCCGGGCTGAGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCT
GCTGAGTGCACACCGCCGTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGTTGCCCCCTGCCCA
GCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTTTGAAGGCCTGTTGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCC
ACTTGCTGGCCGTGGCTTGGCAGAGAGGGCCTCCCAGCAGAGCTGAGAGGAGGGGGTGACCAGCTTGGAGTCTCTGGTGGGCAGAGAGGG
ATGGGGTCCCTGAGCCAGGCCCCACCCATCACAGCATTCCCAGGTCCTGGTACCCAGCCCTCAGTTGTCATTTGGTTCAGAATCAGTTCC
CTTTCTCTGGGACCAAATTTCCCTTCTCTAAACATCCTACAGAGAAGGTTCCAAAGCTGAGCACCCATCACCCTAGGTGTGCACCAGACT
CCTATTAGCCCCTCCTTCCAGGAGCTAGAACCAGGGAGGTCCTGAGTGAGGAAGGCATGACCTCTGGGCTCTCTAGGTGGCCCTGGTCTT
GCCCCATCCATCCCACCTGCCACTACCTTGGGTGTCCTTACAGCTCTGCCCTGACCCCAGCCCCTGCCCCTGGACACCTGCTGACAGCTC
CCACACAGAACAGTCTGAGGTGATGCTGGCTACAGCCCTGGCAGCCCATGGCAACTCAAAGTGCCTTCCAAACCAAACTGCCCCTCATGA
GGTTAGGGTCCCCCACCCTCCACCTGCCCAGAGGCCAACTCTGTTCCCTTCTCCTTTCATCCCAGAGGGGCCTCATCAGCAAAGACAGAA
ACTGATGTTCCATGCATGTCCCTGCTTCCAAAGCCTGACCTTCCAAAGCTTGCTTCCTTCCTCCTGGCTGCACAGACACCTCTGCTTGGC
CACAGCTTTGCTCTTTGGTCCTCAGGCCACCAGACCCCTCACAGCATGGCCCTTGGCTCTTCCTGCACTGCCCTCACCCTCAGCCGTCCC
AAGGAGTGCCCAGCACTACTCAGCATGTAGTCCAGGACCTGCGGCATCAGCATCCCCTGGGAGCTTCTTAGAAATGCAGACCTGTGGGCT
CTACCACAGGCCTCTGGAATCAGAATCTTCAGGGTGGGGCCCAGCAGTCTGTGTTTTAACAGGTTCTCCCGGTGATGCTGGTGCATGCTC
AAGTTTGAGAACCGCTGCTCTCATAGACTGCTCCTCCAAGGGGAAGCAGTGTGGAACAGCAGAGAAAGTCCCGTCCCTATCTCTGACTGT
GCAGTGAGTGTGGCCTAGGAACAGGTCCCTTCCTAAGCTCTAGTGTCCCCATCTGTAAAATGGGCTGATTGGCCTCCACGGTCAGAGCGG
CCATCTGGCTGTGCCATCCTGCATTTTTAGGAATGGAAAGCAGGCCTCTGAGGCAGTGGACAGGAAGACTTCTCATCCTTGAATTCTAGC
TCCCATTCCAAACTGTTAGTCCCCAACCTTGTGGTCACATCAGAGGTCAACAGCAGAACAGAGGCAGGTCAGGGTTGTCCGCTCTGATTA
GCAGAACGACAGCCCCTTCCTCCTCCTCCCTCCTTCCCATCCCTACTCATTAGCTCCCTGCTCCTGGGATGCTTCCCAAGCAGCCCAGGC
CTCTAGCCTCCATGGCTGATGACCTCAGCTTTCACACTGGTGAAGTCTGTGTACCCATACTGCAGCCCCATCCCATGGGGCCCCTGAAGA
CCCACTGAGGAATTCCGTAGGGTCTTGTTCCCACGACCGGAGTGCTGGCTCTCACAGTGAATTTTGATGCATTTAAAATAAGATTCTGAT
GCCAGACTGTTAAAACAGGCGCTGGTTCTGAAGCACCGATGGAAACAGATTGATGCAGATGGAAGGAGGAAGGGAGACTGGGCCCACTGA
TTTCCAGCCCCACCATGTGTGCTGTTTTCAGATGTGATTGAGGGGTGTTCTGCCCTGCCTCCACTGTCACAGCCTTTAATAAAGATGTGA
ATCTTGAAAGCCTGATGCTCCAATCACAGACTCTGCTCAGCATCCCCAGAGGAACCACTGAGAAGCCTTTTGCCTGGATAGGAGGGGGCT
CTCCCAGGCATAGGCTTGTGGCCACTTGCCCAGCACAACTGTGTTTTGTGGGGCGTCTTTTAGGACTTAGCAGAGCTGAGAGCCCTTTGT
TGCTCAATGCTGTGAGCCTTAAGCATGTGAATCCCCCCACATGACAAGTGGGGAGACCCAGGGTAGGCTTTCCTTTGGATCATCTCCAAA
TGGGAGTGCCATGTGGCAGGAAAGAAGCACCGATTTCAAGAATTACTTCCTAGAGAAAGTCAGGAACTAGAGACCAGAGTCTGCAGGAAC
TTTGCCACTGCCCTTCACTGGCTAATCCTGTACTTCTCTCTGTGTTCCTTGAGTGACAGGTGGTAAAACCCTTAAAAAGGGAGGTGTGGG
AGGCCCAGGACTTTGGTAACAGGTGATGAATGTGTTGTCTTGGCCATCACAGGTGGAGCTTCAGTTAGTACCCGAGGGATTCCCCTGGCA
CAAGCATTATAGGAATTAGTCCACCACTGGCGTGGGTGAGCAGCCAGGTAATGGGAATTGATCAGTGCCACCACCCTTGACCCCAACTAC
CATCCCAGATGCCCAGATTCCAGTCCTGGAGTTTTATTCTCTCAGCTTGATCCTTTGACCAAGAAGATCCAGTCCCAATATGTCACCTGT
GCTTCATCTTTGGACTATATCTCAGGTGTTTACGTGTCAACTAATGGGAGCTTACTGGGTTAGAAGTCAGGACACTGAGTTTCAATCCTC
ACTTAGTAGTCTGTGGCCCTCTTTGGCACATTAACCTCCCTCCTTGATCCTCAGGCTGCACCTCTGGCAAATGGGAGAATGCGGCTCCTT
TTGACTTCAAGGGATCTTTGTGGGAACCAATGAGAAAATGTGTGTGAAGATAGCTTTTTGGTATATTTTAAAAGTGCACAAATTTAAGAT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000569477_chr15_74317198_+_1690nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTCTCTTCCAGCCCTCAGTCTGAGGTTCT
GTATTGGAAAGTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACT
CCTCGCCAGTCCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGC
CCGCTGAGCAGGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCT
ACCTGTTGTACAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000569965_chr15_74317198_+_1589nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGGTAGGGAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGAC
AGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGAC
AGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGT
CCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000567543_chr15_74317198_+_856nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGAC

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000435786_chr15_74317198_+_3095nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCCCAGAAGTTCAGCCCAGGAC
TCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCCTGGGGAATTTTCCAGTGAG
GCATTGAGTCCCAAGCTGTGCTGAGGACAGTCTCCAAATGACAGCTGCATGCCTGGACCACCCCAGCCCTCCCACTACACCAGGGCCAGG
AGCTCTTCTGAAATGCTGATAGCATGTGTCCAGAGCCCTGTCTCTTTTCTGGAATGTCCAAGACCTTTGTCTGGAGCTTCCTTATGCATT
TTCTGTCCTCTAAGTCCTCAGTGAGGAGGGCTGGACAAGAATCCATTCCTTGGTTTATTACAGCCAGTGGGGGCCAGTGAAGGGGTGTCA
GGCCACAGGGCAGCTATATAGGGGCCAAACAAGTGAGGTTTGACTCCATCCATGTAGAAAGATATATAAATCCATTCCACAGTGAAACAG
GTGGCCTCGTGGGTAGTGACCCTTCTGTCCCTAGAGGTTTATTACTAGAGGCTGGACTATCACCTGTCCAGGGGAAAAGGGGATCTGAAT
AGAGTGAAAGGTTGGACTGGGTGGCCCCTGAGGTCTCTTCCAGCCCTCAGTCTGAGGTTCTGTATTGGAAAGTGCATGGAGCCCATGGAG
ACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCA
CAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCT
GAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATC
CGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCT
GCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGA
GGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCC
ATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCT
GTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCCC
CCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGGC
CCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATG
AATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACC
ATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCAT
GCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTGGCAG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000436891_chr15_74317198_+_2462nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCA
GGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAA
AGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAA
GATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACC
CCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGG
GGAGGCAGGTAGGGAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTGCATGGAGCCCATGGAGACC
GCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGTCCAGTCTCTGCTGAGAGCACAA
GGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCAGGCTGCCACCCCCGATGCTGAG
CCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTACAGAGCACAGAGAGCCATCCGC
CTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGTGGTCCAAGCCAGCACTCCTGCC
ATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAGCCCACCCCACCGGATACGAGGG
GCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTTTGCCCTCCCCTTCTCCTCCATG
GCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGGTGTTCCCCCTGGGGACTCTGTC
AGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACCCTGTGCCCCAGAAAGGCCCCCC
ATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCAGCCAACACCCCTGCCCGGCCCC
TGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTAAGGAATGAATCAACGAATGAAT
GGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCATGGCTGAGATTCAAGCCACCATT
CCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGCCAATAGCACAGCCTTCCATGCC
CCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGGCTATCCCAAGACCTGGCAGATG

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000564428_chr15_74317198_+_1437nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAA
GTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCA
GCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTT
CCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGA
AAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGGGTCCTGGACGA
GAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCCTGGGGCTACCC
CCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGAGCTCTGGCCAA

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000359928_chr15_74317198_+_1178nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGAC
TCAGATGCCGAAAACTCGTCCTCCCGAGAGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCAGG
GTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTGACCTCAAGATTGACAATGAAAGTGGGTTCTCC
TGGGGCTACCCCCACCCCTTTCTAATTTAGTCTCTGAGTCCCAAAAAGAAGTGCAGGCAGAGCCATCTGCCAGGCCCAGGAGAGCTCTGA
GCTCTGGCCAACAACTGCAGCCAGGCTGGGCAGAGCACTCCGGCTCACCTGGGCTCCTGGCGTGTCATTTGCTGGCTTGAATAAAGATGT

>In-frame_RARA_ENST00000425707_chr17_38487648_+_PML_ENST00000563500_chr15_74317198_+_4013nt
CTCGCTATGGCCGCTGCCATCGCCCCGCGCCCCTGAGCCGCGGCCCCCTGGACGGCTCCTCTCCCGGGACCCCGCACCCTGATGCCGAGC
AGCACCAGGGCGCCGGGTTAGGGCAGACGCTGTGCTCGCTGGCACCCCGAACGGGTTGCTTCCCCCGCTGCGAGCATCACAGGACATGGC
CCCCTCAGCCACCTAGCTGGGGCCCATCTAGGAGTGGCATCTTTTTTGGTGCCCTGAAGGCCAGCTCTGGACCTTCCCAGGAAAAGTGCC
AGCTCACAGAACTGCTTGACCAAAGGACCGGCTCTTGAGACATCCCCCAACCCACCTGGCCCCCAGCTAGGGTGGGGGCTCCAGGAGACT
GAGATTAGCCTGCCCTCTTTGGACAGCAGCTCCAGGACAGGGCGGGTGGGCTGACCACCCAAACCCCATCTGGGCCCAGGCCCCATGCCC
CGAGGAGGGGTGGTCTGAAGCCCACCAGAGCCCCCTGCCAGACTGTCTGCCTCCCTTCTGACTGTGGCCGCTTGGCATGGCCAGCAACAG
CAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCGGTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACT
CTCCCCGCCAGGCGCTCTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCAATGCAGCTGTATCCAA
GAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGGATGTCTCCAATACAACGACAGCCCAGAAGAGGAA
GTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCA
GCCCAGGCCCAGCACCTCCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGTCTT
CCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGGTGGGTAGGGCAGTGGCCTGGGTGCTGCCCGCCAGGGT
CTGGGCGGTGCCCCTCTTCTGTATTTTGGCCCCATCCAGAAAGCCCAAAGCCAACAGGAGTCCCTTATTCCCACTGAATAAGATAGGGAA
AGTTCACAGTGTGCGTGGGGGTGAGAGTGGACACAGTTTACCATGTGTTTTGCCATGATTGAGGTGTGGGGAGCCTGACAGGCTAAAATG
CACAGTTCTATGAGTCCTTTCTCCCAAACACTACTGTGCCTTTGCACAGGGCAGGTCTCCACAAGAAGTTTGTTGGCTGATGCCTAGCAT
ACTCCCAGAGAGGGCTTGGGCATACCATAACAGGAAACTGGACTCCCCATGACCTTAACTCTGCTCTCTCAGTCTACACCCATCATTTCC
CCAAGTGTTTCTGCAAAGGCCACCTACCTAAGTATCTCATTTGTCAGAGTTATCTTCTATGAACACTGCCAGGCAGGTAGTCAGTTGGGC
AGGAGTTGAGGTCAACCCAGAGGAATCTGGAACAAGAGAGTTCTAAGGATCTGCTTCACCCAGAGTACAGCTTTGTTCCTCATTCTGACT
GAGCCCTAGCCTTGGTCACACACTGAGCACTGACTGATATTCCTTACCCACAAATGCTATTGGTAATCGATGGGTTTTGATTAACTAAAT
GAAGCGTCTTTTAACTCTAGACATCCCAGCTCATGGAGCTGAGAATGGGGACAGTGTGCTTCTTTAGGATTGCAGAAGGTTCCAGACCAG
GTAGCAGTTGTCAGGCCTCCTGTACAGGGGGCAAATTCTGAATTCTGGGCAGATAACTTAATTGAATATTCATAGATAAGGCACAGCAAG
AAATTATGGAAACCCATTTGTGAATTACTCAAATCCAAATGCAAAGCAGAGTCACATTGGCACACACAGTGGCTGTTCCCGTCCCCCTGC
AGGGCATCCGTTTCCCCCAGCCGACTGGCCTGCAAGGATTCCCATAGGTGCACACCCACACCCCTCCCAGCATGCATCCTAGGCAGTTCA
TAATGCATCTCCCCTTCCCCGTTTCAGAGGAACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGGTGAGTGGCC
CAGAAGTTCAGCCCAGGACTCCTGCCTCCCCCCATTTCAGGTCCCAGGGGGCACAGCCACAGCAGGTGACTCTCAGACTTGCCTTGCGCC
TGGGGAATTTTCCAGTGAGGCATTGAGTCCCAAGCTGTGCTGAGGACAGTCTCCAAATGACAGCTGCATGCCTGGACCACCCCAGCCCTC
CCACTACACCAGGGCCAGGAGCTCTTCTGAAATGCTGATAGCATGTGTCCAGAGCCCTGTCTCTTTTCTGGAATGTCCAAGACCTTTGTC
TGGAGCTTCCTTATGCATTTTCTGTCCTCTAAGTCCTCAGTGAGGAGGGCTGGACAAGAATCCATTCCTTGGTTTATTACAGCCAGTGGG
GGCCAGTGAAGGGGTGTCAGGCCACAGGGCAGCTATATAGGGGCCAAACAAGTGAGGTTTGACTCCATCCATGTAGAAAGATATATAAAT
CCATTCCACAGTGAAACAGGTGGCCTCGTGGGTAGTGACCCTTCTGTCCCTAGAGGTTTATTACTAGAGGCTGGACTATCACCTGTCCAG
GGGAAAAGGGGATCTGAATAGAGTGAAAGGTTGGACTGGGTGGCCCCTGAGGTCTCTTCCAGCCCTCAGTCTGAGGTTCTGTATTGGAAA
GTGCATGGAGCCCATGGAGACCGCCGAGCCACAGTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGCCCACTCCTCGCCAGT
CCAGTCTCTGCTGAGAGCACAAGGAGCCTCCAGCCTGCCCTGTGGCACATACCACCCCCCAGCTTGGCCTCCCCACCAGCCCGCTGAGCA
GGCTGCCACCCCCGATGCTGAGCCTCACAGCGAGCCTCCTGATCACCAGGAGCGCCCTGCCGTCCACCGTGGGATCCGCTACCTGTTGTA
CAGAGCACAGAGAGCCATCCGCCTTCGCCATGCCCTCCGCTTGCACCCTCAATTGCATCGGGCCCCTATTCGGACTTGGTCTCCCCATGT
GGTCCAAGCCAGCACTCCTGCCATCACAGGGCCCCTCAACCATCCTGCCAATGCCCAGGAACATCCTGCCCAGCTGCAAAGGGGCATCAG
CCCACCCCACCGGATACGAGGGGCTGTGCGATCCCGCAGCCGCTCCCTCCGGGGCTCCTCCCATTTATCCCAGTGGCTCAACAACTTTTT
TGCCCTCCCCTTCTCCTCCATGGCTTCCCAGCTTGACATGTCTTCCGTGGTGGGGGCAGGGGAAAGCAGAGCCCAGACTCTTGGAGCAGG
TGTTCCCCCTGGGGACTCTGTCAGAGGCTCCATGGAGGCCTCTCAAGTCCAAGTGCCTCTGGAAGCCTCTCCAATTACATTCCCACCACC
CTGTGCCCCAGAAAGGCCCCCCATCAGCCCAGTCCCAGGCGCCCGTCAAGCAGGCCTCTGAGAGTGCTACCCTTCTCTTGTAACCTTGCA
GCCAACACCCCTGCCCGGCCCCTGAGCTGCCTCCTCCAGCCCATGCTCTTACAGGCCCTGCACAGAGTAGCACTCATTAATTCTTGGTTA
AGGAATGAATCAACGAATGAATGGCTATGCATGGACCTCTGGGCAGGGAGACCTGGGTCTTCTCTGGCTGAGAGGGGAAGGCTAAGGCAT
GGCTGAGATTCAAGCCACCATTCCAGGCCTCTTTGCCCAAGAAAGAAACTTCTGTCACCCTTGCACTCTCCTGTATTCTGAGTCCCTGGC
CAATAGCACAGCCTTCCATGCCCCGACCCCCACCCCAAGCCTCTCCACTAGGCCTCTGCCAGGATCTAAGCCCATGAGCACAGGGACTGG


Top

FusionGenePPI for RARA_PML


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RARANRBF2, ZBTB16, MECR, RXRG, RXRB, NCOA6, GADD45G, GADD45A, NRIP1, KAT2B, HDAC3, HDAC4, TDG, PML, TRIP4, KDM5A, RXRA, POU2F1, NCOR2, NR0B2, BAG1, TADA3, NCOR1, NKX2-1, TRIM24, IRX4, SP1, NPAS2, CLOCK, ARNTL, NR2E3, CCND3, NCOA2, SRC, AJUBA, LIMD1, WTIP, SKI, HR, PIN1, SUV39H1, PSMC5, EP300, PARP1, MED6, TOP2B, SAP130, HNRNPU, RFC4, NPM1, MRTO4, SNRNP40, MED1, NCOA1, HMGA1, RUVBL1, RUNX1, SIAH1, RARA, HDAC2, NCOA3, CREBBP, LRIF1, KLF5, SMARCD3, ARID1A, SPI1, PRDX6, NR1H2, ITGB1BP2, MED25, MAPK6, FOXO1, MAPK1, TRIM32, PHF8, TNIP1, HACE1, SQSTM1, UBQLN1, ARID5A, UBE3A, PRAM1, FAS, PRAME, TBL1XR1, SUZ12, EZH2, USP7, TMEM54, MMS19, AKT1, FN1, WWOX, E2F1, MBD3, MTA2, CBX5, CEBPA, HDAC1, NSD1, TEKT4, SNW1, SIRT1, ACTN4, SRF, MDM2, ZNF131, RARG, RARB, TRIM25PMLGATA2, TDG, CHFR, DAXX, SMAD3, SMAD2, ZFYVE9, MAPK11, MDM2, RPL11, MYB, ANKRD2, TP53, TRIM69, TOPBP1, CCNT1, SRF, CREBBP, SUMO1, NCOR2, SIN3A, NCOR1, HDAC1, SKI, HDAC3, HDAC2, PML, RARA, RXRA, TRIM24, RB1, EIF4E, RELA, HHEX, NR4A1, STAT3, JUN, FOS, ATF2, UBE2I, BCL6, ZBTB16, SP1, ARNT, TRIM27, PLAGL1, UBE2U, NR2C1, KAT5, SATB1, TERT, NR3C1, POLR2E, PPARG, MED7, PCBD2, CHD4, SAP25, ZNF506, FOXO1, HDAC7, TOP2B, SAP130, HNRNPU, RFC4, NPM1, MRTO4, SNRNP40, RUNX1, SIAH1, SF1, SMARCA4, KLHL20, SPI1, BANP, UBE3A, TGIF1, SP100, PIAS2, SUMO2, SUMO3, AXIN1, MAGEA2, RNF4, SETDB1, PSME3, H2AFX, ATXN3, PIAS1, CSNK2A1, MAF, TERF2IP, ARIH2, USP7, CSNK2B, YAP1, CTNNB1, RANBP2, RBCK1, MAP2K4, FBXO3, CUL1, SKP1, RBX1, PIN1, UHRF1, HIPK2, TOPORS, IKBKE, ZMYM2, SLC1A2, WRN, IER3, RAD51, CHEK2, SYNE2, MAPK3, MAPK1, SIAH2, MYC, ARID3A, RUNX3, RUNX2, PKM, CSNK2A3, PLCG1, ELF4, BCL2, AURKA, SIRT1, TP63, NFATC1, FAS, MTOR, CSNK1D, EZH2, SUZ12, ECT2, MAPK7, CDK1, CDK2, CDK6, RNF111, LMNA, HDAC6, HDAC11, RNF125, KAT6A, PSMA3, CASP8AP2, ADH1B, NFKB1, PLSCR1, SH3GL1, GLIS2, JAK1, ATF7IP, ATXN1, HTT, EHMT2, ATRX, H3F3A, HIRA, ASF1A, NCOA2, EGFR, RPL5, RBL2, E2F4, TBX3, TBX2, PYCARD, SKIL, SENP1, SNX11, RFPL4B, FHL3, ACOT8, PER2, NTRK1, TCF7L2, IFI16, PARK7, DNM2, KRAS, CASC5, FIP1L1, DSN1, SQSTM1, PLOD3, HOMER3, ATP5J2, TOMM20, HMGXB4, WDR5, INTS7, TCTN3, UQCRQ, TBC1D14, COLGALT1, SFXN3, DPH7, C1QTNF6, NANP, EME1, GOLGA6A, TIMM23, MAP1LC3B, GATA1, STAT1, STAT2, NACC1, PPARGC1A, NR1I3, CDKN2A, USP11, NF1, TUBA3C, GOPC, TULP3, KLHL40, NDUFS1, TRIML2, WDR45B, NDUFA2, RNF123, PADI3, ARHGEF16, CDH19, SPTA1, TRIM25, TRIM22, CIITA, CACUL1, PCBP1, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgenePMLchr17:38487648chr15:74317198ENST00000268058+29448_555394883PER2
TgenePMLchr17:38487648chr15:74317198ENST00000268059+28448_555394830PER2
TgenePMLchr17:38487648chr15:74317198ENST00000354026+27448_555394782PER2
TgenePMLchr17:38487648chr15:74317198ENST00000359928+26448_555394474PER2
TgenePMLchr17:38487648chr15:74317198ENST00000395132+25448_555394436PER2
TgenePMLchr17:38487648chr15:74317198ENST00000395135+28448_555394634PER2
TgenePMLchr17:38487648chr15:74317198ENST00000435786+27448_555394612PER2
TgenePMLchr17:38487648chr15:74317198ENST00000436891+28448_555394902PER2
TgenePMLchr17:38487648chr15:74317198ENST00000564428+27448_555394586PER2
TgenePMLchr17:38487648chr15:74317198ENST00000565898+28448_555394835PER2
TgenePMLchr17:38487648chr15:74317198ENST00000567543+25448_555394424PER2
TgenePMLchr17:38487648chr15:74317198ENST00000569477+28448_555394642PER2
TgenePMLchr17:38487648chr15:74317198ENST00000569965+28448_555394608PER2
TgenePMLchr17:38487648chr15:74326819ENST00000359928+36448_555418474PER2
TgenePMLchr17:38487648chr15:74326819ENST00000395132+05448_555-32436PER2
TgenePMLchr17:38487648chr15:74326819ENST00000567543+35448_555418424PER2


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgenePMLchr17:38487648chr15:74326819ENST00000268058+59448_555552883PER2
TgenePMLchr17:38487648chr15:74326819ENST00000268059+58448_555552830PER2
TgenePMLchr17:38487648chr15:74326819ENST00000354026+47448_555504782PER2
TgenePMLchr17:38487648chr15:74326819ENST00000395135+58448_555552634PER2
TgenePMLchr17:38487648chr15:74326819ENST00000435786+57448_555552612PER2
TgenePMLchr17:38487648chr15:74326819ENST00000436891+58448_555555902PER2
TgenePMLchr17:38487648chr15:74326819ENST00000564428+47448_555504586PER2
TgenePMLchr17:38487648chr15:74326819ENST00000565898+48448_555504835PER2
TgenePMLchr17:38487648chr15:74326819ENST00000569477+58448_555552642PER2
TgenePMLchr17:38487648chr15:74326819ENST00000569965+58448_555555608PER2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RARA_PML


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneRARAP10276DB00210AdapaleneRetinoic acid receptor alphasmall moleculeapproved
HgeneRARAP10276DB00459AcitretinRetinoic acid receptor alphasmall moleculeapproved
HgeneRARAP10276DB00982IsotretinoinRetinoic acid receptor alphasmall moleculeapproved
HgeneRARAP10276DB00523AlitretinoinRetinoic acid receptor alphasmall moleculeapproved|investigational
HgeneRARAP10276DB00799TazaroteneRetinoic acid receptor alphasmall moleculeapproved|investigational
HgeneRARAP10276DB00755TretinoinRetinoic acid receptor alphasmall moleculeapproved|investigational|nutraceutical
TgenePMLP29590DB01169Arsenic trioxideProtein PMLsmall moleculeapproved|investigational

Top

RelatedDiseases for RARA_PML


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRARAC0023487Acute Promyelocytic Leukemia22CTD_human;HPO;ORPHANET
HgeneRARAC0036341Schizophrenia3PSYGENET
HgeneRARAC0005586Bipolar Disorder1PSYGENET
HgeneRARAC0010701Phyllodes Tumor1CTD_human
HgeneRARAC0085183Neoplasms, Second Primary1CTD_human
HgeneRARAC0149940Sciatic Neuropathy1CTD_human
HgeneRARAC0206650Fibroadenoma1CTD_human
HgeneRARAC0525045Mood Disorders1PSYGENET
HgeneRARAC1458155Mammary Neoplasms1CTD_human
HgeneRARAC2239176Liver carcinoma1CTD_human
TgenePMLC0023487Acute Promyelocytic Leukemia20CTD_human;ORPHANET
TgenePMLC0017636Glioblastoma1CTD_human
TgenePMLC0023904Liver Neoplasms, Experimental1CTD_human
TgenePMLC0029401Osteitis Deformans1CTD_human
TgenePMLC0036341Schizophrenia1CTD_human
TgenePMLC0038325Stevens-Johnson Syndrome1CTD_human
TgenePMLC0085183Neoplasms, Second Primary1CTD_human