FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30438

FusionGeneSummary for RAPGEF5_BAALC

check button Fusion gene summary
Fusion gene informationFusion gene name: RAPGEF5_BAALC
Fusion gene ID: 30438
HgeneTgene
Gene symbol

RAPGEF5

BAALC

Gene ID

9771

79870

Gene nameRap guanine nucleotide exchange factor 5BAALC, MAP3K1 and KLF4 binding
SynonymsGFR|MR-GEF|REPAC-
Cytomap

7p15.3

8q22.3

Type of geneprotein-codingprotein-coding
Descriptionrap guanine nucleotide exchange factor 5M-Ras-regulated GEFM-Ras-regulated Rap GEFRap guanine nucleotide exchange factor (GEF) 5guanine nucleotide exchange factor for Rap1related to Epacbrain and acute leukemia cytoplasmic proteinBAALC, MEKK1 and KLF4 bindingbrain and acute leukemia, cytoplasmic
Modification date2018051920180519
UniProtAcc

Q92565

Q8WXS3

Ensembl transtripts involved in fusion geneENST00000344041, ENST00000475788, 
ENST00000405243, ENST00000401957, 
ENST00000309982, ENST00000438105, 
ENST00000297574, ENST00000330955, 
ENST00000306391, ENST00000523754, 
Fusion gene scores* DoF score11 X 11 X 6=7266 X 2 X 5=60
# samples 117
** MAII scorelog2(11/726*10)=-2.72246602447109
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/60*10)=0.222392421336448
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RAPGEF5 [Title/Abstract] AND BAALC [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A3M1-01ARAPGEF5chr7

22306583

-BAALCchr8

104225147

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000344041ENST00000309982RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5CDS-intronENST00000344041ENST00000438105RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5CDS-intronENST00000344041ENST00000297574RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5CDS-intronENST00000344041ENST00000330955RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5CDS-intronENST00000344041ENST00000306391RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5CDS-intronENST00000344041ENST00000523754RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5UTR-3CDSENST00000475788ENST00000309982RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5UTR-intronENST00000475788ENST00000438105RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5UTR-intronENST00000475788ENST00000297574RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5UTR-intronENST00000475788ENST00000330955RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5UTR-intronENST00000475788ENST00000306391RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5UTR-intronENST00000475788ENST00000523754RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
In-frameENST00000405243ENST00000309982RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5CDS-intronENST00000405243ENST00000438105RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5CDS-intronENST00000405243ENST00000297574RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5CDS-intronENST00000405243ENST00000330955RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5CDS-intronENST00000405243ENST00000306391RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
5CDS-intronENST00000405243ENST00000523754RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
intron-3CDSENST00000401957ENST00000309982RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
intron-intronENST00000401957ENST00000438105RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
intron-intronENST00000401957ENST00000297574RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
intron-intronENST00000401957ENST00000330955RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
intron-intronENST00000401957ENST00000306391RAPGEF5chr7

22306583

-BAALCchr8

104225147

+
intron-intronENST00000401957ENST00000523754RAPGEF5chr7

22306583

-BAALCchr8

104225147

+

Top

FusionProtFeatures for RAPGEF5_BAALC


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RAPGEF5

Q92565

BAALC

Q8WXS3

Guanine nucleotide exchange factor (GEF) for RAP1A,RAP2A and MRAS/M-Ras-GTP. Its association with MRAS inhibits Rap1activation. {ECO:0000269|PubMed:10777494,ECO:0000269|PubMed:10934204}. May play a synaptic role at the postsynaptic lipid raftspossibly through interaction with CAMK2A.{ECO:0000250|UniProtKB:Q920K5}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRAPGEF5chr7:22306583chr8:104225147ENST00000401957-116345_579-83581DomainRas-GEF
HgeneRAPGEF5chr7:22306583chr8:104225147ENST00000401957-11668_201-83581DomainN-terminal Ras-GEF


Top

FusionGeneSequence for RAPGEF5_BAALC


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RAPGEF5_ENST00000344041_chr7_22306583_-_BAALC_ENST00000309982_chr8_104225147_+_205aa
MAIGVWQLLLDMGIMLSVDQHLYFQDTTVFYQFSSDECSYLYCEFEREEEWQNGVKLLLQLVPLIPARGGICELSHQKIEDSEESSDEIL
VRLTSAVQRELAAVIALKARKSGMLEDGLPSNGVPRSTAPGGIPNPEKKTNCETQCPNPQSLSSGPLTQKQNGLQTTEAKRDAKRMPAKE

>In-frame_RAPGEF5_ENST00000405243_chr7_22306583_-_BAALC_ENST00000309982_chr8_104225147_+_358aa
MRMAVGSVKMQPPCESPALAAAAAVVAADGPLRRSPSAREPEREQPPASLRPRLRDLPALLRSGLTLRRKRSAAGGRTLSRRISNPYLEH
TPSQITGENSSCAGRALRNIIIVQAADLIKDRVNLKGFYRRSCVGSELVDWLLEHCPFVQCRSMAIGVWQLLLDMGIMLSVDQHLYFQDT
TVFYQFSSDECSYLYCEFEREEEWQNGVKLLLQLVPLIPARGGICELSHQKIEDSEESSDEILVRLTSAVQRELAAVIALKARKSGMLED


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RAPGEF5_ENST00000344041_chr7_22306583_-_BAALC_ENST00000309982_chr8_104225147_+_615nt
ATGGCCATAGGAGTCTGGCAACTCCTACTGGACATGGGAATTATGTTATCAGTGGACCAGCATCTATACTTTCAAGATACTTATGTTTTC
TACCAGTTTTCCTCTGATGAATGTAGCTACTTGTACTGTGAATTTGAAAGAGAAGAAGAATGGCAAAATGGTGTCAAGCTTTTACTGCAA
CTTGTGCCTCTCATTCCTGCCAGAGGTGGCATCTGTGAACTGTCTCATCAGAAAATTGAAGACTCCGAAGAAAGCAGTGATGAAATTCTT
GTGCGTCTAACATCTGCGGTGCAGAGAGAGCTAGCAGCTGTTATTGCTTTGAAAGCAAGGAAGTCTGGCATGCTGGAAGATGGACTGCCC
TCCAATGGTGTGCCCCGATCTACAGCCCCAGGTGGAATACCCAACCCAGAGAAGAAGACGAACTGTGAGACCCAGTGCCCAAATCCCCAG
AGCCTCAGCTCAGGCCCTCTGACCCAGAAACAGAATGGCCTTCAGACCACAGAGGCTAAAAGAGATGCTAAGAGAATGCCTGCAAAAGAA

>In-frame_RAPGEF5_ENST00000405243_chr7_22306583_-_BAALC_ENST00000309982_chr8_104225147_+_1074nt
ATGAGGATGGCCGTGGGCTCCGTCAAGATGCAGCCGCCGTGCGAGAGCCCGGCCCTGGCCGCCGCGGCGGCGGTGGTGGCGGCAGACGGC
CCCCTGCGCCGCAGCCCCAGCGCCCGGGAGCCCGAGCGCGAGCAGCCGCCGGCGTCGCTGCGGCCGCGGCTGAGGGACCTGCCCGCGCTG
CTGCGGAGCGGGCTCACGCTGCGGAGGAAGCGGAGCGCCGCTGGGGGCCGGACTCTATCAAGAAGAATATCTAATCCGTACCTTGAACAT
ACGCCTTCCCAGATTTATGGAGAGAATTCTTCTTGTGCAGGAAGAGCATTGAGGAATATTATTATCGTTCAAGCAGCTGACCTGATAAAG
GACAGAGTGAACCTCAAGGGGTTTTACAGGAGGAGCTGCGTTGGGTCAGAGCTGGTAGACTGGCTTCTAGAACACTGTCCTTTCGTCCAG
TGCAGATCTATGGCCATAGGAGTCTGGCAACTCCTACTGGACATGGGAATTATGTTATCAGTGGACCAGCATCTATACTTTCAAGATACT
TATGTTTTCTACCAGTTTTCCTCTGATGAATGTAGCTACTTGTACTGTGAATTTGAAAGAGAAGAAGAATGGCAAAATGGTGTCAAGCTT
TTACTGCAACTTGTGCCTCTCATTCCTGCCAGAGGTGGCATCTGTGAACTGTCTCATCAGAAAATTGAAGACTCCGAAGAAAGCAGTGAT
GAAATTCTTGTGCGTCTAACATCTGCGGTGCAGAGAGAGCTAGCAGCTGTTATTGCTTTGAAAGCAAGGAAGTCTGGCATGCTGGAAGAT
GGACTGCCCTCCAATGGTGTGCCCCGATCTACAGCCCCAGGTGGAATACCCAACCCAGAGAAGAAGACGAACTGTGAGACCCAGTGCCCA
AATCCCCAGAGCCTCAGCTCAGGCCCTCTGACCCAGAAACAGAATGGCCTTCAGACCACAGAGGCTAAAAGAGATGCTAAGAGAATGCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_RAPGEF5_ENST00000344041_chr7_22306583_-_BAALC_ENST00000309982_chr8_104225147_+_3133nt
GCTGCGGCCGCGGCTGAGGGACCTGCCCGCGCTGCTGCGGAGCGGGCTCACGCTGCGGAGGAAGCGGAGCGCCGCTGGGGGCCGGACTCT
ATCAAGAAGAATATCTAATCCGTACCTTGAACATACGCCTTCCCAGATTTATGGAGAGAATTCTTCTTGTGCAGGAAGAGCATTGAGGAA
TATTATTATCGTTCAAGCAGCTGACCTGATAAAGGACAGAGTGAACCTCAAGGGGTTTTACAGGAGGAGCTGCGTTGGGTCAGAGCTGGT
AGACTGGCTTCTAGAACACTGTCCTTTCGTCCAGTGCAGATCTATGGCCATAGGAGTCTGGCAACTCCTACTGGACATGGGAATTATGTT
ATCAGTGGACCAGCATCTATACTTTCAAGATACTTATGTTTTCTACCAGTTTTCCTCTGATGAATGTAGCTACTTGTACTGTGAATTTGA
AAGAGAAGAAGAATGGCAAAATGGTGTCAAGCTTTTACTGCAACTTGTGCCTCTCATTCCTGCCAGAGGTGGCATCTGTGAACTGTCTCA
TCAGAAAATTGAAGACTCCGAAGAAAGCAGTGATGAAATTCTTGTGCGTCTAACATCTGCGGTGCAGAGAGAGCTAGCAGCTGTTATTGC
TTTGAAAGCAAGGAAGTCTGGCATGCTGGAAGATGGACTGCCCTCCAATGGTGTGCCCCGATCTACAGCCCCAGGTGGAATACCCAACCC
AGAGAAGAAGACGAACTGTGAGACCCAGTGCCCAAATCCCCAGAGCCTCAGCTCAGGCCCTCTGACCCAGAAACAGAATGGCCTTCAGAC
CACAGAGGCTAAAAGAGATGCTAAGAGAATGCCTGCAAAAGAAGTCACCATTAATGTAACAGATAGCATCCAACAGATGGACAGAAGTCG
AAGAATCACAAAGAACTGTGTCAACTAGCAGAGAGTCCAAGCAGAAGGGCAGATGGACTTCTTCAGTGTCCTTCACGGCACTGGATCCCA
TCAAAGAACCTTGAAGAAGTGGCTGCCCCTTGCTGGACCTGAATTCTACTGAGTCCCTGGCAAGACTGTCTTACCTGGCAGCAAACTGCT
GCCTGATTTGTTGGGACCTTCTGAGCCTTCTACTTATCATGTAAATGTATTGGCACAGTGCTTACATATGTTAATAAACTGCAAATGTGC
AGTTCAGTTTGTCTCTTTGCAACTCCTGTAATACGGTCTGGTGTAAAAGTAGTGAGTTAAAGCTACAGGTCAGTTTATGAAACAGAAAAG
TAGGAATGCATTTTCTGGGTGAAAGAGTCACACCTTAGTGCTATAACTCTCCTGCCCATGATAGTGTATTCTGTTTCAGGCAAGCTTATT
CTTTCCTTCTTTCATTTTAAATATTGTCATTACAAATCTTACCAGGTTCACTTAAAAGCTGGCTTTCATCCAACTCTAAACCCACATATT
GAAAAAATCAAGGTACAGGAAAACTCCTTGTTATCCTTGTTTCCTTAGCTTGGTATGAGACAGATCGGATCCAGTTTCCCATGCACCAAC
CCACTGCCCATGGCATGTCTTTGGGAGGTGTCTGTGAAGCAGTCATACCTGCTCCTCATCTGCCTGGAAAGTCCTCCTATTCCAGTGTCC
ATGTTGGCCTCCAGTCCTTAATGTCACCATGCTTGTGGCCAATGCATCCAAATAAGGATACCCCTCAGGGCTCAGCTAGACATTGCAATT
TTGCATAGCTTTCCAGTTCCCTTTGCTTGTCTTCTTGACTGTCTTCCCTCTCTATCGGGGTCACTTGCAATTGTTAATCAAAGATTGAAC
ACTGCGTAGGAGAGGGAGATGATCCAGAGACATGTGGCAGCAGGCATGGCTTCCCCTTGGCCTCTCTGTACACTGCCCCAGGACTGTCAT
TTTGGCATCTGCAAAGGAATCACTTTAGAAAGCCAGCACCTGGTTGATGTGTATTCATACTGACATTAGATTGATGTGCACTGCATTAGA
AATGAGGTAGCTGACACAGAAAAAGGATGTTTTGATAGGAATAATTTTCTAGTATGTCTTGAAACATGTTCATCTGGAAGTATTTTCCTC
CAAAGTAATGTAGCATGATTTTTCAAGGATTGTTAACATGCCTGGGATTGGGAAAGATAGGACTAAAGTTGTGCCAAACTATATCAATAA
ATTCCATGTTTAGCAGAAATAGGCAGCCTATTGGTGTTATGTTTATGTAACATAGTCCAGAGAACTGACATGCAGGTCAAAAGTCAGATA
CGCAACCTCCTTATCTGCTAACTCTGTTATTCTTCAAACACAAGTGGGTAGTGTCATTTTTCCTTCCTTCCTTCCATTGGCAGATTGTAT
ATTTATTCACAAAACATTAAATGTCCATCCTGTGCCAGGTACTATGCAGATGTTGAGGGATTTGGGGTCTGGTTAGTCGTGACTATCTAT
CCTGAATCTAACAGTGACTTCATAACTAGGAGACTGAATTAGACCCTTAAGGTATAGTGTGTGTTGCAAATCACTCTGCAATGGAAACTT
TTATATTCAGGGTAGGTTTGTGTCTTAAACTAGGTGTTCTAATCAATGTACAAGACTTTACCATACACGCAACTATAGTTTTTCTAAACC
TTCATCATTTTGTGATTCTTTGAGAAAGGGCTTTTAGGAACTTTATGTTCTAAAAAATGTTTTTAACAATAATAAGATAAAAGAAAAACC
TGTGATTCATATGTCCCCACTGGCATTACTCAGCAGGAGCCCCCAGCTGCCAAAGGTTGGCAGTGATCCTGCAAGTTCAAGGGCTCTTTC
TCCCTGGGGATGTGCTTTGTGGCTTCTCTTTACAGCTTTGTTTCTGCATCAGTTCACTGCTGCATGTTGTTTGGAATTTATCACCTTAAG
AAAGTGTCTCTGTTTTATATAGAAACACTTTCTCACTTACAGGGGAGAAGGAAATGCAGGGCACATGATCTGGCCCTCCCCAGAACAATC
TGGATTTCACGGAGACAGCAACCAGAAGTTAAACCATGTGACTAAAAATGCATCTGGCTACTTTTTCATGTATGTATGAGACAGAAACTA

>In-frame_RAPGEF5_ENST00000405243_chr7_22306583_-_BAALC_ENST00000309982_chr8_104225147_+_3363nt
TCTCGCTTCCTGGCGAAGGCGCGGACGGCGCGCGGAGGCGAGCGCGGTGGAGAGGAGCCCCCGGCGCCGCAGCGCCGTCAGGGCATGAGG
ATGGCCGTGGGCTCCGTCAAGATGCAGCCGCCGTGCGAGAGCCCGGCCCTGGCCGCCGCGGCGGCGGTGGTGGCGGCAGACGGCCCCCTG
CGCCGCAGCCCCAGCGCCCGGGAGCCCGAGCGCGAGCAGCCGCCGGCGTCGCTGCGGCCGCGGCTGAGGGACCTGCCCGCGCTGCTGCGG
AGCGGGCTCACGCTGCGGAGGAAGCGGAGCGCCGCTGGGGGCCGGACTCTATCAAGAAGAATATCTAATCCGTACCTTGAACATACGCCT
TCCCAGATTTATGGAGAGAATTCTTCTTGTGCAGGAAGAGCATTGAGGAATATTATTATCGTTCAAGCAGCTGACCTGATAAAGGACAGA
GTGAACCTCAAGGGGTTTTACAGGAGGAGCTGCGTTGGGTCAGAGCTGGTAGACTGGCTTCTAGAACACTGTCCTTTCGTCCAGTGCAGA
TCTATGGCCATAGGAGTCTGGCAACTCCTACTGGACATGGGAATTATGTTATCAGTGGACCAGCATCTATACTTTCAAGATACTTATGTT
TTCTACCAGTTTTCCTCTGATGAATGTAGCTACTTGTACTGTGAATTTGAAAGAGAAGAAGAATGGCAAAATGGTGTCAAGCTTTTACTG
CAACTTGTGCCTCTCATTCCTGCCAGAGGTGGCATCTGTGAACTGTCTCATCAGAAAATTGAAGACTCCGAAGAAAGCAGTGATGAAATT
CTTGTGCGTCTAACATCTGCGGTGCAGAGAGAGCTAGCAGCTGTTATTGCTTTGAAAGCAAGGAAGTCTGGCATGCTGGAAGATGGACTG
CCCTCCAATGGTGTGCCCCGATCTACAGCCCCAGGTGGAATACCCAACCCAGAGAAGAAGACGAACTGTGAGACCCAGTGCCCAAATCCC
CAGAGCCTCAGCTCAGGCCCTCTGACCCAGAAACAGAATGGCCTTCAGACCACAGAGGCTAAAAGAGATGCTAAGAGAATGCCTGCAAAA
GAAGTCACCATTAATGTAACAGATAGCATCCAACAGATGGACAGAAGTCGAAGAATCACAAAGAACTGTGTCAACTAGCAGAGAGTCCAA
GCAGAAGGGCAGATGGACTTCTTCAGTGTCCTTCACGGCACTGGATCCCATCAAAGAACCTTGAAGAAGTGGCTGCCCCTTGCTGGACCT
GAATTCTACTGAGTCCCTGGCAAGACTGTCTTACCTGGCAGCAAACTGCTGCCTGATTTGTTGGGACCTTCTGAGCCTTCTACTTATCAT
GTAAATGTATTGGCACAGTGCTTACATATGTTAATAAACTGCAAATGTGCAGTTCAGTTTGTCTCTTTGCAACTCCTGTAATACGGTCTG
GTGTAAAAGTAGTGAGTTAAAGCTACAGGTCAGTTTATGAAACAGAAAAGTAGGAATGCATTTTCTGGGTGAAAGAGTCACACCTTAGTG
CTATAACTCTCCTGCCCATGATAGTGTATTCTGTTTCAGGCAAGCTTATTCTTTCCTTCTTTCATTTTAAATATTGTCATTACAAATCTT
ACCAGGTTCACTTAAAAGCTGGCTTTCATCCAACTCTAAACCCACATATTGAAAAAATCAAGGTACAGGAAAACTCCTTGTTATCCTTGT
TTCCTTAGCTTGGTATGAGACAGATCGGATCCAGTTTCCCATGCACCAACCCACTGCCCATGGCATGTCTTTGGGAGGTGTCTGTGAAGC
AGTCATACCTGCTCCTCATCTGCCTGGAAAGTCCTCCTATTCCAGTGTCCATGTTGGCCTCCAGTCCTTAATGTCACCATGCTTGTGGCC
AATGCATCCAAATAAGGATACCCCTCAGGGCTCAGCTAGACATTGCAATTTTGCATAGCTTTCCAGTTCCCTTTGCTTGTCTTCTTGACT
GTCTTCCCTCTCTATCGGGGTCACTTGCAATTGTTAATCAAAGATTGAACACTGCGTAGGAGAGGGAGATGATCCAGAGACATGTGGCAG
CAGGCATGGCTTCCCCTTGGCCTCTCTGTACACTGCCCCAGGACTGTCATTTTGGCATCTGCAAAGGAATCACTTTAGAAAGCCAGCACC
TGGTTGATGTGTATTCATACTGACATTAGATTGATGTGCACTGCATTAGAAATGAGGTAGCTGACACAGAAAAAGGATGTTTTGATAGGA
ATAATTTTCTAGTATGTCTTGAAACATGTTCATCTGGAAGTATTTTCCTCCAAAGTAATGTAGCATGATTTTTCAAGGATTGTTAACATG
CCTGGGATTGGGAAAGATAGGACTAAAGTTGTGCCAAACTATATCAATAAATTCCATGTTTAGCAGAAATAGGCAGCCTATTGGTGTTAT
GTTTATGTAACATAGTCCAGAGAACTGACATGCAGGTCAAAAGTCAGATACGCAACCTCCTTATCTGCTAACTCTGTTATTCTTCAAACA
CAAGTGGGTAGTGTCATTTTTCCTTCCTTCCTTCCATTGGCAGATTGTATATTTATTCACAAAACATTAAATGTCCATCCTGTGCCAGGT
ACTATGCAGATGTTGAGGGATTTGGGGTCTGGTTAGTCGTGACTATCTATCCTGAATCTAACAGTGACTTCATAACTAGGAGACTGAATT
AGACCCTTAAGGTATAGTGTGTGTTGCAAATCACTCTGCAATGGAAACTTTTATATTCAGGGTAGGTTTGTGTCTTAAACTAGGTGTTCT
AATCAATGTACAAGACTTTACCATACACGCAACTATAGTTTTTCTAAACCTTCATCATTTTGTGATTCTTTGAGAAAGGGCTTTTAGGAA
CTTTATGTTCTAAAAAATGTTTTTAACAATAATAAGATAAAAGAAAAACCTGTGATTCATATGTCCCCACTGGCATTACTCAGCAGGAGC
CCCCAGCTGCCAAAGGTTGGCAGTGATCCTGCAAGTTCAAGGGCTCTTTCTCCCTGGGGATGTGCTTTGTGGCTTCTCTTTACAGCTTTG
TTTCTGCATCAGTTCACTGCTGCATGTTGTTTGGAATTTATCACCTTAAGAAAGTGTCTCTGTTTTATATAGAAACACTTTCTCACTTAC
AGGGGAGAAGGAAATGCAGGGCACATGATCTGGCCCTCCCCAGAACAATCTGGATTTCACGGAGACAGCAACCAGAAGTTAAACCATGTG
ACTAAAAATGCATCTGGCTACTTTTTCATGTATGTATGAGACAGAAACTAATCCTTACTATCCTATTAGGATACCACTTTTCATTGCAAA


Top

FusionGenePPI for RAPGEF5_BAALC


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RAPGEF5RAP2A, RAP1A, MRAS, KCND3, PLAC9, VANGL1, TMEM253, ANK3, ANK1, MAPK8IP2, ANK2, DDHD2, TUBB1, HSP90AA4P, CCDC88A, UBB, HERC1, PPFIBP1, RICTOR, PLEC, ZNHIT2, WNK1, PRKAR1B, PPP2R5D, PRKACB, PIK3CB, FLNC, ATP2B2BAALCMDFI, ATXN1, CHEK2, MAP3K1, KLF4, ATP1B3, RNF2, CHD1L, CINP, OSBPL1A, AP1G1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneBAALCchr7:22306583chr8:104225147ENST00000306391+024_36081CAMK2A
TgeneBAALCchr7:22306583chr8:104225147ENST00000330955+024_36074CAMK2A
TgeneBAALCchr7:22306583chr8:104225147ENST00000438105+024_36-6255CAMK2A


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneBAALCchr7:22306583chr8:104225147ENST00000297574+144_3688181CAMK2A
TgeneBAALCchr7:22306583chr8:104225147ENST00000309982+034_3653146CAMK2A


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RAPGEF5_BAALC


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RAPGEF5_BAALC


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRAPGEF5C0005586Bipolar Disorder1PSYGENET
HgeneRAPGEF5C0033975Psychotic Disorders1PSYGENET
HgeneRAPGEF5C0036341Schizophrenia1PSYGENET
HgeneRAPGEF5C0041696Unipolar Depression1PSYGENET
HgeneRAPGEF5C0236733Amphetamine-Related Disorders1CTD_human
HgeneRAPGEF5C0349204Nonorganic psychosis1PSYGENET
HgeneRAPGEF5C1269683Major Depressive Disorder1PSYGENET
TgeneBAALCC0023467Leukemia, Myelocytic, Acute1CTD_human