FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30384

FusionGeneSummary for RAP1B_IGSF8

check button Fusion gene summary
Fusion gene informationFusion gene name: RAP1B_IGSF8
Fusion gene ID: 30384
HgeneTgene
Gene symbol

RAP1B

IGSF8

Gene ID

5908

93185

Gene nameRAP1B, member of RAS oncogene familyimmunoglobulin superfamily member 8
SynonymsK-REV|RAL1BCD316|CD81P3|EWI-2|EWI2|KCT-4|LIR-D1|PGRL
Cytomap

12q15

1q23.2

Type of geneprotein-codingprotein-coding
Descriptionras-related protein Rap-1bGTP-binding protein smg p21BRAS-related protein RAP1BRas family small GTP binding protein RAP1Bsmall GTP binding proteinimmunoglobulin superfamily member 8CD81 partner 3glu-Trp-Ile EWI motif-containing protein 2keratinocytes-associated transmembrane protein 4prostaglandin regulatory-like protein
Modification date2018052720180523
UniProtAcc

P61224

Q969P0

Ensembl transtripts involved in fusion geneENST00000250559, ENST00000393436, 
ENST00000341355, ENST00000537460, 
ENST00000463493, ENST00000450214, 
ENST00000543393, ENST00000378985, 
ENST00000540209, ENST00000539091, 
ENST00000542145, ENST00000543697, 
ENST00000541216, 
ENST00000314485, 
ENST00000368086, ENST00000460351, 
Fusion gene scores* DoF score12 X 6 X 7=5047 X 4 X 7=196
# samples 117
** MAII scorelog2(11/504*10)=-2.19592020997526
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/196*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RAP1B [Title/Abstract] AND IGSF8 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRAP1B

GO:0071320

cellular response to cAMP

21840392


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A240-01ARAP1Bchr12

69048032

+IGSF8chr1

160065036

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000250559ENST00000314485RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000250559ENST00000368086RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
5CDS-5UTRENST00000250559ENST00000460351RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000393436ENST00000314485RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000393436ENST00000368086RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
5CDS-5UTRENST00000393436ENST00000460351RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000341355ENST00000314485RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000341355ENST00000368086RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
5CDS-5UTRENST00000341355ENST00000460351RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000537460ENST00000314485RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000537460ENST00000368086RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
5CDS-5UTRENST00000537460ENST00000460351RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
3UTR-3CDSENST00000463493ENST00000314485RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
3UTR-3CDSENST00000463493ENST00000368086RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
3UTR-5UTRENST00000463493ENST00000460351RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000450214ENST00000314485RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000450214ENST00000368086RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
5CDS-5UTRENST00000450214ENST00000460351RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000543393ENST00000314485RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000543393ENST00000368086RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
5CDS-5UTRENST00000543393ENST00000460351RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000378985ENST00000314485RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000378985ENST00000368086RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
5CDS-5UTRENST00000378985ENST00000460351RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000540209ENST00000314485RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000540209ENST00000368086RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
5CDS-5UTRENST00000540209ENST00000460351RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000539091ENST00000314485RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000539091ENST00000368086RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
5CDS-5UTRENST00000539091ENST00000460351RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
intron-3CDSENST00000542145ENST00000314485RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
intron-3CDSENST00000542145ENST00000368086RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
intron-5UTRENST00000542145ENST00000460351RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000543697ENST00000314485RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000543697ENST00000368086RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
5CDS-5UTRENST00000543697ENST00000460351RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000541216ENST00000314485RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
In-frameENST00000541216ENST00000368086RAP1Bchr12

69048032

+IGSF8chr1

160065036

-
5CDS-5UTRENST00000541216ENST00000460351RAP1Bchr12

69048032

+IGSF8chr1

160065036

-

Top

FusionProtFeatures for RAP1B_IGSF8


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RAP1B

P61224

IGSF8

Q969P0

May play a key role in diverse functions ascribed toCD81 and CD9 such as oocytes fertilization or hepatitis C virusfunction. May regulate proliferation and differentiation ofkeratinocytes. May be a negative regulator of cell motility:suppresses T-cell mobility coordinately with CD81, associates withCD82 to suppress prostate cancer cell migration, regulatesepidermoid cell reaggregation and motility on laminin-5 with CD9and CD81 as key linkers. May also play a role on integrin-dependent morphology and motility functions. May participate inthe regulation of neurite outgrowth and maintenance of the neuralnetwork in the adult brain. {ECO:0000269|PubMed:11504738,ECO:0000269|PubMed:12750295, ECO:0000269|PubMed:12752121,ECO:0000269|PubMed:14662754, ECO:0000269|PubMed:15070678}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000250559+5832_40108554MotifEffector region
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000341355+5732_40108185MotifEffector region
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000393436+5832_40108534MotifEffector region
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000450214+3632_4066379MotifEffector region
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000537460+6932_40108180MotifEffector region
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000539091+3632_4066224MotifEffector region
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000540209+4732_4089323MotifEffector region
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000250559+5810_18108554Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000250559+5857_61108554Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000341355+5710_18108185Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000341355+5757_61108185Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000393436+5810_18108534Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000393436+5857_61108534Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000450214+3610_1866379Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000450214+3657_6166379Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000537460+6910_18108180Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000537460+6957_61108180Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000539091+3610_1866224Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000539091+3657_6166224Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000540209+4710_1889323Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000540209+4757_6189323Nucleotide bindingGTP
TgeneIGSF8chr12:69048032chr1:160065036ENST00000314485-07162_28621527DomainNote=Ig-like C2-type 2
TgeneIGSF8chr12:69048032chr1:160065036ENST00000314485-0728_14921527DomainNote=Ig-like C2-type 1
TgeneIGSF8chr12:69048032chr1:160065036ENST00000314485-07303_42421527DomainNote=Ig-like C2-type 3
TgeneIGSF8chr12:69048032chr1:160065036ENST00000314485-07431_56021527DomainNote=Ig-like C2-type 4
TgeneIGSF8chr12:69048032chr1:160065036ENST00000368086-07162_28621535DomainNote=Ig-like C2-type 2
TgeneIGSF8chr12:69048032chr1:160065036ENST00000368086-0728_14921535DomainNote=Ig-like C2-type 1
TgeneIGSF8chr12:69048032chr1:160065036ENST00000368086-07303_42421535DomainNote=Ig-like C2-type 3
TgeneIGSF8chr12:69048032chr1:160065036ENST00000368086-07431_56021535DomainNote=Ig-like C2-type 4
TgeneIGSF8chr12:69048032chr1:160065036ENST00000314485-07274_27621527MotifNote=EWI motif
TgeneIGSF8chr12:69048032chr1:160065036ENST00000368086-07274_27621535MotifNote=EWI motif
TgeneIGSF8chr12:69048032chr1:160065036ENST00000314485-0728_57921527Topological domainExtracellular
TgeneIGSF8chr12:69048032chr1:160065036ENST00000314485-07601_61321527Topological domainCytoplasmic
TgeneIGSF8chr12:69048032chr1:160065036ENST00000368086-0728_57921535Topological domainExtracellular
TgeneIGSF8chr12:69048032chr1:160065036ENST00000368086-07601_61321535Topological domainCytoplasmic
TgeneIGSF8chr12:69048032chr1:160065036ENST00000314485-07580_60021527TransmembraneHelical
TgeneIGSF8chr12:69048032chr1:160065036ENST00000368086-07580_60021535TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000542145+1732_40-47258MotifEffector region
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000250559+58116_119108554Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000250559+58147_149108554Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000341355+57116_119108185Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000341355+57147_149108185Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000393436+58116_119108534Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000393436+58147_149108534Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000450214+36116_11966379Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000450214+36147_14966379Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000537460+69116_119108180Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000537460+69147_149108180Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000539091+36116_11966224Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000539091+36147_14966224Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000540209+47116_11989323Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000540209+47147_14989323Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000542145+1710_18-47258Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000542145+17116_119-47258Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000542145+17147_149-47258Nucleotide bindingGTP
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000542145+1757_61-47258Nucleotide bindingGTP


Top

FusionGeneSequence for RAP1B_IGSF8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RAP1B_ENST00000250559_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_108aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTF

>In-frame_RAP1B_ENST00000250559_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_108aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTF

>In-frame_RAP1B_ENST00000393436_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_108aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTF

>In-frame_RAP1B_ENST00000393436_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_108aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTF

>In-frame_RAP1B_ENST00000341355_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_108aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTF

>In-frame_RAP1B_ENST00000341355_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_108aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTF

>In-frame_RAP1B_ENST00000537460_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_108aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTF

>In-frame_RAP1B_ENST00000537460_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_108aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTF

>In-frame_RAP1B_ENST00000450214_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_66aa

>In-frame_RAP1B_ENST00000450214_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_66aa

>In-frame_RAP1B_ENST00000543393_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_42aa

>In-frame_RAP1B_ENST00000543393_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_42aa

>In-frame_RAP1B_ENST00000378985_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_42aa

>In-frame_RAP1B_ENST00000378985_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_42aa

>In-frame_RAP1B_ENST00000540209_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_89aa

>In-frame_RAP1B_ENST00000540209_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_89aa

>In-frame_RAP1B_ENST00000539091_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_66aa

>In-frame_RAP1B_ENST00000539091_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_66aa

>In-frame_RAP1B_ENST00000543697_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_108aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTF

>In-frame_RAP1B_ENST00000543697_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_108aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTF

>In-frame_RAP1B_ENST00000541216_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_108aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTF

>In-frame_RAP1B_ENST00000541216_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_108aa
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RAP1B_ENST00000250559_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_324nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGA
ACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTT

>In-frame_RAP1B_ENST00000250559_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_324nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGA
ACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTT

>In-frame_RAP1B_ENST00000393436_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_324nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGA
ACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTT

>In-frame_RAP1B_ENST00000393436_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_324nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGA
ACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTT

>In-frame_RAP1B_ENST00000341355_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_324nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGA
ACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTT

>In-frame_RAP1B_ENST00000341355_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_324nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGA
ACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTT

>In-frame_RAP1B_ENST00000537460_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_324nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGA
ACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTT

>In-frame_RAP1B_ENST00000537460_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_324nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGA
ACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTT

>In-frame_RAP1B_ENST00000450214_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_198nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGGAGCAATTTACAGCAATGAGGGATTTATACATG
AAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGA

>In-frame_RAP1B_ENST00000450214_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_198nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGGAGCAATTTACAGCAATGAGGGATTTATACATG
AAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGA

>In-frame_RAP1B_ENST00000543393_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_126nt
ATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTG

>In-frame_RAP1B_ENST00000543393_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_126nt
ATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTG

>In-frame_RAP1B_ENST00000378985_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_126nt
ATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTG

>In-frame_RAP1B_ENST00000378985_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_126nt
ATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTG

>In-frame_RAP1B_ENST00000540209_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_267nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCA

>In-frame_RAP1B_ENST00000540209_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_267nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCA

>In-frame_RAP1B_ENST00000539091_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_198nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGGAGCAATTTACAGCAATGAGGGATTTATACATG
AAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGA

>In-frame_RAP1B_ENST00000539091_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_198nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGGAGCAATTTACAGCAATGAGGGATTTATACATG
AAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGA

>In-frame_RAP1B_ENST00000543697_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_324nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGA
ACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTT

>In-frame_RAP1B_ENST00000543697_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_324nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGA
ACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTT

>In-frame_RAP1B_ENST00000541216_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_324nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGA
ACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTT

>In-frame_RAP1B_ENST00000541216_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_324nt
ATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAA
AAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGA
ACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_RAP1B_ENST00000250559_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_2617nt
ACCCGCGCGCCCCGCCCGCGGGCGGAAGCTGGAGCGAGGCTGAACGCCTGACGTCAAGGCGACATCGCCAAACCTCGCCCAGATTCAGGC
GTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCGACGCTGGCTG
CAGGGACCCGGTGACAGCGTGAGAGGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGC
GTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAAAAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAA
GTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGAACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAA
AATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTT
AAAGACACTGATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCA
TCTCCTGCAATGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGG
GCATTGTCAGTACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAG
GTGATGCCGTGGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACC
TGGGCAGCTACAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGG
CCCCAACCTCACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACAC
ACCTGGCAGTGTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGG
CCGTGGAGGCTGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAG
TAGGGGGTGCCCAGGCAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTG
CAGAGAAAAGGGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCG
GCCCAGGGGAGCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGA
TGGCACCTGCGGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCC
GACACATTGCCATGGAGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCC
TCGCCAAAGCCTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGG
AAGGTGTGGTGCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGC
GGGGTGGCCCCCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGG
TGGGTGGCGTAGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCC
ATCGGCTGAGACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCT
GGTACCAGGCGGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGG
GTACAGGGGTGGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTA
CTCCCCAGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCT
TCCTTTAATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCC
TTCTGTTCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTGTCCTGGAATTAGTTTTTCTAAAATGTGAATAAACTTGTTTTATA

>In-frame_RAP1B_ENST00000250559_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_2640nt
ACCCGCGCGCCCCGCCCGCGGGCGGAAGCTGGAGCGAGGCTGAACGCCTGACGTCAAGGCGACATCGCCAAACCTCGCCCAGATTCAGGC
GTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCGACGCTGGCTG
CAGGGACCCGGTGACAGCGTGAGAGGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGC
GTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAAAAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAA
GTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGAACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAA
AATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTT
AAAGACACTGATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCA
TCTCCTGCAATGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGG
GCATTGTCAGTACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAG
GTGATGCCGTGGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACC
TGGGCAGCTACAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGG
CCCCAACCTCACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACAC
ACCTGGCAGTGTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGG
CCGTGGAGGCTGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAG
TAGGGGGTGCCCAGGCAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTG
CAGAGAAAAGGGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCG
GCCCAGGGGAGCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGA
TGGCACCTGCGGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCC
GACACATTGCCATGGAGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCC
TCGCCAAAGCCTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGG
AAGGTGTGGTGCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGC
GGGGTGGCCCCCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGG
TGGGTGGCGTAGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCC
ATCGGCTGAGACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCT
GGTACCAGGCGGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGG
GTACAGGGGTGGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTA
CTCCCCAGCCCACACCGGGCACCCTTTTCAGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGA
CACCCTCTCCCTCTGTCCACTCTTCCTTTAATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCC
CTCCCAAGCCCCTCCCTCTGGCCTTCTGTTCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTGTCCTGGAATTAGTTTTTCTAA

>In-frame_RAP1B_ENST00000393436_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_2607nt
GGGCGGAAGCTGGAGCGAGGCTGAACGCCTGACGTCAAGGCGACATCGCCAAACCTCGCCCAGATTCAGGCGTGTAAACCAGCCGGAGCG
GCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCGACGCTGGCTGCAGGGACCCGGTGACAGCG
TGAGAGGTTCGCAGAGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGT
CTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAAAAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAG
ATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGAACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAG
GATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTG
ATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAA
TGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAG
TACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGT
GGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTA
CAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTC
ACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGT
GTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGC
TGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGC
CCAGGCAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAG
GGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGA
GCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGC
GGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGC
CATGGAGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGC
CTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGT
GCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCC
CCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGT
AGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAG
ACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGC
GGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGT
GGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGGT
CTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTCCTTTAATT
TATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTTCTGTTCTT

>In-frame_RAP1B_ENST00000393436_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_2630nt
GGGCGGAAGCTGGAGCGAGGCTGAACGCCTGACGTCAAGGCGACATCGCCAAACCTCGCCCAGATTCAGGCGTGTAAACCAGCCGGAGCG
GCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCGACGCTGGCTGCAGGGACCCGGTGACAGCG
TGAGAGGTTCGCAGAGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGT
CTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAAAAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAG
ATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGAACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAG
GATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTG
ATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAA
TGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAG
TACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGT
GGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTA
CAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTC
ACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGT
GTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGC
TGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGC
CCAGGCAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAG
GGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGA
GCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGC
GGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGC
CATGGAGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGC
CTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGT
GCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCC
CCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGT
AGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAG
ACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGC
GGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGT
GGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGCC
CACACCGGGCACCCTTTTCAGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCC
CTCTGTCCACTCTTCCTTTAATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCC
CCTCCCTCTGGCCTTCTGTTCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTGTCCTGGAATTAGTTTTTCTAAAATGTGAATA

>In-frame_RAP1B_ENST00000341355_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_2541nt
AAACCTCGCCCAGATTCAGGCGTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGG
AGCGCGGGGCGACGCTGGCTGCAGGGACCCGGTGACAGCGTGAGAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTC
TTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAAAAATACGATCCTACGATAGAAGATT
CTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGAACGGAGCAATTTACAGCAATGAGGG
ATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAAC
AGATTCTTCGAGTTAAAGACACTGATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGG
CACAGCTGTCTCCATCTCCTGCAATGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCC
AGATACTGCACTGGGCATTGTCAGTACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGT
GCAGCGCCTACAAGGTGATGCCGTGGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCAC
TGATACCCGCTACCTGGGCAGCTACAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCC
CCGAGGCCGCCAGGCCCCAACCTCACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCAC
ACAGAAGCACACACACCTGGCAGTGTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAAT
CCGGTCAGACTTGGCCGTGGAGGCTGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCG
GTACCGCATGGTAGTAGGGGGTGCCCAGGCAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAG
CTGGGCCCAGATTGCAGAGAAAAGGGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGG
TGAACGTCGGATCGGCCCAGGGGAGCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTC
TGTAGGTTGGGAGATGGCACCTGCGGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCC
TGGCTATGAGGGCCGACACATTGCCATGGAGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGG
CACCTACCGCTGCCTCGCCAAAGCCTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGT
ACATGTGCGGGAGGAAGGTGTGGTGCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTG
CAACATCTCTGTGCGGGGTGGCCCCCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGT
CCCTGCCCAGCTGGTGGGTGGCGTAGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGT
GGGGCCCCGAAGCCATCGGCTGAGACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCA
TGCCGACTACAGCTGGTACCAGGCGGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGT
GCCTCTGCTGGTGGGTACAGGGGTGGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAA
ACGGTGATCCCTTACTCCCCAGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTC
CCTCTGTCCACTCTTCCTTTAATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGC
CCCTCCCTCTGGCCTTCTGTTCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTGTCCTGGAATTAGTTTTTCTAAAATGTGAAT

>In-frame_RAP1B_ENST00000341355_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_2564nt
AAACCTCGCCCAGATTCAGGCGTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGG
AGCGCGGGGCGACGCTGGCTGCAGGGACCCGGTGACAGCGTGAGAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTC
TTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAAAAATACGATCCTACGATAGAAGATT
CTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGAACGGAGCAATTTACAGCAATGAGGG
ATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAAC
AGATTCTTCGAGTTAAAGACACTGATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGG
CACAGCTGTCTCCATCTCCTGCAATGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCC
AGATACTGCACTGGGCATTGTCAGTACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGT
GCAGCGCCTACAAGGTGATGCCGTGGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCAC
TGATACCCGCTACCTGGGCAGCTACAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCC
CCGAGGCCGCCAGGCCCCAACCTCACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCAC
ACAGAAGCACACACACCTGGCAGTGTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAAT
CCGGTCAGACTTGGCCGTGGAGGCTGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCG
GTACCGCATGGTAGTAGGGGGTGCCCAGGCAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAG
CTGGGCCCAGATTGCAGAGAAAAGGGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGG
TGAACGTCGGATCGGCCCAGGGGAGCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTC
TGTAGGTTGGGAGATGGCACCTGCGGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCC
TGGCTATGAGGGCCGACACATTGCCATGGAGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGG
CACCTACCGCTGCCTCGCCAAAGCCTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGT
ACATGTGCGGGAGGAAGGTGTGGTGCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTG
CAACATCTCTGTGCGGGGTGGCCCCCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGT
CCCTGCCCAGCTGGTGGGTGGCGTAGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGT
GGGGCCCCGAAGCCATCGGCTGAGACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCA
TGCCGACTACAGCTGGTACCAGGCGGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGT
GCCTCTGCTGGTGGGTACAGGGGTGGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAA
ACGGTGATCCCTTACTCCCCAGCCCACACCGGGCACCCTTTTCAGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCC
TCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTCCTTTAATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCT
TCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTTCTGTTCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTGTCCTGGA

>In-frame_RAP1B_ENST00000537460_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_2751nt
AAACCTCGCCCAGATTCAGGCGTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGG
AGCGCGGGGCGACGCTGGCTGCAGGGACCCGGTGACAGCGTGAGAGCCAGGCATGGTGGTGTGTTCCTGTAGTCCCAGCTACTCGGGAGG
CTGAGCAGGAGAATCGCTGGAACCTGGCAGGCAGAACTTGCAGTGAGCTGAGATCGTGCCACTGCACTCCAGCCTAGGCGACAGAGTGAG
ACTCCGTCTCAAACAACAACAACAACAAAAGCTCCTCGATGGAACCATTTGATAGTGACAAGGATTGAAGTACTAGGTTTTGACAAGCTT
GCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTG
TAGAAAAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTG
CAGGAACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCA
CATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTGATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGT
CCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAATGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTT
CGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAGTACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAA
GTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGTGGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGC
CGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTACAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGT
CCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTCACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCT
GGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGTGTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGG
GCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGCTGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGA
GCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGCCCAGGCAGGGGACGCAGGCACCTACCACTGCACTGC
CGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAGGGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTC
CAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGAGCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACT
TCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGCGGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCT
GGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGCCATGGAGAAGGTGGCATCCAGAACATACCGGCTACG
GCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGCCTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGC
AGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGTGCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGT
GTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCCCCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGA
GCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGTAGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCC
TGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAGACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTA
CCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGCGGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCC
CTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGTGGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCAT
CACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAA
GCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTCCTTTAATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGC
CTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTTCTGTTCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTG

>In-frame_RAP1B_ENST00000537460_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_2774nt
AAACCTCGCCCAGATTCAGGCGTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGG
AGCGCGGGGCGACGCTGGCTGCAGGGACCCGGTGACAGCGTGAGAGCCAGGCATGGTGGTGTGTTCCTGTAGTCCCAGCTACTCGGGAGG
CTGAGCAGGAGAATCGCTGGAACCTGGCAGGCAGAACTTGCAGTGAGCTGAGATCGTGCCACTGCACTCCAGCCTAGGCGACAGAGTGAG
ACTCCGTCTCAAACAACAACAACAACAAAAGCTCCTCGATGGAACCATTTGATAGTGACAAGGATTGAAGTACTAGGTTTTGACAAGCTT
GCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTG
TAGAAAAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTG
CAGGAACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCA
CATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTGATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGT
CCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAATGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTT
CGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAGTACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAA
GTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGTGGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGC
CGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTACAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGT
CCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTCACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCT
GGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGTGTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGG
GCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGCTGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGA
GCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGCCCAGGCAGGGGACGCAGGCACCTACCACTGCACTGC
CGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAGGGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTC
CAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGAGCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACT
TCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGCGGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCT
GGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGCCATGGAGAAGGTGGCATCCAGAACATACCGGCTACG
GCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGCCTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGC
AGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGTGCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGT
GTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCCCCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGA
GCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGTAGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCC
TGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAGACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTA
CCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGCGGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCC
CTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGTGGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCAT
CACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGCCCACACCGGGCACCCTTTTCAGGTCTTGCAGGTGTCG
ACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTCCTTTAATTTATTTGACCTCCC
ACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTTCTGTTCTTGATCTCTTAGGGA

>In-frame_RAP1B_ENST00000450214_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_2422nt
AAACCTCGCCCAGATTCAGGCGTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGG
AGCGCGGGGCGACGCTGGCTGCAGGGACCCGGTGACAGCGTGAGAGGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTA
GTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTT
GCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTGATGAT
GAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAATGTGA
CCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAGTACCA
AGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGTGGTGC
TCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTACAGCG
GCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTCACCCC
CACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGTGTCCT
TTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGCTGGAG
CTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGCCCAGG
CAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAGGGCCG
TCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGAGCCCT
TGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGCGGGGG
CACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGCCATGG
AGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGCCTATG
TTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGTGCTGG
AGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCCCCCAG
GACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGTAGGCC
AGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAGACTAC
ACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGCGGGCA
GTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGTGGCCC
TAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGGTCTTGC
AGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTCCTTTAATTTATTT
GACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTTCTGTTCTTGATCT

>In-frame_RAP1B_ENST00000450214_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_2445nt
AAACCTCGCCCAGATTCAGGCGTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGG
AGCGCGGGGCGACGCTGGCTGCAGGGACCCGGTGACAGCGTGAGAGGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTA
GTCGTTCTTGGCTCAGGAGGCGTTGGAAAGTCTGCTTTGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTT
GCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTGATGAT
GAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAATGTGA
CCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAGTACCA
AGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGTGGTGC
TCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTACAGCG
GCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTCACCCC
CACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGTGTCCT
TTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGCTGGAG
CTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGCCCAGG
CAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAGGGCCG
TCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGAGCCCT
TGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGCGGGGG
CACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGCCATGG
AGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGCCTATG
TTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGTGCTGG
AGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCCCCCAG
GACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGTAGGCC
AGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAGACTAC
ACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGCGGGCA
GTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGTGGCCC
TAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGCCCACAC
CGGGCACCCTTTTCAGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTG
TCCACTCTTCCTTTAATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCC
CTCTGGCCTTCTGTTCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTGTCCTGGAATTAGTTTTTCTAAAATGTGAATAAACTT

>In-frame_RAP1B_ENST00000543393_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_2328nt
AGATTCAGGCGTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCG
ACGCTGGCTGCAGGGACCCGGTGACAGCGTGAGAGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCAT
TAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTGATGATGAAT
GGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAATGTGACCGG
CTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAGTACCAAGGA
TACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGTGGTGCTCAA
GATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTACAGCGGCAA
GGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTCACCCCCACG
CATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGTGTCCTTTGG
GCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGCTGGAGCTCC
CTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGCCCAGGCAGG
GGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAGGGCCGTCCT
GGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGAGCCCTTGGA
ACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGCGGGGGCACC
TGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGCCATGGAGAA
GGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGCCTATGTTCG
AGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGTGCTGGAGGC
TGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCCCCCAGGACT
GCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGTAGGCCAGGA
TGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAGACTACACAG
CTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGCGGGCAGTGC
CCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGTGGCCCTAGT
CACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGGTCTTGCAGGT
GTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTCCTTTAATTTATTTGACC
TCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTTCTGTTCTTGATCTCTTA

>In-frame_RAP1B_ENST00000543393_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_2351nt
AGATTCAGGCGTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCG
ACGCTGGCTGCAGGGACCCGGTGACAGCGTGAGAGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCAT
TAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTGATGATGAAT
GGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAATGTGACCGG
CTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAGTACCAAGGA
TACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGTGGTGCTCAA
GATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTACAGCGGCAA
GGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTCACCCCCACG
CATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGTGTCCTTTGG
GCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGCTGGAGCTCC
CTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGCCCAGGCAGG
GGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAGGGCCGTCCT
GGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGAGCCCTTGGA
ACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGCGGGGGCACC
TGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGCCATGGAGAA
GGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGCCTATGTTCG
AGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGTGCTGGAGGC
TGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCCCCCAGGACT
GCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGTAGGCCAGGA
TGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAGACTACACAG
CTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGCGGGCAGTGC
CCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGTGGCCCTAGT
CACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGCCCACACCGGG
CACCCTTTTCAGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCA
CTCTTCCTTTAATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCT
GGCCTTCTGTTCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTGTCCTGGAATTAGTTTTTCTAAAATGTGAATAAACTTGTTT

>In-frame_RAP1B_ENST00000378985_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_2322nt
AGGCGTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCGACGCTG
GCTGCAGGGACCCGGTGACAGCGTGAGAGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTT
ATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTGATGATGAATGGGATG
CTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAATGTGACCGGCTATGA
GGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAGTACCAAGGATACCCA
GTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGTGGTGCTCAAGATTGC
CCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTACAGCGGCAAGGTGGA
GCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTCACCCCCACGCATGAC
GGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGTGTCCTTTGGGCGATC
TGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGCTGGAGCTCCCTATGC
TGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGCCCAGGCAGGGGACGC
AGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAGGGCCGTCCTGGCCCA
CGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGAGCCCTTGGAACTGCT
GTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGCGGGGGCACCTGGGCC
CGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGCCATGGAGAAGGTGGC
ATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGCCTATGTTCGAGGGTC
TGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGTGCTGGAGGCTGTGGC
ATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCCCCCAGGACTGCGGCT
GGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGTAGGCCAGGATGGTGT
GGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAGACTACACAGCTTGGG
GCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGCGGGCAGTGCCCGCTC
AGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGTGGCCCTAGTCACTGG
TGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGGTCTTGCAGGTGTCGAC
TGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTCCTTTAATTTATTTGACCTCCCAC
TACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTTCTGTTCTTGATCTCTTAGGGATC

>In-frame_RAP1B_ENST00000378985_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_2345nt
AGGCGTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCGACGCTG
GCTGCAGGGACCCGGTGACAGCGTGAGAGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTT
ATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTGATGATGAATGGGATG
CTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAATGTGACCGGCTATGA
GGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAGTACCAAGGATACCCA
GTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGTGGTGCTCAAGATTGC
CCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTACAGCGGCAAGGTGGA
GCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTCACCCCCACGCATGAC
GGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGTGTCCTTTGGGCGATC
TGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGCTGGAGCTCCCTATGC
TGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGCCCAGGCAGGGGACGC
AGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAGGGCCGTCCTGGCCCA
CGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGAGCCCTTGGAACTGCT
GTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGCGGGGGCACCTGGGCC
CGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGCCATGGAGAAGGTGGC
ATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGCCTATGTTCGAGGGTC
TGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGTGCTGGAGGCTGTGGC
ATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCCCCCAGGACTGCGGCT
GGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGTAGGCCAGGATGGTGT
GGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAGACTACACAGCTTGGG
GCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGCGGGCAGTGCCCGCTC
AGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGTGGCCCTAGTCACTGG
TGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGCCCACACCGGGCACCCT
TTTCAGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTC
CTTTAATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTT
CTGTTCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTGTCCTGGAATTAGTTTTTCTAAAATGTGAATAAACTTGTTTTATAAA

>In-frame_RAP1B_ENST00000540209_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_2474nt
AGGCGTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCGACGCTG
GCTGCAGGGACCCGGTGACAGCGTGAGAGGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGG
AGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAAAAATACGATCCTACGATAGAAGATTCTTATAGAAA
GGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAA
CGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTGATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAG
GGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAATGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGG
TTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAGTACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGA
GTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGTGGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATT
TATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTACAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAG
GTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTCACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTG
GGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGTGTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCA
ACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGCTGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGT
CTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGCCCAGGCAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAG
TGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAGGGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAG
CTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGAGCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCA
GCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGCGGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACA
GAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGCCATGGAGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAG
GCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGCCTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGT
GCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGTGCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGC
GGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCCCCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCA
GAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGTAGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGA
GGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAGACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGT
GCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGCGGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATG
CATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGTGGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGC
TGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCC
TCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTCCTTTAATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCT
TCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTTCTGTTCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTGTCCTGGA

>In-frame_RAP1B_ENST00000540209_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_2497nt
AGGCGTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCGACGCTG
GCTGCAGGGACCCGGTGACAGCGTGAGAGGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGG
AGGCGTTGGAAAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAAAAATACGATCCTACGATAGAAGATTCTTATAGAAA
GGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAA
CGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTGATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAG
GGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAATGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGG
TTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAGTACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGA
GTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGTGGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATT
TATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTACAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAG
GTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTCACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTG
GGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGTGTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCA
ACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGCTGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGT
CTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGCCCAGGCAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAG
TGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAGGGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAG
CTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGAGCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCA
GCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGCGGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACA
GAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGCCATGGAGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAG
GCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGCCTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGT
GCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGTGCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGC
GGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCCCCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCA
GAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGTAGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGA
GGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAGACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGT
GCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGCGGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATG
CATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGTGGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGC
TGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGCCCACACCGGGCACCCTTTTCAGGTCTTGCAGGTGTCGACTGTCT
TCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTCCTTTAATTTATTTGACCTCCCACTACCC
AGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTTCTGTTCTTGATCTCTTAGGGATCCTATA

>In-frame_RAP1B_ENST00000539091_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_2410nt
GTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCGACGCTGGCTG
CAGGGACCCGGTGACAGCGTGAGAGGTTCGCAGAGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGC
TCAGGAGGCGTTGGAAAGTCTGCTTTGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTAT
TCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTGATGATGAATGGGATGCT
GGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAATGTGACCGGCTATGAGG
GCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAGTACCAAGGATACCCAGT
TCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGTGGTGCTCAAGATTGCCC
GCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTACAGCGGCAAGGTGGAGC
TGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTCACCCCCACGCATGACGG
TGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGTGTCCTTTGGGCGATCTG
TGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGCTGGAGCTCCCTATGCTG
AGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGCCCAGGCAGGGGACGCAG
GCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAGGGCCGTCCTGGCCCACG
TGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGAGCCCTTGGAACTGCTGT
GCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGCGGGGGCACCTGGGCCCG
GCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGCCATGGAGAAGGTGGCAT
CCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGCCTATGTTCGAGGGTCTG
GGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGTGCTGGAGGCTGTGGCAT
GGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCCCCCAGGACTGCGGCTGG
CCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGTAGGCCAGGATGGTGTGG
CAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAGACTACACAGCTTGGGGC
CCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGCGGGCAGTGCCCGCTCAG
GGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGTGGCCCTAGTCACTGGTG
CCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGGTCTTGCAGGTGTCGACTG
TCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTCCTTTAATTTATTTGACCTCCCACTA
CCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTTCTGTTCTTGATCTCTTAGGGATCCT

>In-frame_RAP1B_ENST00000539091_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_2433nt
GTGTAAACCAGCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCGACGCTGGCTG
CAGGGACCCGGTGACAGCGTGAGAGGTTCGCAGAGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGC
TCAGGAGGCGTTGGAAAGTCTGCTTTGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAGGATTTGCATTAGTTTAT
TCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTGATGATGAATGGGATGCT
GGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAATGTGACCGGCTATGAGG
GCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAGTACCAAGGATACCCAGT
TCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGTGGTGCTCAAGATTGCCC
GCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTACAGCGGCAAGGTGGAGC
TGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTCACCCCCACGCATGACGG
TGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGTGTCCTTTGGGCGATCTG
TGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGCTGGAGCTCCCTATGCTG
AGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGCCCAGGCAGGGGACGCAG
GCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAGGGCCGTCCTGGCCCACG
TGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGAGCCCTTGGAACTGCTGT
GCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGCGGGGGCACCTGGGCCCG
GCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGCCATGGAGAAGGTGGCAT
CCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGCCTATGTTCGAGGGTCTG
GGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGTGCTGGAGGCTGTGGCAT
GGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCCCCCAGGACTGCGGCTGG
CCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGTAGGCCAGGATGGTGTGG
CAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAGACTACACAGCTTGGGGC
CCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGCGGGCAGTGCCCGCTCAG
GGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGTGGCCCTAGTCACTGGTG
CCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGCCCACACCGGGCACCCTTT
TCAGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTCCT
TTAATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTTCT
GTTCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTGTCCTGGAATTAGTTTTTCTAAAATGTGAATAAACTTGTTTTATAAAAA

>In-frame_RAP1B_ENST00000543697_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_2517nt
GCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCGACGCTGGCTGCAGGGACCCG
GTGACAGCGTGAGAGGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGT
CTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAAAAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAG
ATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGAACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAG
GATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTG
ATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAA
TGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAG
TACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGT
GGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTA
CAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTC
ACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGT
GTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGC
TGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGC
CCAGGCAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAG
GGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGA
GCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGC
GGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGC
CATGGAGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGC
CTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGT
GCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCC
CCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGT
AGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAG
ACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGC
GGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGT
GGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGGT
CTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTCCTTTAATT
TATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTTCTGTTCTT

>In-frame_RAP1B_ENST00000543697_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_2540nt
GCCGGAGCGGCGCGGCAGCGGCAGGACCGCCGTGGCGCCTAGAGTAGCGACCCGGGGGGAGCGCGGGGCGACGCTGGCTGCAGGGACCCG
GTGACAGCGTGAGAGGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGAAAGT
CTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAAAAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAAGTAG
ATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGAACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGACAAG
GATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGACACTG
ATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCTGCAA
TGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTGTCAG
TACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATGCCGT
GGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCAGCTA
CAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAACCTC
ACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGGCAGT
GTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGGAGGC
TGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGGGTGC
CCAGGCAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGAAAAG
GGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAGGGGA
GCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCACCTGC
GGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACATTGC
CATGGAGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCAAAGC
CTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTGTGGT
GCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTGGCCC
CCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTGGCGT
AGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGCTGAG
ACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACCAGGC
GGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAGGGGT
GGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCCAGCC
CACACCGGGCACCCTTTTCAGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCC
CTCTGTCCACTCTTCCTTTAATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCC
CCTCCCTCTGGCCTTCTGTTCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTGTCCTGGAATTAGTTTTTCTAAAATGTGAATA

>In-frame_RAP1B_ENST00000541216_chr12_69048032_+_IGSF8_ENST00000314485_chr1_160065036_-_2431nt
CCCGGTGACAGCGTGAGAGGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGA
AAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAAAAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAA
GTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGAACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGA
CAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGAC
ACTGATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCT
GCAATGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTG
TCAGTACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATG
CCGTGGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCA
GCTACAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAA
CCTCACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGG
CAGTGTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGG
AGGCTGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGG
GTGCCCAGGCAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGA
AAAGGGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAG
GGGAGCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCAC
CTGCGGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACA
TTGCCATGGAGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCA
AAGCCTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTG
TGGTGCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTG
GCCCCCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTG
GCGTAGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGC
TGAGACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACC
AGGCGGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAG
GGGTGGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCC
AGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCTCTCCCTCTGTCCACTCTTCCTTT
AATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCAAGCCCCTCCCTCTGGCCTTCTGT
TCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTGTCCTGGAATTAGTTTTTCTAAAATGTGAATAAACTTGTTTTATAAAAAGC

>In-frame_RAP1B_ENST00000541216_chr12_69048032_+_IGSF8_ENST00000368086_chr1_160065036_-_2454nt
CCCGGTGACAGCGTGAGAGGTACTAGGTTTTGACAAGCTTGCATCATGCGTGAGTATAAGCTAGTCGTTCTTGGCTCAGGAGGCGTTGGA
AAGTCTGCTTTGACTGTACAATTTGTTCAAGGAATTTTTGTAGAAAAATACGATCCTACGATAGAAGATTCTTATAGAAAGCAAGTTGAA
GTAGATGCACAACAGTGTATGCTTGAAATCTTGGATACTGCAGGAACGGAGCAATTTACAGCAATGAGGGATTTATACATGAAAAATGGA
CAAGGATTTGCATTAGTTTATTCCATCACAGCACAGTCCACATTTAACGATTTACAAGACCTGAGAGAACAGATTCTTCGAGTTAAAGAC
ACTGATGATGAATGGGATGCTGGGCCCGGGAGGTGCTGGTCCCCGAGGGGCCCTTGTACCGCGTGGCTGGCACAGCTGTCTCCATCTCCT
GCAATGTGACCGGCTATGAGGGCCCTGCCCAGCAGAACTTCGAGTGGTTCCTGTATAGGCCCGAGGCCCCAGATACTGCACTGGGCATTG
TCAGTACCAAGGATACCCAGTTCTCCTATGCTGTCTTCAAGTCCCGAGTGGTGGCGGGTGAGGTGCAGGTGCAGCGCCTACAAGGTGATG
CCGTGGTGCTCAAGATTGCCCGCCTGCAGGCCCAGGATGCCGGCATTTATGAGTGCCACACCCCCTCCACTGATACCCGCTACCTGGGCA
GCTACAGCGGCAAGGTGGAGCTGAGAGTTCTTCCAGATGTCCTCCAGGTGTCTGCTGCCCCCCCAGGGCCCCGAGGCCGCCAGGCCCCAA
CCTCACCCCCACGCATGACGGTGCATGAGGGGCAGGAGCTGGCACTGGGCTGCCTGGCGAGGACAAGCACACAGAAGCACACACACCTGG
CAGTGTCCTTTGGGCGATCTGTGCCCGAGGCACCAGTTGGGCGGTCAACTCTGCAGGAAGTGGTGGGAATCCGGTCAGACTTGGCCGTGG
AGGCTGGAGCTCCCTATGCTGAGCGATTGGCTGCAGGGGAGCTTCGTCTGGGCAAGGAAGGGACCGATCGGTACCGCATGGTAGTAGGGG
GTGCCCAGGCAGGGGACGCAGGCACCTACCACTGCACTGCCGCTGAGTGGATTCAGGATCCTGATGGCAGCTGGGCCCAGATTGCAGAGA
AAAGGGCCGTCCTGGCCCACGTGGATGTGCAGACGCTGTCCAGCCAGCTGGCAGTGACAGTGGGGCCTGGTGAACGTCGGATCGGCCCAG
GGGAGCCCTTGGAACTGCTGTGCAATGTGTCAGGGGCACTTCCCCCAGCAGGCCGTCATGCTGCATACTCTGTAGGTTGGGAGATGGCAC
CTGCGGGGGCACCTGGGCCCGGCCGCCTGGTAGCCCAGCTGGACACAGAGGGTGTGGGCAGCCTGGGCCCTGGCTATGAGGGCCGACACA
TTGCCATGGAGAAGGTGGCATCCAGAACATACCGGCTACGGCTAGAGGCTGCCAGGCCTGGTGATGCGGGCACCTACCGCTGCCTCGCCA
AAGCCTATGTTCGAGGGTCTGGGACCCGGCTTCGTGAAGCAGCCAGTGCCCGTTCCCGGCCTCTCCCTGTACATGTGCGGGAGGAAGGTG
TGGTGCTGGAGGCTGTGGCATGGCTAGCAGGAGGCACAGTGTACCGCGGGGAGACTGCCTCCCTGCTGTGCAACATCTCTGTGCGGGGTG
GCCCCCCAGGACTGCGGCTGGCCGCCAGCTGGTGGGTGGAGCGACCAGAGGACGGAGAGCTCAGCTCTGTCCCTGCCCAGCTGGTGGGTG
GCGTAGGCCAGGATGGTGTGGCAGAGCTGGGAGTCCGGCCTGGAGGAGGCCCTGTCAGCGTAGAGCTGGTGGGGCCCCGAAGCCATCGGC
TGAGACTACACAGCTTGGGGCCCGAGGATGAAGGCGTGTACCACTGTGCCCCCAGCGCCTGGGTGCAGCATGCCGACTACAGCTGGTACC
AGGCGGGCAGTGCCCGCTCAGGGCCTGTTACAGTCTACCCCTACATGCATGCCCTGGACACCCTATTTGTGCCTCTGCTGGTGGGTACAG
GGGTGGCCCTAGTCACTGGTGCCACTGTCCTTGGTACCATCACTTGCTGCTTCATGAAGAGGCTTCGAAAACGGTGATCCCTTACTCCCC
AGCCCACACCGGGCACCCTTTTCAGGTCTTGCAGGTGTCGACTGTCTTCCGGCCCAGCTCCAAGCCCTCCTCTGGTTGCCTGGACACCCT
CTCCCTCTGTCCACTCTTCCTTTAATTTATTTGACCTCCCACTACCCAGAATGGGAGACGTGCCTCCCCTTCCCCACTCCTTCCCTCCCA
AGCCCCTCCCTCTGGCCTTCTGTTCTTGATCTCTTAGGGATCCTATAGGGAGGCCATTTCCTGTCCTGGAATTAGTTTTTCTAAAATGTG


Top

FusionGenePPI for RAP1B_IGSF8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RAP1BRGL2, CHGB, A2M, TP53, CSAD, PKM, PDHB, SDF4, DDAH2, APLP1, UNC119, ALAS1, ZNF135, KMT2B, TLE1, CCT7, LRIF1, FAF1, KRIT1, APP, MOV10, MOGS, ILF2, VCAM1, FN1, ITGA4, RALGDS, RGS2, RAB7B, RPTOR, RASSF5, ZDHHC17, LPPR1, RASL10A, PLTP, RD3, CDC42, RAB5A, RAB5B, RAB5C, RAB7A, RAB8A, RAB8B, STX12, STX7, UQCRC2, DMXL1, KLC1, MAP3K4, XRCC1, ATP6AP2, LIMA1, UBR4, DICER1, AP3M1, GAR1, WRAP53, KIAA1191, AARS2, NCKAP5L, MRPS35, TSEN2, USP32, NRBP2, RAP1GDS1, GRPR, TMEM206, TRIM25IGSF8CD82, CD9, CD81, A2M, ACTN1, FLNA, NCL, AKT1, MSN, ACTN4, CFL1, ACTN2, MYH3, CFL2, FLNC, CSNK2A1, SERPINB9, IBTK, CCT3, CCT4, HIST1H1D, HIST1H1C, HIST1H1E, HIST1H2BD, HIST1H2BJ, HIST1H2BK, HIST1H2BH, HIST1H2BO, HIST1H2BL, HIST1H2BM, HIST1H2BN, HIST1H1A, HIST1H2BB, HIST1H2BE, HIST2H2BF, HIST1H3E, HIST3H3, HIST2H3C, H3F3B, RBBP4, HIST1H2BA, PKM, FTH1, PDIA6, FTL, EIF3A, XRCC6, DDX17, XRCC5, HNRNPU, SYNCRIP, SART3, EIF3L, PABPC1, EIF3B, EIF3C, EIF3CL, SUPT16H, HNRNPA2B1, YBX1, DHX15, HNRNPA1, SET, EIF3F, PRPF8, HNRNPK, NPM1, YBX3, EIF3E, HNRNPH1, ILF3, DDX3X, DDX5, MCM5, ILF2, ANP32B, EEF1A2, EIF3I, HNRNPD, EEF1G, HNRNPA3, SNRPD3, PDCD4, EIF3H, SNRPD1, SRSF3, PURA, YBX2, EEF1D, HNRNPM, DDX3Y, IFI16, SRP14, SNRPB, ALYREF, EIF3G, EIF3K, EEF1B2, SF3B3, TCOF1, SNRPA1, LSM3, IKBKAP, CAPRIN1, PCBP2, SRSF8, TUBB, TUBA1A, TUBA1B, TUBB4A, TUBA4A, TUBB7P, TUBB6, TUBA8, TUBE1, VPS35, RPS4X, RPS9, RPS18, RPL7A, RPS19, RPLP0, RPS3, RPL12, RPL6, RPS25, RPS8, RPLP2, RPS16, RPS2, RPS3A, RPL18, RPL4, RPL22, RPL27, RPS13, RPS4Y1, RPL30, RPS14, RPL5, RPL23A, RPL27A, RPL31, RPS6, RPL11, FAU, RPL13, RPL17, RPL8, RPL26L1, RPL35A, RPL35, RPL13A, RPL26, RPS15, RPL19, RPL9, RPS23, RPL24, RPL36, RPS28, RPS26P11, FBXO6, KRTAP10-4, KRTAP10-7, KRTAP10-9, KRTAP10-8, KRTAP10-3, EIF2B5, HADHB, TMEM160, EIF2B4, TBRG4, DNM3, EIF2B2, DNAJC14, ADPRHL2, DNAH14, HBD, HBA2, DAGLB, OCLN, MBLAC2, KRTAP4-12, GDPD5, TMX1, TMEM30B, CD19, EFNB3, RFX3, MMRN1, TMX4


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000250559+5825_67108554KRIT1
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000341355+5725_67108185KRIT1
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000393436+5825_67108534KRIT1
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000450214+3625_6766379KRIT1
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000537460+6925_67108180KRIT1
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000539091+3625_6766224KRIT1
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000540209+4725_6789323KRIT1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneRAP1Bchr12:69048032chr1:160065036ENST00000542145+1725_67-47258KRIT1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RAP1B_IGSF8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RAP1B_IGSF8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource