FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3029

FusionGeneSummary for ASPSCR1_TFE3

check button Fusion gene summary
Fusion gene informationFusion gene name: ASPSCR1_TFE3
Fusion gene ID: 3029
HgeneTgene
Gene symbol

ASPSCR1

TFE3

Gene ID

79058

7030

Gene nameASPSCR1, UBX domain containing tether for SLC2A4transcription factor binding to IGHM enhancer 3
SynonymsASPCR1|ASPL|ASPS|RCC17|TUG|UBXD9|UBXN9RCCP2|RCCX1|TFEA|bHLHe33
Cytomap

17q25.3

Xp11.23

Type of geneprotein-codingprotein-coding
Descriptiontether containing UBX domain for GLUT4UBX domain protein 9UBX domain-containing protein 9alveolar soft part sarcoma chromosomal region candidate gene 1 proteinalveolar soft part sarcoma chromosome region, candidate 1alveolar soft part sarcoma locusrtranscription factor E3class E basic helix-loop-helix protein 33transcription factor E family, member Atranscription factor for IgH enhancertranscription factor for immunoglobulin heavy-chain enhancer 3
Modification date2018051920180527
UniProtAcc

Q9BZE9

P19532

Ensembl transtripts involved in fusion geneENST00000306729, ENST00000306739, 
ENST00000580534, ENST00000581647, 
ENST00000582404, 
ENST00000315869, 
ENST00000487451, 
Fusion gene scores* DoF score3 X 3 X 3=2710 X 9 X 4=360
# samples 419
** MAII scorelog2(4/27*10)=0.567040592723894
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(19/360*10)=-0.921997487998727
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ASPSCR1 [Title/Abstract] AND TFE3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1AY034077ASPSCR1chr17

79954722

+TFE3chrX

48891767

-
ChiTaRS3.1AY034078ASPSCR1chr17

79954722

+TFE3chrX

48895640

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000306729ENST00000315869ASPSCR1chr17

79954722

+TFE3chrX

48891767

-
5CDS-5UTRENST00000306729ENST00000487451ASPSCR1chr17

79954722

+TFE3chrX

48891767

-
In-frameENST00000306739ENST00000315869ASPSCR1chr17

79954722

+TFE3chrX

48891767

-
5CDS-5UTRENST00000306739ENST00000487451ASPSCR1chr17

79954722

+TFE3chrX

48891767

-
In-frameENST00000580534ENST00000315869ASPSCR1chr17

79954722

+TFE3chrX

48891767

-
5CDS-5UTRENST00000580534ENST00000487451ASPSCR1chr17

79954722

+TFE3chrX

48891767

-
intron-3CDSENST00000581647ENST00000315869ASPSCR1chr17

79954722

+TFE3chrX

48891767

-
intron-5UTRENST00000581647ENST00000487451ASPSCR1chr17

79954722

+TFE3chrX

48891767

-
intron-3CDSENST00000582404ENST00000315869ASPSCR1chr17

79954722

+TFE3chrX

48891767

-
intron-5UTRENST00000582404ENST00000487451ASPSCR1chr17

79954722

+TFE3chrX

48891767

-
In-frameENST00000306729ENST00000315869ASPSCR1chr17

79954722

+TFE3chrX

48895640

-
5CDS-5UTRENST00000306729ENST00000487451ASPSCR1chr17

79954722

+TFE3chrX

48895640

-
In-frameENST00000306739ENST00000315869ASPSCR1chr17

79954722

+TFE3chrX

48895640

-
5CDS-5UTRENST00000306739ENST00000487451ASPSCR1chr17

79954722

+TFE3chrX

48895640

-
In-frameENST00000580534ENST00000315869ASPSCR1chr17

79954722

+TFE3chrX

48895640

-
5CDS-5UTRENST00000580534ENST00000487451ASPSCR1chr17

79954722

+TFE3chrX

48895640

-
intron-3CDSENST00000581647ENST00000315869ASPSCR1chr17

79954722

+TFE3chrX

48895640

-
intron-5UTRENST00000581647ENST00000487451ASPSCR1chr17

79954722

+TFE3chrX

48895640

-
intron-3CDSENST00000582404ENST00000315869ASPSCR1chr17

79954722

+TFE3chrX

48895640

-
intron-5UTRENST00000582404ENST00000487451ASPSCR1chr17

79954722

+TFE3chrX

48895640

-

Top

FusionProtFeatures for ASPSCR1_TFE3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ASPSCR1

Q9BZE9

TFE3

P19532

Tethering protein that sequesters GLUT4-containingvesicles in the cytoplasm in the absence of insulin. Modulates theamount of GLUT4 that is available at the cell surface (Bysimilarity). Enhances VCP methylation catalyzed by VCPKMT.{ECO:0000250, ECO:0000269|PubMed:23349634}. Transcription factor that specifically recognizes andbinds E-box sequences (5'-CANNTG-3'). Efficient DNA-bindingrequires dimerization with itself or with another MiT/TFE familymember such as TFEB or MITF. In association with TFEB, activatesthe expression of CD40L in T-cells, thereby playing a role in T-cell-dependent antibody responses in activated CD4(+) T-cells andthymus-dependent humoral immunity. Specifically recognizes theMUE3 box, a subset of E-boxes, present in the immunoglobulinenhancer. It also binds very well to a USF/MLTF site.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTFE3chr17:79954722chrX:48891767ENST00000315869-410346_399295576DomainbHLH
TgeneTFE3chr17:79954722chrX:48895640ENST00000315869-310346_399260576DomainbHLH
TgeneTFE3chr17:79954722chrX:48891767ENST00000315869-410409_430295576RegionNote=Leucine-zipper
TgeneTFE3chr17:79954722chrX:48895640ENST00000315869-310260_271260576RegionStrong transcription activation domain
TgeneTFE3chr17:79954722chrX:48895640ENST00000315869-310409_430260576RegionNote=Leucine-zipper

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneASPSCR1chr17:79954722chrX:48891767ENST00000306729+717386_462311648DomainUBX
HgeneASPSCR1chr17:79954722chrX:48891767ENST00000306739+716386_462311554DomainUBX
HgeneASPSCR1chr17:79954722chrX:48891767ENST00000580534+615386_462234502DomainUBX
HgeneASPSCR1chr17:79954722chrX:48895640ENST00000306729+717386_462311648DomainUBX
HgeneASPSCR1chr17:79954722chrX:48895640ENST00000306739+716386_462311554DomainUBX
HgeneASPSCR1chr17:79954722chrX:48895640ENST00000580534+615386_462234502DomainUBX
TgeneTFE3chr17:79954722chrX:48891767ENST00000315869-410260_271295576RegionStrong transcription activation domain


Top

FusionGeneSequence for ASPSCR1_TFE3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ASPSCR1_ENST00000306729_chr17_79954722_+_TFE3_ENST00000315869_chrX_48891767_-_592aa
MAAPAGGGGSAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPCETDLKFQRSVLDLSLQWRFANLPNNAKLEMVPASRSREGPEN
MVRIALQLDDGSRLQDSFCSGQTLWELLSHFPQIRECLQHPGGATPVCVYTRDEVTGEAALRGTTLQSLGLTGGSATIRFVMKCYDPVGK
TPGSLGSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSSAKLP
KSLSSPGGPSKPKKSKSGQDPQQEQEQERERDPQQEQERERLPVSGNLLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKE
RQKKDNHNLIERRRRFNINDRIKELGTLIPKSSDPEMRWNKGTILKASVDTIRKLQKEQQRSKDLESRQRSLEQANRSLQLRIQELELQA
QIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDI

>In-frame_ASPSCR1_ENST00000306739_chr17_79954722_+_TFE3_ENST00000315869_chrX_48891767_-_592aa
MAAPAGGGGSAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPCETDLKFQRSVLDLSLQWRFANLPNNAKLEMVPASRSREGPEN
MVRIALQLDDGSRLQDSFCSGQTLWELLSHFPQIRECLQHPGGATPVCVYTRDEVTGEAALRGTTLQSLGLTGGSATIRFVMKCYDPVGK
TPGSLGSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSSAKLP
KSLSSPGGPSKPKKSKSGQDPQQEQEQERERDPQQEQERERLPVSGNLLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKE
RQKKDNHNLIERRRRFNINDRIKELGTLIPKSSDPEMRWNKGTILKASVDTIRKLQKEQQRSKDLESRQRSLEQANRSLQLRIQELELQA
QIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDI

>In-frame_ASPSCR1_ENST00000306729_chr17_79954722_+_TFE3_ENST00000315869_chrX_48895640_-_627aa
MAAPAGGGGSAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPCETDLKFQRSVLDLSLQWRFANLPNNAKLEMVPASRSREGPEN
MVRIALQLDDGSRLQDSFCSGQTLWELLSHFPQIRECLQHPGGATPVCVYTRDEVTGEAALRGTTLQSLGLTGGSATIRFVMKCYDPVGK
TPGSLGSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSSAKLP
KSLSSPGGPSKPKKSKSGQDPQQEQEQERERDPQQEQERERIDDVIDEIISLESSYNDEMLSTLPGGTTGLQLPSTLPVSGNLLDVYSSQ
GVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSSDPEMRWNKGTILKASVDTIRKL
QKEQQRSKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPH

>In-frame_ASPSCR1_ENST00000306739_chr17_79954722_+_TFE3_ENST00000315869_chrX_48895640_-_627aa
MAAPAGGGGSAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPCETDLKFQRSVLDLSLQWRFANLPNNAKLEMVPASRSREGPEN
MVRIALQLDDGSRLQDSFCSGQTLWELLSHFPQIRECLQHPGGATPVCVYTRDEVTGEAALRGTTLQSLGLTGGSATIRFVMKCYDPVGK
TPGSLGSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSSAKLP
KSLSSPGGPSKPKKSKSGQDPQQEQEQERERDPQQEQERERIDDVIDEIISLESSYNDEMLSTLPGGTTGLQLPSTLPVSGNLLDVYSSQ
GVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSSDPEMRWNKGTILKASVDTIRKL
QKEQQRSKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ASPSCR1_ENST00000306729_chr17_79954722_+_TFE3_ENST00000315869_chrX_48891767_-_1776nt
ATGGCGGCCCCGGCAGGCGGCGGAGGCTCCGCGGTGTCGGTGCTGGCCCCGAACGGCCGGCGCCACACGGTGAAGGTGACGCCGAGCACC
GTGCTGCTTCAGGTTCTGGAGGACACGTGCCGGCGGCAGGACTTCAACCCCTGTGAATATGATCTGAAGTTTCAGAGGAGCGTGCTCGAC
CTTTCTCTCCAGTGGAGATTTGCCAACCTGCCCAACAATGCCAAGCTGGAGATGGTGCCCGCTTCCCGGAGCCGTGAGGGGCCTGAGAAC
ATGGTTCGCATCGCTTTGCAGCTGGACGATGGCTCGAGGTTGCAGGACTCTTTCTGTTCAGGCCAGACCCTCTGGGAGCTTCTCAGCCAT
TTTCCACAGATCAGGGAGTGCCTGCAGCACCCCGGCGGGGCCACCCCAGTCTGCGTGTACACGAGGGATGAGGTGACGGGTGAAGCTGCC
CTGCGGGGCACGACGCTGCAGTCGCTGGGCCTGACCGGGGGCAGCGCCACCATCAGGTTTGTCATGAAGTGCTACGACCCCGTGGGCAAG
ACCCCAGGAAGCCTGGGCTCGTCAGCGTCGGCTGGCCAGGCAGCCGCCAGCGCTCCACTTCCCTTGGAATCTGGGGAGCTCAGCCGCGGC
GACTTGAGCCGTCCGGAGGACGCGGACACCTCAGGGCCCTGCTGCGAGCACACTCAGGAGAAGCAGAGCACAAGGGCACCCGCAGCTGCC
CCCTTTGTTCCTTTCTCGGGTGGGGGACAGAGACTGGGGGGCCCTCCTGGGCCCACGAGGCCTCTGACATCATCTTCAGCTAAGTTGCCG
AAGTCCCTCTCCAGCCCTGGAGGCCCCTCCAAGCCAAAGAAGTCCAAGTCGGGCCAGGATCCCCAGCAGGAGCAGGAGCAGGAGCGGGAG
CGGGATCCCCAGCAGGAGCAGGAGCGGGAGCGGCTGCCTGTGTCAGGGAATCTGCTTGATGTGTACAGTAGTCAAGGCGTGGCCACACCA
GCCATCACTGTCAGCAACTCCTGCCCAGCTGAGCTGCCCAACATCAAACGGGAGATCTCTGAGACCGAGGCAAAGGCCCTTTTGAAGGAA
CGGCAGAAGAAAGACAATCACAACCTAATTGAGCGTCGCAGGCGATTCAACATTAACGACAGGATCAAGGAACTGGGCACTCTCATCCCT
AAGTCCAGTGACCCGGAGATGCGCTGGAACAAGGGCACCATCCTGAAGGCCTCTGTGGATTATATCCGCAAGCTGCAGAAGGAGCAGCAG
CGCTCCAAAGACCTGGAGAGCCGGCAGCGATCCCTGGAGCAGGCCAACCGCAGCCTGCAGCTCCGAATTCAGGAACTAGAACTGCAGGCC
CAGATCCATGGCCTGCCAGTACCTCCCACTCCAGGGCTGCTTTCCTTGGCCACGACTTCGGCTTCTGACAGCCTCAAGCCAGAGCAGCTG
GACATTGAGGAGGAGGGCAGGCCAGGCGCAGCAACGTTCCATGTAGGGGGGGGACCTGCCCAGAATGCTCCCCATCAGCAGCCCCCTGCA
CCGCCCTCAGATGCCCTTCTGGACCTGCACTTTCCCAGCGACCACCTGGGGGACCTGGGAGACCCCTTCCACCTGGGGCTGGAGGACATT
CTGATGGAGGAGGAGGAGGGGGTGGTGGGAGGACTGTCGGGGGGTGCCCTGTCCCCACTGCGGGCTGCCTCCGATCCCCTGCTCTCTTCA

>In-frame_ASPSCR1_ENST00000306739_chr17_79954722_+_TFE3_ENST00000315869_chrX_48891767_-_1776nt
ATGGCGGCCCCGGCAGGCGGCGGAGGCTCCGCGGTGTCGGTGCTGGCCCCGAACGGCCGGCGCCACACGGTGAAGGTGACGCCGAGCACC
GTGCTGCTTCAGGTTCTGGAGGACACGTGCCGGCGGCAGGACTTCAACCCCTGTGAATATGATCTGAAGTTTCAGAGGAGCGTGCTCGAC
CTTTCTCTCCAGTGGAGATTTGCCAACCTGCCCAACAATGCCAAGCTGGAGATGGTGCCCGCTTCCCGGAGCCGTGAGGGGCCTGAGAAC
ATGGTTCGCATCGCTTTGCAGCTGGACGATGGCTCGAGGTTGCAGGACTCTTTCTGTTCAGGCCAGACCCTCTGGGAGCTTCTCAGCCAT
TTTCCACAGATCAGGGAGTGCCTGCAGCACCCCGGCGGGGCCACCCCAGTCTGCGTGTACACGAGGGATGAGGTGACGGGTGAAGCTGCC
CTGCGGGGCACGACGCTGCAGTCGCTGGGCCTGACCGGGGGCAGCGCCACCATCAGGTTTGTCATGAAGTGCTACGACCCCGTGGGCAAG
ACCCCAGGAAGCCTGGGCTCGTCAGCGTCGGCTGGCCAGGCAGCCGCCAGCGCTCCACTTCCCTTGGAATCTGGGGAGCTCAGCCGCGGC
GACTTGAGCCGTCCGGAGGACGCGGACACCTCAGGGCCCTGCTGCGAGCACACTCAGGAGAAGCAGAGCACAAGGGCACCCGCAGCTGCC
CCCTTTGTTCCTTTCTCGGGTGGGGGACAGAGACTGGGGGGCCCTCCTGGGCCCACGAGGCCTCTGACATCATCTTCAGCTAAGTTGCCG
AAGTCCCTCTCCAGCCCTGGAGGCCCCTCCAAGCCAAAGAAGTCCAAGTCGGGCCAGGATCCCCAGCAGGAGCAGGAGCAGGAGCGGGAG
CGGGATCCCCAGCAGGAGCAGGAGCGGGAGCGGCTGCCTGTGTCAGGGAATCTGCTTGATGTGTACAGTAGTCAAGGCGTGGCCACACCA
GCCATCACTGTCAGCAACTCCTGCCCAGCTGAGCTGCCCAACATCAAACGGGAGATCTCTGAGACCGAGGCAAAGGCCCTTTTGAAGGAA
CGGCAGAAGAAAGACAATCACAACCTAATTGAGCGTCGCAGGCGATTCAACATTAACGACAGGATCAAGGAACTGGGCACTCTCATCCCT
AAGTCCAGTGACCCGGAGATGCGCTGGAACAAGGGCACCATCCTGAAGGCCTCTGTGGATTATATCCGCAAGCTGCAGAAGGAGCAGCAG
CGCTCCAAAGACCTGGAGAGCCGGCAGCGATCCCTGGAGCAGGCCAACCGCAGCCTGCAGCTCCGAATTCAGGAACTAGAACTGCAGGCC
CAGATCCATGGCCTGCCAGTACCTCCCACTCCAGGGCTGCTTTCCTTGGCCACGACTTCGGCTTCTGACAGCCTCAAGCCAGAGCAGCTG
GACATTGAGGAGGAGGGCAGGCCAGGCGCAGCAACGTTCCATGTAGGGGGGGGACCTGCCCAGAATGCTCCCCATCAGCAGCCCCCTGCA
CCGCCCTCAGATGCCCTTCTGGACCTGCACTTTCCCAGCGACCACCTGGGGGACCTGGGAGACCCCTTCCACCTGGGGCTGGAGGACATT
CTGATGGAGGAGGAGGAGGGGGTGGTGGGAGGACTGTCGGGGGGTGCCCTGTCCCCACTGCGGGCTGCCTCCGATCCCCTGCTCTCTTCA

>In-frame_ASPSCR1_ENST00000306729_chr17_79954722_+_TFE3_ENST00000315869_chrX_48895640_-_1881nt
ATGGCGGCCCCGGCAGGCGGCGGAGGCTCCGCGGTGTCGGTGCTGGCCCCGAACGGCCGGCGCCACACGGTGAAGGTGACGCCGAGCACC
GTGCTGCTTCAGGTTCTGGAGGACACGTGCCGGCGGCAGGACTTCAACCCCTGTGAATATGATCTGAAGTTTCAGAGGAGCGTGCTCGAC
CTTTCTCTCCAGTGGAGATTTGCCAACCTGCCCAACAATGCCAAGCTGGAGATGGTGCCCGCTTCCCGGAGCCGTGAGGGGCCTGAGAAC
ATGGTTCGCATCGCTTTGCAGCTGGACGATGGCTCGAGGTTGCAGGACTCTTTCTGTTCAGGCCAGACCCTCTGGGAGCTTCTCAGCCAT
TTTCCACAGATCAGGGAGTGCCTGCAGCACCCCGGCGGGGCCACCCCAGTCTGCGTGTACACGAGGGATGAGGTGACGGGTGAAGCTGCC
CTGCGGGGCACGACGCTGCAGTCGCTGGGCCTGACCGGGGGCAGCGCCACCATCAGGTTTGTCATGAAGTGCTACGACCCCGTGGGCAAG
ACCCCAGGAAGCCTGGGCTCGTCAGCGTCGGCTGGCCAGGCAGCCGCCAGCGCTCCACTTCCCTTGGAATCTGGGGAGCTCAGCCGCGGC
GACTTGAGCCGTCCGGAGGACGCGGACACCTCAGGGCCCTGCTGCGAGCACACTCAGGAGAAGCAGAGCACAAGGGCACCCGCAGCTGCC
CCCTTTGTTCCTTTCTCGGGTGGGGGACAGAGACTGGGGGGCCCTCCTGGGCCCACGAGGCCTCTGACATCATCTTCAGCTAAGTTGCCG
AAGTCCCTCTCCAGCCCTGGAGGCCCCTCCAAGCCAAAGAAGTCCAAGTCGGGCCAGGATCCCCAGCAGGAGCAGGAGCAGGAGCGGGAG
CGGGATCCCCAGCAGGAGCAGGAGCGGGAGCGGATTGATGATGTCATTGATGAGATCATCAGCCTGGAGTCCAGTTACAATGATGAAATG
CTCAGCTATCTGCCCGGAGGCACCACAGGACTGCAGCTCCCCAGCACGCTGCCTGTGTCAGGGAATCTGCTTGATGTGTACAGTAGTCAA
GGCGTGGCCACACCAGCCATCACTGTCAGCAACTCCTGCCCAGCTGAGCTGCCCAACATCAAACGGGAGATCTCTGAGACCGAGGCAAAG
GCCCTTTTGAAGGAACGGCAGAAGAAAGACAATCACAACCTAATTGAGCGTCGCAGGCGATTCAACATTAACGACAGGATCAAGGAACTG
GGCACTCTCATCCCTAAGTCCAGTGACCCGGAGATGCGCTGGAACAAGGGCACCATCCTGAAGGCCTCTGTGGATTATATCCGCAAGCTG
CAGAAGGAGCAGCAGCGCTCCAAAGACCTGGAGAGCCGGCAGCGATCCCTGGAGCAGGCCAACCGCAGCCTGCAGCTCCGAATTCAGGAA
CTAGAACTGCAGGCCCAGATCCATGGCCTGCCAGTACCTCCCACTCCAGGGCTGCTTTCCTTGGCCACGACTTCGGCTTCTGACAGCCTC
AAGCCAGAGCAGCTGGACATTGAGGAGGAGGGCAGGCCAGGCGCAGCAACGTTCCATGTAGGGGGGGGACCTGCCCAGAATGCTCCCCAT
CAGCAGCCCCCTGCACCGCCCTCAGATGCCCTTCTGGACCTGCACTTTCCCAGCGACCACCTGGGGGACCTGGGAGACCCCTTCCACCTG
GGGCTGGAGGACATTCTGATGGAGGAGGAGGAGGGGGTGGTGGGAGGACTGTCGGGGGGTGCCCTGTCCCCACTGCGGGCTGCCTCCGAT

>In-frame_ASPSCR1_ENST00000306739_chr17_79954722_+_TFE3_ENST00000315869_chrX_48895640_-_1881nt
ATGGCGGCCCCGGCAGGCGGCGGAGGCTCCGCGGTGTCGGTGCTGGCCCCGAACGGCCGGCGCCACACGGTGAAGGTGACGCCGAGCACC
GTGCTGCTTCAGGTTCTGGAGGACACGTGCCGGCGGCAGGACTTCAACCCCTGTGAATATGATCTGAAGTTTCAGAGGAGCGTGCTCGAC
CTTTCTCTCCAGTGGAGATTTGCCAACCTGCCCAACAATGCCAAGCTGGAGATGGTGCCCGCTTCCCGGAGCCGTGAGGGGCCTGAGAAC
ATGGTTCGCATCGCTTTGCAGCTGGACGATGGCTCGAGGTTGCAGGACTCTTTCTGTTCAGGCCAGACCCTCTGGGAGCTTCTCAGCCAT
TTTCCACAGATCAGGGAGTGCCTGCAGCACCCCGGCGGGGCCACCCCAGTCTGCGTGTACACGAGGGATGAGGTGACGGGTGAAGCTGCC
CTGCGGGGCACGACGCTGCAGTCGCTGGGCCTGACCGGGGGCAGCGCCACCATCAGGTTTGTCATGAAGTGCTACGACCCCGTGGGCAAG
ACCCCAGGAAGCCTGGGCTCGTCAGCGTCGGCTGGCCAGGCAGCCGCCAGCGCTCCACTTCCCTTGGAATCTGGGGAGCTCAGCCGCGGC
GACTTGAGCCGTCCGGAGGACGCGGACACCTCAGGGCCCTGCTGCGAGCACACTCAGGAGAAGCAGAGCACAAGGGCACCCGCAGCTGCC
CCCTTTGTTCCTTTCTCGGGTGGGGGACAGAGACTGGGGGGCCCTCCTGGGCCCACGAGGCCTCTGACATCATCTTCAGCTAAGTTGCCG
AAGTCCCTCTCCAGCCCTGGAGGCCCCTCCAAGCCAAAGAAGTCCAAGTCGGGCCAGGATCCCCAGCAGGAGCAGGAGCAGGAGCGGGAG
CGGGATCCCCAGCAGGAGCAGGAGCGGGAGCGGATTGATGATGTCATTGATGAGATCATCAGCCTGGAGTCCAGTTACAATGATGAAATG
CTCAGCTATCTGCCCGGAGGCACCACAGGACTGCAGCTCCCCAGCACGCTGCCTGTGTCAGGGAATCTGCTTGATGTGTACAGTAGTCAA
GGCGTGGCCACACCAGCCATCACTGTCAGCAACTCCTGCCCAGCTGAGCTGCCCAACATCAAACGGGAGATCTCTGAGACCGAGGCAAAG
GCCCTTTTGAAGGAACGGCAGAAGAAAGACAATCACAACCTAATTGAGCGTCGCAGGCGATTCAACATTAACGACAGGATCAAGGAACTG
GGCACTCTCATCCCTAAGTCCAGTGACCCGGAGATGCGCTGGAACAAGGGCACCATCCTGAAGGCCTCTGTGGATTATATCCGCAAGCTG
CAGAAGGAGCAGCAGCGCTCCAAAGACCTGGAGAGCCGGCAGCGATCCCTGGAGCAGGCCAACCGCAGCCTGCAGCTCCGAATTCAGGAA
CTAGAACTGCAGGCCCAGATCCATGGCCTGCCAGTACCTCCCACTCCAGGGCTGCTTTCCTTGGCCACGACTTCGGCTTCTGACAGCCTC
AAGCCAGAGCAGCTGGACATTGAGGAGGAGGGCAGGCCAGGCGCAGCAACGTTCCATGTAGGGGGGGGACCTGCCCAGAATGCTCCCCAT
CAGCAGCCCCCTGCACCGCCCTCAGATGCCCTTCTGGACCTGCACTTTCCCAGCGACCACCTGGGGGACCTGGGAGACCCCTTCCACCTG
GGGCTGGAGGACATTCTGATGGAGGAGGAGGAGGGGGTGGTGGGAGGACTGTCGGGGGGTGCCCTGTCCCCACTGCGGGCTGCCTCCGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ASPSCR1_ENST00000306729_chr17_79954722_+_TFE3_ENST00000315869_chrX_48891767_-_3300nt
GCTGCGGCCCCGCCCCCTGGCCGCGTGGCTGCGCGTCCTGGCTGTTGCCGATAAAGTTGTTTGACGCCGGCCCGGCGGCGGGTCACGTGA
GCGGAAAATGGCGGCCCCGGCAGGCGGCGGAGGCTCCGCGGTGTCGGTGCTGGCCCCGAACGGCCGGCGCCACACGGTGAAGGTGACGCC
GAGCACCGTGCTGCTTCAGGTTCTGGAGGACACGTGCCGGCGGCAGGACTTCAACCCCTGTGAATATGATCTGAAGTTTCAGAGGAGCGT
GCTCGACCTTTCTCTCCAGTGGAGATTTGCCAACCTGCCCAACAATGCCAAGCTGGAGATGGTGCCCGCTTCCCGGAGCCGTGAGGGGCC
TGAGAACATGGTTCGCATCGCTTTGCAGCTGGACGATGGCTCGAGGTTGCAGGACTCTTTCTGTTCAGGCCAGACCCTCTGGGAGCTTCT
CAGCCATTTTCCACAGATCAGGGAGTGCCTGCAGCACCCCGGCGGGGCCACCCCAGTCTGCGTGTACACGAGGGATGAGGTGACGGGTGA
AGCTGCCCTGCGGGGCACGACGCTGCAGTCGCTGGGCCTGACCGGGGGCAGCGCCACCATCAGGTTTGTCATGAAGTGCTACGACCCCGT
GGGCAAGACCCCAGGAAGCCTGGGCTCGTCAGCGTCGGCTGGCCAGGCAGCCGCCAGCGCTCCACTTCCCTTGGAATCTGGGGAGCTCAG
CCGCGGCGACTTGAGCCGTCCGGAGGACGCGGACACCTCAGGGCCCTGCTGCGAGCACACTCAGGAGAAGCAGAGCACAAGGGCACCCGC
AGCTGCCCCCTTTGTTCCTTTCTCGGGTGGGGGACAGAGACTGGGGGGCCCTCCTGGGCCCACGAGGCCTCTGACATCATCTTCAGCTAA
GTTGCCGAAGTCCCTCTCCAGCCCTGGAGGCCCCTCCAAGCCAAAGAAGTCCAAGTCGGGCCAGGATCCCCAGCAGGAGCAGGAGCAGGA
GCGGGAGCGGGATCCCCAGCAGGAGCAGGAGCGGGAGCGGCTGCCTGTGTCAGGGAATCTGCTTGATGTGTACAGTAGTCAAGGCGTGGC
CACACCAGCCATCACTGTCAGCAACTCCTGCCCAGCTGAGCTGCCCAACATCAAACGGGAGATCTCTGAGACCGAGGCAAAGGCCCTTTT
GAAGGAACGGCAGAAGAAAGACAATCACAACCTAATTGAGCGTCGCAGGCGATTCAACATTAACGACAGGATCAAGGAACTGGGCACTCT
CATCCCTAAGTCCAGTGACCCGGAGATGCGCTGGAACAAGGGCACCATCCTGAAGGCCTCTGTGGATTATATCCGCAAGCTGCAGAAGGA
GCAGCAGCGCTCCAAAGACCTGGAGAGCCGGCAGCGATCCCTGGAGCAGGCCAACCGCAGCCTGCAGCTCCGAATTCAGGAACTAGAACT
GCAGGCCCAGATCCATGGCCTGCCAGTACCTCCCACTCCAGGGCTGCTTTCCTTGGCCACGACTTCGGCTTCTGACAGCCTCAAGCCAGA
GCAGCTGGACATTGAGGAGGAGGGCAGGCCAGGCGCAGCAACGTTCCATGTAGGGGGGGGACCTGCCCAGAATGCTCCCCATCAGCAGCC
CCCTGCACCGCCCTCAGATGCCCTTCTGGACCTGCACTTTCCCAGCGACCACCTGGGGGACCTGGGAGACCCCTTCCACCTGGGGCTGGA
GGACATTCTGATGGAGGAGGAGGAGGGGGTGGTGGGAGGACTGTCGGGGGGTGCCCTGTCCCCACTGCGGGCTGCCTCCGATCCCCTGCT
CTCTTCAGTGTCCCCTGCTGTCTCCAAGGCCAGCAGCCGCCGCAGCAGCTTCAGCATGGAAGAGGAGTCCTGATCAGGCCTCACCCCTCC
CCTGGGACTTTCCCACCCAGGAAAGGAGGACCAGTCAGGATGAGGCCCCGCCTTTTCCCCCACCCTCCCATGAGACTGCCCTGCCCAGGT
ATCCTGGGGGAAGAGGAGATGTGATCAGGCCCCACCCCTGTAATCAGGCAAGGAGGAGGAGTCAGATGAGGCCCTGCACCTTCCCCAAAG
GAACCGCCCAGTGCAGGTATTTCAGAAGGAGAAGGCTGGAGAAGGACATGAGATCAGGGCCTGCCCCCTGGGGATCACAGCCTCACCCCT
GCCCCTGTGGGACTCATCCTTGCCCAGGTGAGGGAAGGAGACAGGATGAGGTCTCGACCCTGTCCCCTAGGGACTGTCCTAGCCAGGTCT
CCTGGGAAAGGGAGATGTCAGGATGTTGCTCCATCCTTTGTCTTGGAACCACCAGTCTAGTCCGTCCTGGCACAGAAGAGGAGTCAAGTA
ATGGAGGTCCCAGCCCTGGGGGTTTAAGCTCTGCCCCTTCCCCATGAACCCTGCCCTGCTCTGCCCAGGCAAGGAACAGAAGTGAGGATG
AGACCCAGCCCCTTCCCCTGGGAACTCTCCTGGCCTTCTAGGAATGGAGGAGCCAGGCCCCACCCCTTCCCTATAGGAACAGCCCAGCAC
AGGTATTTCAGGTGTGAAAGAATCAGTAGGACCAGGCCACCGCTAGTGCTTGTGGAGATCACAGCCCCACCCTTGTCCCTCAGCAACATC
CCATCTAAGCATTCCACACTGCAGGGAGGAGTGGTACTTAAGCTCCCCTGCCTTAACCTGGGACCAACCTGACCTAACCTAGGAGGGCTC
TGAGCCAACCTTGCTCTTGGGGAAGGGGACAGATTATGAAATTTCATGGATGAATTTTCCAGACCTATATCTGGAGTGAGAGGCCCCCAC
CCTTGGGCAGAGTCCTGCCTTCTTCCTTGAGGGGCAGTTTGGGAAGGTGATGGGTATTAGTGGGGGACTGAGTTCAGGTTACCAGAACCA
GTACCTCAGTATTCTTTTTCAACATGTAGGGCAAGAGGATGAAGGAAGGGGCTATCCTGGGACCTCCCCAGCCCAGGAAAAACTGGAAGC
CTTCCCCCAGCAAGGCAGAAGCTTGGAGGAGGGTTGTAAAAGCATATTGTACCCCCTCATTTGTTTATCTGATTTTTTTATTGCTCCGCA
TACTGAGAATCTAGGCCACCCCAACCTCTGTTCCCCACCCAGTTCTTCATTTGGAGGAATCACCCCATTTCAGAGTTATCAAGAGACACT
CCCCCCTCCATTCCCACCCCTCATACCTACACCCAAGGTTGTCAGCTTTGGATTGCTGGGGCCAGGCCCCATGGAGGGTATACTGAGGGG

>In-frame_ASPSCR1_ENST00000306739_chr17_79954722_+_TFE3_ENST00000315869_chrX_48891767_-_3300nt
GCTGCGGCCCCGCCCCCTGGCCGCGTGGCTGCGCGTCCTGGCTGTTGCCGATAAAGTTGTTTGACGCCGGCCCGGCGGCGGGTCACGTGA
GCGGAAAATGGCGGCCCCGGCAGGCGGCGGAGGCTCCGCGGTGTCGGTGCTGGCCCCGAACGGCCGGCGCCACACGGTGAAGGTGACGCC
GAGCACCGTGCTGCTTCAGGTTCTGGAGGACACGTGCCGGCGGCAGGACTTCAACCCCTGTGAATATGATCTGAAGTTTCAGAGGAGCGT
GCTCGACCTTTCTCTCCAGTGGAGATTTGCCAACCTGCCCAACAATGCCAAGCTGGAGATGGTGCCCGCTTCCCGGAGCCGTGAGGGGCC
TGAGAACATGGTTCGCATCGCTTTGCAGCTGGACGATGGCTCGAGGTTGCAGGACTCTTTCTGTTCAGGCCAGACCCTCTGGGAGCTTCT
CAGCCATTTTCCACAGATCAGGGAGTGCCTGCAGCACCCCGGCGGGGCCACCCCAGTCTGCGTGTACACGAGGGATGAGGTGACGGGTGA
AGCTGCCCTGCGGGGCACGACGCTGCAGTCGCTGGGCCTGACCGGGGGCAGCGCCACCATCAGGTTTGTCATGAAGTGCTACGACCCCGT
GGGCAAGACCCCAGGAAGCCTGGGCTCGTCAGCGTCGGCTGGCCAGGCAGCCGCCAGCGCTCCACTTCCCTTGGAATCTGGGGAGCTCAG
CCGCGGCGACTTGAGCCGTCCGGAGGACGCGGACACCTCAGGGCCCTGCTGCGAGCACACTCAGGAGAAGCAGAGCACAAGGGCACCCGC
AGCTGCCCCCTTTGTTCCTTTCTCGGGTGGGGGACAGAGACTGGGGGGCCCTCCTGGGCCCACGAGGCCTCTGACATCATCTTCAGCTAA
GTTGCCGAAGTCCCTCTCCAGCCCTGGAGGCCCCTCCAAGCCAAAGAAGTCCAAGTCGGGCCAGGATCCCCAGCAGGAGCAGGAGCAGGA
GCGGGAGCGGGATCCCCAGCAGGAGCAGGAGCGGGAGCGGCTGCCTGTGTCAGGGAATCTGCTTGATGTGTACAGTAGTCAAGGCGTGGC
CACACCAGCCATCACTGTCAGCAACTCCTGCCCAGCTGAGCTGCCCAACATCAAACGGGAGATCTCTGAGACCGAGGCAAAGGCCCTTTT
GAAGGAACGGCAGAAGAAAGACAATCACAACCTAATTGAGCGTCGCAGGCGATTCAACATTAACGACAGGATCAAGGAACTGGGCACTCT
CATCCCTAAGTCCAGTGACCCGGAGATGCGCTGGAACAAGGGCACCATCCTGAAGGCCTCTGTGGATTATATCCGCAAGCTGCAGAAGGA
GCAGCAGCGCTCCAAAGACCTGGAGAGCCGGCAGCGATCCCTGGAGCAGGCCAACCGCAGCCTGCAGCTCCGAATTCAGGAACTAGAACT
GCAGGCCCAGATCCATGGCCTGCCAGTACCTCCCACTCCAGGGCTGCTTTCCTTGGCCACGACTTCGGCTTCTGACAGCCTCAAGCCAGA
GCAGCTGGACATTGAGGAGGAGGGCAGGCCAGGCGCAGCAACGTTCCATGTAGGGGGGGGACCTGCCCAGAATGCTCCCCATCAGCAGCC
CCCTGCACCGCCCTCAGATGCCCTTCTGGACCTGCACTTTCCCAGCGACCACCTGGGGGACCTGGGAGACCCCTTCCACCTGGGGCTGGA
GGACATTCTGATGGAGGAGGAGGAGGGGGTGGTGGGAGGACTGTCGGGGGGTGCCCTGTCCCCACTGCGGGCTGCCTCCGATCCCCTGCT
CTCTTCAGTGTCCCCTGCTGTCTCCAAGGCCAGCAGCCGCCGCAGCAGCTTCAGCATGGAAGAGGAGTCCTGATCAGGCCTCACCCCTCC
CCTGGGACTTTCCCACCCAGGAAAGGAGGACCAGTCAGGATGAGGCCCCGCCTTTTCCCCCACCCTCCCATGAGACTGCCCTGCCCAGGT
ATCCTGGGGGAAGAGGAGATGTGATCAGGCCCCACCCCTGTAATCAGGCAAGGAGGAGGAGTCAGATGAGGCCCTGCACCTTCCCCAAAG
GAACCGCCCAGTGCAGGTATTTCAGAAGGAGAAGGCTGGAGAAGGACATGAGATCAGGGCCTGCCCCCTGGGGATCACAGCCTCACCCCT
GCCCCTGTGGGACTCATCCTTGCCCAGGTGAGGGAAGGAGACAGGATGAGGTCTCGACCCTGTCCCCTAGGGACTGTCCTAGCCAGGTCT
CCTGGGAAAGGGAGATGTCAGGATGTTGCTCCATCCTTTGTCTTGGAACCACCAGTCTAGTCCGTCCTGGCACAGAAGAGGAGTCAAGTA
ATGGAGGTCCCAGCCCTGGGGGTTTAAGCTCTGCCCCTTCCCCATGAACCCTGCCCTGCTCTGCCCAGGCAAGGAACAGAAGTGAGGATG
AGACCCAGCCCCTTCCCCTGGGAACTCTCCTGGCCTTCTAGGAATGGAGGAGCCAGGCCCCACCCCTTCCCTATAGGAACAGCCCAGCAC
AGGTATTTCAGGTGTGAAAGAATCAGTAGGACCAGGCCACCGCTAGTGCTTGTGGAGATCACAGCCCCACCCTTGTCCCTCAGCAACATC
CCATCTAAGCATTCCACACTGCAGGGAGGAGTGGTACTTAAGCTCCCCTGCCTTAACCTGGGACCAACCTGACCTAACCTAGGAGGGCTC
TGAGCCAACCTTGCTCTTGGGGAAGGGGACAGATTATGAAATTTCATGGATGAATTTTCCAGACCTATATCTGGAGTGAGAGGCCCCCAC
CCTTGGGCAGAGTCCTGCCTTCTTCCTTGAGGGGCAGTTTGGGAAGGTGATGGGTATTAGTGGGGGACTGAGTTCAGGTTACCAGAACCA
GTACCTCAGTATTCTTTTTCAACATGTAGGGCAAGAGGATGAAGGAAGGGGCTATCCTGGGACCTCCCCAGCCCAGGAAAAACTGGAAGC
CTTCCCCCAGCAAGGCAGAAGCTTGGAGGAGGGTTGTAAAAGCATATTGTACCCCCTCATTTGTTTATCTGATTTTTTTATTGCTCCGCA
TACTGAGAATCTAGGCCACCCCAACCTCTGTTCCCCACCCAGTTCTTCATTTGGAGGAATCACCCCATTTCAGAGTTATCAAGAGACACT
CCCCCCTCCATTCCCACCCCTCATACCTACACCCAAGGTTGTCAGCTTTGGATTGCTGGGGCCAGGCCCCATGGAGGGTATACTGAGGGG

>In-frame_ASPSCR1_ENST00000580534_chr17_79954722_+_TFE3_ENST00000315869_chrX_48891767_-_3160nt
ACGTGAGCGGAAAATGGCGGCCCCGGCAGGCGGCGGAGGCTCCGCGGTGTCGGTGCTGGCCCCGAACGGCCGGCGCCACACGGTGAAGGT
GACGCCGAGCACCGTGCTGCTTCAGGTTTCAGAGGAGCGTGCTCGACCTTTCTCTCCAGTGGAGATTTGCCAACCTGCCCAACAATGCCA
AGCTGGAGATGGTGCCCGCTTCCCGGAGCCGTGAGGGGCCTGAGAACATGGTTCGCATCGCTTTGCAGCTGGACGATGGCTCGAGGTTGC
AGGACTCTTTCTGTTCAGGCCAGACCCTCTGGGAGCTTCTCAGCCATTTTCCACAGATCAGGGAGTGCCTGCAGCACCCCGGCGGGGCCA
CCCCAGTCTGCGTGTACACGAGGGATGAGGTGACGGGTGAAGCTGCCCTGCGGGGCACGACGCTGCAGTCGCTGGGCCTGACCGGGGGCA
GCGCCACCATCAGGTTTGTCATGAAGTGCTACGACCCCGTGGGCAAGACCCCAGGAAGCCTGGGCTCGTCAGCGTCGGCTGGCCAGGCAG
CCGCCAGCGCTCCACTTCCCTTGGAATCTGGGGAGCTCAGCCGCGGCGACTTGAGCCGTCCGGAGGACGCGGACACCTCAGGGCCCTGCT
GCGAGCACACTCAGGAGAAGCAGAGCACAAGGGCACCCGCAGCTGCCCCCTTTGTTCCTTTCTCGGGTGGGGGACAGAGACTGGGGGGCC
CTCCTGGGCCCACGAGGCCTCTGACATCATCTTCAGCTAAGTTGCCGAAGTCCCTCTCCAGCCCTGGAGGCCCCTCCAAGCCAAAGAAGT
CCAAGTCGGGCCAGGATCCCCAGCAGGAGCAGGAGCAGGAGCGGGAGCGGGATCCCCAGCAGGAGCAGGAGCGGGAGCGGCTGCCTGTGT
CAGGGAATCTGCTTGATGTGTACAGTAGTCAAGGCGTGGCCACACCAGCCATCACTGTCAGCAACTCCTGCCCAGCTGAGCTGCCCAACA
TCAAACGGGAGATCTCTGAGACCGAGGCAAAGGCCCTTTTGAAGGAACGGCAGAAGAAAGACAATCACAACCTAATTGAGCGTCGCAGGC
GATTCAACATTAACGACAGGATCAAGGAACTGGGCACTCTCATCCCTAAGTCCAGTGACCCGGAGATGCGCTGGAACAAGGGCACCATCC
TGAAGGCCTCTGTGGATTATATCCGCAAGCTGCAGAAGGAGCAGCAGCGCTCCAAAGACCTGGAGAGCCGGCAGCGATCCCTGGAGCAGG
CCAACCGCAGCCTGCAGCTCCGAATTCAGGAACTAGAACTGCAGGCCCAGATCCATGGCCTGCCAGTACCTCCCACTCCAGGGCTGCTTT
CCTTGGCCACGACTTCGGCTTCTGACAGCCTCAAGCCAGAGCAGCTGGACATTGAGGAGGAGGGCAGGCCAGGCGCAGCAACGTTCCATG
TAGGGGGGGGACCTGCCCAGAATGCTCCCCATCAGCAGCCCCCTGCACCGCCCTCAGATGCCCTTCTGGACCTGCACTTTCCCAGCGACC
ACCTGGGGGACCTGGGAGACCCCTTCCACCTGGGGCTGGAGGACATTCTGATGGAGGAGGAGGAGGGGGTGGTGGGAGGACTGTCGGGGG
GTGCCCTGTCCCCACTGCGGGCTGCCTCCGATCCCCTGCTCTCTTCAGTGTCCCCTGCTGTCTCCAAGGCCAGCAGCCGCCGCAGCAGCT
TCAGCATGGAAGAGGAGTCCTGATCAGGCCTCACCCCTCCCCTGGGACTTTCCCACCCAGGAAAGGAGGACCAGTCAGGATGAGGCCCCG
CCTTTTCCCCCACCCTCCCATGAGACTGCCCTGCCCAGGTATCCTGGGGGAAGAGGAGATGTGATCAGGCCCCACCCCTGTAATCAGGCA
AGGAGGAGGAGTCAGATGAGGCCCTGCACCTTCCCCAAAGGAACCGCCCAGTGCAGGTATTTCAGAAGGAGAAGGCTGGAGAAGGACATG
AGATCAGGGCCTGCCCCCTGGGGATCACAGCCTCACCCCTGCCCCTGTGGGACTCATCCTTGCCCAGGTGAGGGAAGGAGACAGGATGAG
GTCTCGACCCTGTCCCCTAGGGACTGTCCTAGCCAGGTCTCCTGGGAAAGGGAGATGTCAGGATGTTGCTCCATCCTTTGTCTTGGAACC
ACCAGTCTAGTCCGTCCTGGCACAGAAGAGGAGTCAAGTAATGGAGGTCCCAGCCCTGGGGGTTTAAGCTCTGCCCCTTCCCCATGAACC
CTGCCCTGCTCTGCCCAGGCAAGGAACAGAAGTGAGGATGAGACCCAGCCCCTTCCCCTGGGAACTCTCCTGGCCTTCTAGGAATGGAGG
AGCCAGGCCCCACCCCTTCCCTATAGGAACAGCCCAGCACAGGTATTTCAGGTGTGAAAGAATCAGTAGGACCAGGCCACCGCTAGTGCT
TGTGGAGATCACAGCCCCACCCTTGTCCCTCAGCAACATCCCATCTAAGCATTCCACACTGCAGGGAGGAGTGGTACTTAAGCTCCCCTG
CCTTAACCTGGGACCAACCTGACCTAACCTAGGAGGGCTCTGAGCCAACCTTGCTCTTGGGGAAGGGGACAGATTATGAAATTTCATGGA
TGAATTTTCCAGACCTATATCTGGAGTGAGAGGCCCCCACCCTTGGGCAGAGTCCTGCCTTCTTCCTTGAGGGGCAGTTTGGGAAGGTGA
TGGGTATTAGTGGGGGACTGAGTTCAGGTTACCAGAACCAGTACCTCAGTATTCTTTTTCAACATGTAGGGCAAGAGGATGAAGGAAGGG
GCTATCCTGGGACCTCCCCAGCCCAGGAAAAACTGGAAGCCTTCCCCCAGCAAGGCAGAAGCTTGGAGGAGGGTTGTAAAAGCATATTGT
ACCCCCTCATTTGTTTATCTGATTTTTTTATTGCTCCGCATACTGAGAATCTAGGCCACCCCAACCTCTGTTCCCCACCCAGTTCTTCAT
TTGGAGGAATCACCCCATTTCAGAGTTATCAAGAGACACTCCCCCCTCCATTCCCACCCCTCATACCTACACCCAAGGTTGTCAGCTTTG
GATTGCTGGGGCCAGGCCCCATGGAGGGTATACTGAGGGGTCTATAGGTTTGTGATTAAAATAATAAAAGCTAGGCGTGTTTGATGCGCT

>In-frame_ASPSCR1_ENST00000306729_chr17_79954722_+_TFE3_ENST00000315869_chrX_48895640_-_3405nt
GCTGCGGCCCCGCCCCCTGGCCGCGTGGCTGCGCGTCCTGGCTGTTGCCGATAAAGTTGTTTGACGCCGGCCCGGCGGCGGGTCACGTGA
GCGGAAAATGGCGGCCCCGGCAGGCGGCGGAGGCTCCGCGGTGTCGGTGCTGGCCCCGAACGGCCGGCGCCACACGGTGAAGGTGACGCC
GAGCACCGTGCTGCTTCAGGTTCTGGAGGACACGTGCCGGCGGCAGGACTTCAACCCCTGTGAATATGATCTGAAGTTTCAGAGGAGCGT
GCTCGACCTTTCTCTCCAGTGGAGATTTGCCAACCTGCCCAACAATGCCAAGCTGGAGATGGTGCCCGCTTCCCGGAGCCGTGAGGGGCC
TGAGAACATGGTTCGCATCGCTTTGCAGCTGGACGATGGCTCGAGGTTGCAGGACTCTTTCTGTTCAGGCCAGACCCTCTGGGAGCTTCT
CAGCCATTTTCCACAGATCAGGGAGTGCCTGCAGCACCCCGGCGGGGCCACCCCAGTCTGCGTGTACACGAGGGATGAGGTGACGGGTGA
AGCTGCCCTGCGGGGCACGACGCTGCAGTCGCTGGGCCTGACCGGGGGCAGCGCCACCATCAGGTTTGTCATGAAGTGCTACGACCCCGT
GGGCAAGACCCCAGGAAGCCTGGGCTCGTCAGCGTCGGCTGGCCAGGCAGCCGCCAGCGCTCCACTTCCCTTGGAATCTGGGGAGCTCAG
CCGCGGCGACTTGAGCCGTCCGGAGGACGCGGACACCTCAGGGCCCTGCTGCGAGCACACTCAGGAGAAGCAGAGCACAAGGGCACCCGC
AGCTGCCCCCTTTGTTCCTTTCTCGGGTGGGGGACAGAGACTGGGGGGCCCTCCTGGGCCCACGAGGCCTCTGACATCATCTTCAGCTAA
GTTGCCGAAGTCCCTCTCCAGCCCTGGAGGCCCCTCCAAGCCAAAGAAGTCCAAGTCGGGCCAGGATCCCCAGCAGGAGCAGGAGCAGGA
GCGGGAGCGGGATCCCCAGCAGGAGCAGGAGCGGGAGCGGATTGATGATGTCATTGATGAGATCATCAGCCTGGAGTCCAGTTACAATGA
TGAAATGCTCAGCTATCTGCCCGGAGGCACCACAGGACTGCAGCTCCCCAGCACGCTGCCTGTGTCAGGGAATCTGCTTGATGTGTACAG
TAGTCAAGGCGTGGCCACACCAGCCATCACTGTCAGCAACTCCTGCCCAGCTGAGCTGCCCAACATCAAACGGGAGATCTCTGAGACCGA
GGCAAAGGCCCTTTTGAAGGAACGGCAGAAGAAAGACAATCACAACCTAATTGAGCGTCGCAGGCGATTCAACATTAACGACAGGATCAA
GGAACTGGGCACTCTCATCCCTAAGTCCAGTGACCCGGAGATGCGCTGGAACAAGGGCACCATCCTGAAGGCCTCTGTGGATTATATCCG
CAAGCTGCAGAAGGAGCAGCAGCGCTCCAAAGACCTGGAGAGCCGGCAGCGATCCCTGGAGCAGGCCAACCGCAGCCTGCAGCTCCGAAT
TCAGGAACTAGAACTGCAGGCCCAGATCCATGGCCTGCCAGTACCTCCCACTCCAGGGCTGCTTTCCTTGGCCACGACTTCGGCTTCTGA
CAGCCTCAAGCCAGAGCAGCTGGACATTGAGGAGGAGGGCAGGCCAGGCGCAGCAACGTTCCATGTAGGGGGGGGACCTGCCCAGAATGC
TCCCCATCAGCAGCCCCCTGCACCGCCCTCAGATGCCCTTCTGGACCTGCACTTTCCCAGCGACCACCTGGGGGACCTGGGAGACCCCTT
CCACCTGGGGCTGGAGGACATTCTGATGGAGGAGGAGGAGGGGGTGGTGGGAGGACTGTCGGGGGGTGCCCTGTCCCCACTGCGGGCTGC
CTCCGATCCCCTGCTCTCTTCAGTGTCCCCTGCTGTCTCCAAGGCCAGCAGCCGCCGCAGCAGCTTCAGCATGGAAGAGGAGTCCTGATC
AGGCCTCACCCCTCCCCTGGGACTTTCCCACCCAGGAAAGGAGGACCAGTCAGGATGAGGCCCCGCCTTTTCCCCCACCCTCCCATGAGA
CTGCCCTGCCCAGGTATCCTGGGGGAAGAGGAGATGTGATCAGGCCCCACCCCTGTAATCAGGCAAGGAGGAGGAGTCAGATGAGGCCCT
GCACCTTCCCCAAAGGAACCGCCCAGTGCAGGTATTTCAGAAGGAGAAGGCTGGAGAAGGACATGAGATCAGGGCCTGCCCCCTGGGGAT
CACAGCCTCACCCCTGCCCCTGTGGGACTCATCCTTGCCCAGGTGAGGGAAGGAGACAGGATGAGGTCTCGACCCTGTCCCCTAGGGACT
GTCCTAGCCAGGTCTCCTGGGAAAGGGAGATGTCAGGATGTTGCTCCATCCTTTGTCTTGGAACCACCAGTCTAGTCCGTCCTGGCACAG
AAGAGGAGTCAAGTAATGGAGGTCCCAGCCCTGGGGGTTTAAGCTCTGCCCCTTCCCCATGAACCCTGCCCTGCTCTGCCCAGGCAAGGA
ACAGAAGTGAGGATGAGACCCAGCCCCTTCCCCTGGGAACTCTCCTGGCCTTCTAGGAATGGAGGAGCCAGGCCCCACCCCTTCCCTATA
GGAACAGCCCAGCACAGGTATTTCAGGTGTGAAAGAATCAGTAGGACCAGGCCACCGCTAGTGCTTGTGGAGATCACAGCCCCACCCTTG
TCCCTCAGCAACATCCCATCTAAGCATTCCACACTGCAGGGAGGAGTGGTACTTAAGCTCCCCTGCCTTAACCTGGGACCAACCTGACCT
AACCTAGGAGGGCTCTGAGCCAACCTTGCTCTTGGGGAAGGGGACAGATTATGAAATTTCATGGATGAATTTTCCAGACCTATATCTGGA
GTGAGAGGCCCCCACCCTTGGGCAGAGTCCTGCCTTCTTCCTTGAGGGGCAGTTTGGGAAGGTGATGGGTATTAGTGGGGGACTGAGTTC
AGGTTACCAGAACCAGTACCTCAGTATTCTTTTTCAACATGTAGGGCAAGAGGATGAAGGAAGGGGCTATCCTGGGACCTCCCCAGCCCA
GGAAAAACTGGAAGCCTTCCCCCAGCAAGGCAGAAGCTTGGAGGAGGGTTGTAAAAGCATATTGTACCCCCTCATTTGTTTATCTGATTT
TTTTATTGCTCCGCATACTGAGAATCTAGGCCACCCCAACCTCTGTTCCCCACCCAGTTCTTCATTTGGAGGAATCACCCCATTTCAGAG
TTATCAAGAGACACTCCCCCCTCCATTCCCACCCCTCATACCTACACCCAAGGTTGTCAGCTTTGGATTGCTGGGGCCAGGCCCCATGGA

>In-frame_ASPSCR1_ENST00000306739_chr17_79954722_+_TFE3_ENST00000315869_chrX_48895640_-_3405nt
GCTGCGGCCCCGCCCCCTGGCCGCGTGGCTGCGCGTCCTGGCTGTTGCCGATAAAGTTGTTTGACGCCGGCCCGGCGGCGGGTCACGTGA
GCGGAAAATGGCGGCCCCGGCAGGCGGCGGAGGCTCCGCGGTGTCGGTGCTGGCCCCGAACGGCCGGCGCCACACGGTGAAGGTGACGCC
GAGCACCGTGCTGCTTCAGGTTCTGGAGGACACGTGCCGGCGGCAGGACTTCAACCCCTGTGAATATGATCTGAAGTTTCAGAGGAGCGT
GCTCGACCTTTCTCTCCAGTGGAGATTTGCCAACCTGCCCAACAATGCCAAGCTGGAGATGGTGCCCGCTTCCCGGAGCCGTGAGGGGCC
TGAGAACATGGTTCGCATCGCTTTGCAGCTGGACGATGGCTCGAGGTTGCAGGACTCTTTCTGTTCAGGCCAGACCCTCTGGGAGCTTCT
CAGCCATTTTCCACAGATCAGGGAGTGCCTGCAGCACCCCGGCGGGGCCACCCCAGTCTGCGTGTACACGAGGGATGAGGTGACGGGTGA
AGCTGCCCTGCGGGGCACGACGCTGCAGTCGCTGGGCCTGACCGGGGGCAGCGCCACCATCAGGTTTGTCATGAAGTGCTACGACCCCGT
GGGCAAGACCCCAGGAAGCCTGGGCTCGTCAGCGTCGGCTGGCCAGGCAGCCGCCAGCGCTCCACTTCCCTTGGAATCTGGGGAGCTCAG
CCGCGGCGACTTGAGCCGTCCGGAGGACGCGGACACCTCAGGGCCCTGCTGCGAGCACACTCAGGAGAAGCAGAGCACAAGGGCACCCGC
AGCTGCCCCCTTTGTTCCTTTCTCGGGTGGGGGACAGAGACTGGGGGGCCCTCCTGGGCCCACGAGGCCTCTGACATCATCTTCAGCTAA
GTTGCCGAAGTCCCTCTCCAGCCCTGGAGGCCCCTCCAAGCCAAAGAAGTCCAAGTCGGGCCAGGATCCCCAGCAGGAGCAGGAGCAGGA
GCGGGAGCGGGATCCCCAGCAGGAGCAGGAGCGGGAGCGGATTGATGATGTCATTGATGAGATCATCAGCCTGGAGTCCAGTTACAATGA
TGAAATGCTCAGCTATCTGCCCGGAGGCACCACAGGACTGCAGCTCCCCAGCACGCTGCCTGTGTCAGGGAATCTGCTTGATGTGTACAG
TAGTCAAGGCGTGGCCACACCAGCCATCACTGTCAGCAACTCCTGCCCAGCTGAGCTGCCCAACATCAAACGGGAGATCTCTGAGACCGA
GGCAAAGGCCCTTTTGAAGGAACGGCAGAAGAAAGACAATCACAACCTAATTGAGCGTCGCAGGCGATTCAACATTAACGACAGGATCAA
GGAACTGGGCACTCTCATCCCTAAGTCCAGTGACCCGGAGATGCGCTGGAACAAGGGCACCATCCTGAAGGCCTCTGTGGATTATATCCG
CAAGCTGCAGAAGGAGCAGCAGCGCTCCAAAGACCTGGAGAGCCGGCAGCGATCCCTGGAGCAGGCCAACCGCAGCCTGCAGCTCCGAAT
TCAGGAACTAGAACTGCAGGCCCAGATCCATGGCCTGCCAGTACCTCCCACTCCAGGGCTGCTTTCCTTGGCCACGACTTCGGCTTCTGA
CAGCCTCAAGCCAGAGCAGCTGGACATTGAGGAGGAGGGCAGGCCAGGCGCAGCAACGTTCCATGTAGGGGGGGGACCTGCCCAGAATGC
TCCCCATCAGCAGCCCCCTGCACCGCCCTCAGATGCCCTTCTGGACCTGCACTTTCCCAGCGACCACCTGGGGGACCTGGGAGACCCCTT
CCACCTGGGGCTGGAGGACATTCTGATGGAGGAGGAGGAGGGGGTGGTGGGAGGACTGTCGGGGGGTGCCCTGTCCCCACTGCGGGCTGC
CTCCGATCCCCTGCTCTCTTCAGTGTCCCCTGCTGTCTCCAAGGCCAGCAGCCGCCGCAGCAGCTTCAGCATGGAAGAGGAGTCCTGATC
AGGCCTCACCCCTCCCCTGGGACTTTCCCACCCAGGAAAGGAGGACCAGTCAGGATGAGGCCCCGCCTTTTCCCCCACCCTCCCATGAGA
CTGCCCTGCCCAGGTATCCTGGGGGAAGAGGAGATGTGATCAGGCCCCACCCCTGTAATCAGGCAAGGAGGAGGAGTCAGATGAGGCCCT
GCACCTTCCCCAAAGGAACCGCCCAGTGCAGGTATTTCAGAAGGAGAAGGCTGGAGAAGGACATGAGATCAGGGCCTGCCCCCTGGGGAT
CACAGCCTCACCCCTGCCCCTGTGGGACTCATCCTTGCCCAGGTGAGGGAAGGAGACAGGATGAGGTCTCGACCCTGTCCCCTAGGGACT
GTCCTAGCCAGGTCTCCTGGGAAAGGGAGATGTCAGGATGTTGCTCCATCCTTTGTCTTGGAACCACCAGTCTAGTCCGTCCTGGCACAG
AAGAGGAGTCAAGTAATGGAGGTCCCAGCCCTGGGGGTTTAAGCTCTGCCCCTTCCCCATGAACCCTGCCCTGCTCTGCCCAGGCAAGGA
ACAGAAGTGAGGATGAGACCCAGCCCCTTCCCCTGGGAACTCTCCTGGCCTTCTAGGAATGGAGGAGCCAGGCCCCACCCCTTCCCTATA
GGAACAGCCCAGCACAGGTATTTCAGGTGTGAAAGAATCAGTAGGACCAGGCCACCGCTAGTGCTTGTGGAGATCACAGCCCCACCCTTG
TCCCTCAGCAACATCCCATCTAAGCATTCCACACTGCAGGGAGGAGTGGTACTTAAGCTCCCCTGCCTTAACCTGGGACCAACCTGACCT
AACCTAGGAGGGCTCTGAGCCAACCTTGCTCTTGGGGAAGGGGACAGATTATGAAATTTCATGGATGAATTTTCCAGACCTATATCTGGA
GTGAGAGGCCCCCACCCTTGGGCAGAGTCCTGCCTTCTTCCTTGAGGGGCAGTTTGGGAAGGTGATGGGTATTAGTGGGGGACTGAGTTC
AGGTTACCAGAACCAGTACCTCAGTATTCTTTTTCAACATGTAGGGCAAGAGGATGAAGGAAGGGGCTATCCTGGGACCTCCCCAGCCCA
GGAAAAACTGGAAGCCTTCCCCCAGCAAGGCAGAAGCTTGGAGGAGGGTTGTAAAAGCATATTGTACCCCCTCATTTGTTTATCTGATTT
TTTTATTGCTCCGCATACTGAGAATCTAGGCCACCCCAACCTCTGTTCCCCACCCAGTTCTTCATTTGGAGGAATCACCCCATTTCAGAG
TTATCAAGAGACACTCCCCCCTCCATTCCCACCCCTCATACCTACACCCAAGGTTGTCAGCTTTGGATTGCTGGGGCCAGGCCCCATGGA

>In-frame_ASPSCR1_ENST00000580534_chr17_79954722_+_TFE3_ENST00000315869_chrX_48895640_-_3265nt
ACGTGAGCGGAAAATGGCGGCCCCGGCAGGCGGCGGAGGCTCCGCGGTGTCGGTGCTGGCCCCGAACGGCCGGCGCCACACGGTGAAGGT
GACGCCGAGCACCGTGCTGCTTCAGGTTTCAGAGGAGCGTGCTCGACCTTTCTCTCCAGTGGAGATTTGCCAACCTGCCCAACAATGCCA
AGCTGGAGATGGTGCCCGCTTCCCGGAGCCGTGAGGGGCCTGAGAACATGGTTCGCATCGCTTTGCAGCTGGACGATGGCTCGAGGTTGC
AGGACTCTTTCTGTTCAGGCCAGACCCTCTGGGAGCTTCTCAGCCATTTTCCACAGATCAGGGAGTGCCTGCAGCACCCCGGCGGGGCCA
CCCCAGTCTGCGTGTACACGAGGGATGAGGTGACGGGTGAAGCTGCCCTGCGGGGCACGACGCTGCAGTCGCTGGGCCTGACCGGGGGCA
GCGCCACCATCAGGTTTGTCATGAAGTGCTACGACCCCGTGGGCAAGACCCCAGGAAGCCTGGGCTCGTCAGCGTCGGCTGGCCAGGCAG
CCGCCAGCGCTCCACTTCCCTTGGAATCTGGGGAGCTCAGCCGCGGCGACTTGAGCCGTCCGGAGGACGCGGACACCTCAGGGCCCTGCT
GCGAGCACACTCAGGAGAAGCAGAGCACAAGGGCACCCGCAGCTGCCCCCTTTGTTCCTTTCTCGGGTGGGGGACAGAGACTGGGGGGCC
CTCCTGGGCCCACGAGGCCTCTGACATCATCTTCAGCTAAGTTGCCGAAGTCCCTCTCCAGCCCTGGAGGCCCCTCCAAGCCAAAGAAGT
CCAAGTCGGGCCAGGATCCCCAGCAGGAGCAGGAGCAGGAGCGGGAGCGGGATCCCCAGCAGGAGCAGGAGCGGGAGCGGATTGATGATG
TCATTGATGAGATCATCAGCCTGGAGTCCAGTTACAATGATGAAATGCTCAGCTATCTGCCCGGAGGCACCACAGGACTGCAGCTCCCCA
GCACGCTGCCTGTGTCAGGGAATCTGCTTGATGTGTACAGTAGTCAAGGCGTGGCCACACCAGCCATCACTGTCAGCAACTCCTGCCCAG
CTGAGCTGCCCAACATCAAACGGGAGATCTCTGAGACCGAGGCAAAGGCCCTTTTGAAGGAACGGCAGAAGAAAGACAATCACAACCTAA
TTGAGCGTCGCAGGCGATTCAACATTAACGACAGGATCAAGGAACTGGGCACTCTCATCCCTAAGTCCAGTGACCCGGAGATGCGCTGGA
ACAAGGGCACCATCCTGAAGGCCTCTGTGGATTATATCCGCAAGCTGCAGAAGGAGCAGCAGCGCTCCAAAGACCTGGAGAGCCGGCAGC
GATCCCTGGAGCAGGCCAACCGCAGCCTGCAGCTCCGAATTCAGGAACTAGAACTGCAGGCCCAGATCCATGGCCTGCCAGTACCTCCCA
CTCCAGGGCTGCTTTCCTTGGCCACGACTTCGGCTTCTGACAGCCTCAAGCCAGAGCAGCTGGACATTGAGGAGGAGGGCAGGCCAGGCG
CAGCAACGTTCCATGTAGGGGGGGGACCTGCCCAGAATGCTCCCCATCAGCAGCCCCCTGCACCGCCCTCAGATGCCCTTCTGGACCTGC
ACTTTCCCAGCGACCACCTGGGGGACCTGGGAGACCCCTTCCACCTGGGGCTGGAGGACATTCTGATGGAGGAGGAGGAGGGGGTGGTGG
GAGGACTGTCGGGGGGTGCCCTGTCCCCACTGCGGGCTGCCTCCGATCCCCTGCTCTCTTCAGTGTCCCCTGCTGTCTCCAAGGCCAGCA
GCCGCCGCAGCAGCTTCAGCATGGAAGAGGAGTCCTGATCAGGCCTCACCCCTCCCCTGGGACTTTCCCACCCAGGAAAGGAGGACCAGT
CAGGATGAGGCCCCGCCTTTTCCCCCACCCTCCCATGAGACTGCCCTGCCCAGGTATCCTGGGGGAAGAGGAGATGTGATCAGGCCCCAC
CCCTGTAATCAGGCAAGGAGGAGGAGTCAGATGAGGCCCTGCACCTTCCCCAAAGGAACCGCCCAGTGCAGGTATTTCAGAAGGAGAAGG
CTGGAGAAGGACATGAGATCAGGGCCTGCCCCCTGGGGATCACAGCCTCACCCCTGCCCCTGTGGGACTCATCCTTGCCCAGGTGAGGGA
AGGAGACAGGATGAGGTCTCGACCCTGTCCCCTAGGGACTGTCCTAGCCAGGTCTCCTGGGAAAGGGAGATGTCAGGATGTTGCTCCATC
CTTTGTCTTGGAACCACCAGTCTAGTCCGTCCTGGCACAGAAGAGGAGTCAAGTAATGGAGGTCCCAGCCCTGGGGGTTTAAGCTCTGCC
CCTTCCCCATGAACCCTGCCCTGCTCTGCCCAGGCAAGGAACAGAAGTGAGGATGAGACCCAGCCCCTTCCCCTGGGAACTCTCCTGGCC
TTCTAGGAATGGAGGAGCCAGGCCCCACCCCTTCCCTATAGGAACAGCCCAGCACAGGTATTTCAGGTGTGAAAGAATCAGTAGGACCAG
GCCACCGCTAGTGCTTGTGGAGATCACAGCCCCACCCTTGTCCCTCAGCAACATCCCATCTAAGCATTCCACACTGCAGGGAGGAGTGGT
ACTTAAGCTCCCCTGCCTTAACCTGGGACCAACCTGACCTAACCTAGGAGGGCTCTGAGCCAACCTTGCTCTTGGGGAAGGGGACAGATT
ATGAAATTTCATGGATGAATTTTCCAGACCTATATCTGGAGTGAGAGGCCCCCACCCTTGGGCAGAGTCCTGCCTTCTTCCTTGAGGGGC
AGTTTGGGAAGGTGATGGGTATTAGTGGGGGACTGAGTTCAGGTTACCAGAACCAGTACCTCAGTATTCTTTTTCAACATGTAGGGCAAG
AGGATGAAGGAAGGGGCTATCCTGGGACCTCCCCAGCCCAGGAAAAACTGGAAGCCTTCCCCCAGCAAGGCAGAAGCTTGGAGGAGGGTT
GTAAAAGCATATTGTACCCCCTCATTTGTTTATCTGATTTTTTTATTGCTCCGCATACTGAGAATCTAGGCCACCCCAACCTCTGTTCCC
CACCCAGTTCTTCATTTGGAGGAATCACCCCATTTCAGAGTTATCAAGAGACACTCCCCCCTCCATTCCCACCCCTCATACCTACACCCA
AGGTTGTCAGCTTTGGATTGCTGGGGCCAGGCCCCATGGAGGGTATACTGAGGGGTCTATAGGTTTGTGATTAAAATAATAAAAGCTAGG


Top

FusionGenePPI for ASPSCR1_TFE3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ASPSCR1UBC, VCP, ALPP, NPLOC4, UFD1L, VCPIP1, PHAX, NEDD4, UBXN6, APP, VCPKMT, DCAF11, KRT31, TCF4, TACC3, ADAMTSL4, KRTAP10-8, NOTCH2NL, EZH2, GAPDH, GLUL, UBXN2B, HPD, MAT1A, NSF, AGL, BANF1, DERA, YTHDF1, YTHDF2, NTRK1, UBXN2A, UBXN7, NSFL1C, UBXN10, FAF1, KCTD3, FAM136A, SHKBP1, HAO2, ASNA1, HK1, HACL1, SERPINB2, GLTP, FADS1TFE3AKR1B1, CLTC, PHB2, ACLY, CUL2, EPRS, PFAS, VARS, NEDD8, RPL38, TRIM28, EIF3A, RPA3, E2F3, SMARCE1, MITF, TFE3, SMAD3, SMAD4, TFEC, EWSR1, XPO1, TFEB


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneASPSCR1chr17:79954722chrX:48891767ENST00000306729+717317_380311648GLUT4
HgeneASPSCR1chr17:79954722chrX:48891767ENST00000306739+716317_380311554GLUT4
HgeneASPSCR1chr17:79954722chrX:48891767ENST00000580534+615317_380234502GLUT4
HgeneASPSCR1chr17:79954722chrX:48895640ENST00000306729+717317_380311648GLUT4
HgeneASPSCR1chr17:79954722chrX:48895640ENST00000306739+716317_380311554GLUT4
HgeneASPSCR1chr17:79954722chrX:48895640ENST00000580534+615317_380234502GLUT4


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ASPSCR1_TFE3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ASPSCR1_TFE3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource