FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30152

FusionGeneSummary for RAD17_SEC24A

check button Fusion gene summary
Fusion gene informationFusion gene name: RAD17_SEC24A
Fusion gene ID: 30152
HgeneTgene
Gene symbol

RAD17

SEC24A

Gene ID

5884

10802

Gene nameRAD17 checkpoint clamp loader componentSEC24 homolog A, COPII coat complex component
SynonymsCCYC|HRAD17|R24L|RAD17SP|RAD24-
Cytomap

5q13.2

5q31.1

Type of geneprotein-codingprotein-coding
Descriptioncell cycle checkpoint protein RAD17RAD1 homologRAD17 homologRF-C activator 1 homologRad17-like proteincell cycle checkpoint protein (RAD17)protein transport protein Sec24ASEC24 family, member ASEC24 related gene family, member ASEC24-related protein A
Modification date2018052320180519
UniProtAcc

O75943

O95486

Ensembl transtripts involved in fusion geneENST00000361732, ENST00000509734, 
ENST00000354868, ENST00000521422, 
ENST00000504177, ENST00000354312, 
ENST00000345306, ENST00000305138, 
ENST00000282891, ENST00000358030, 
ENST00000380774, 
ENST00000398844, 
ENST00000322887, 
Fusion gene scores* DoF score3 X 3 X 3=273 X 3 X 3=27
# samples 34
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/27*10)=0.567040592723894
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RAD17 [Title/Abstract] AND SEC24A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSEC24A

GO:0090110

cargo loading into COPII-coated vesicle

17499046|18843296


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-EJ-5524-01ARAD17chr5

68670538

+SEC24Achr5

134050714

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000361732ENST00000398844RAD17chr5

68670538

+SEC24Achr5

134050714

+
5CDS-intronENST00000361732ENST00000322887RAD17chr5

68670538

+SEC24Achr5

134050714

+
In-frameENST00000509734ENST00000398844RAD17chr5

68670538

+SEC24Achr5

134050714

+
5CDS-intronENST00000509734ENST00000322887RAD17chr5

68670538

+SEC24Achr5

134050714

+
In-frameENST00000354868ENST00000398844RAD17chr5

68670538

+SEC24Achr5

134050714

+
5CDS-intronENST00000354868ENST00000322887RAD17chr5

68670538

+SEC24Achr5

134050714

+
5UTR-3CDSENST00000521422ENST00000398844RAD17chr5

68670538

+SEC24Achr5

134050714

+
5UTR-intronENST00000521422ENST00000322887RAD17chr5

68670538

+SEC24Achr5

134050714

+
intron-3CDSENST00000504177ENST00000398844RAD17chr5

68670538

+SEC24Achr5

134050714

+
intron-intronENST00000504177ENST00000322887RAD17chr5

68670538

+SEC24Achr5

134050714

+
In-frameENST00000354312ENST00000398844RAD17chr5

68670538

+SEC24Achr5

134050714

+
5CDS-intronENST00000354312ENST00000322887RAD17chr5

68670538

+SEC24Achr5

134050714

+
In-frameENST00000345306ENST00000398844RAD17chr5

68670538

+SEC24Achr5

134050714

+
5CDS-intronENST00000345306ENST00000322887RAD17chr5

68670538

+SEC24Achr5

134050714

+
In-frameENST00000305138ENST00000398844RAD17chr5

68670538

+SEC24Achr5

134050714

+
5CDS-intronENST00000305138ENST00000322887RAD17chr5

68670538

+SEC24Achr5

134050714

+
In-frameENST00000282891ENST00000398844RAD17chr5

68670538

+SEC24Achr5

134050714

+
5CDS-intronENST00000282891ENST00000322887RAD17chr5

68670538

+SEC24Achr5

134050714

+
5UTR-3CDSENST00000358030ENST00000398844RAD17chr5

68670538

+SEC24Achr5

134050714

+
5UTR-intronENST00000358030ENST00000322887RAD17chr5

68670538

+SEC24Achr5

134050714

+
In-frameENST00000380774ENST00000398844RAD17chr5

68670538

+SEC24Achr5

134050714

+
5CDS-intronENST00000380774ENST00000322887RAD17chr5

68670538

+SEC24Achr5

134050714

+

Top

FusionProtFeatures for RAD17_SEC24A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RAD17

O75943

SEC24A

O95486

Component of the coat protein complex II (COPII) whichpromotes the formation of transport vesicles from the endoplasmicreticulum (ER). The coat has two main functions, the physicaldeformation of the endoplasmic reticulum membrane into vesiclesand the selection of cargo molecules for their transport to theGolgi complex (PubMed:20427317, PubMed:17499046, PubMed:18843296).Plays a central role in cargo selection within the COPII complexand together with SEC24B may have a different specificity comparedto SEC24C and SEC24D. May package preferentially cargos withcytoplasmic DxE or LxxLE motifs and may also recognizeconformational epitopes (PubMed:17499046, PubMed:18843296).{ECO:0000269|PubMed:17499046, ECO:0000269|PubMed:18843296,ECO:0000269|PubMed:20427317}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSEC24Achr5:68670538chr5:134050714ENST00000322887+01389_237-85614Compositional biasNote=Pro-rich
TgeneSEC24Achr5:68670538chr5:134050714ENST00000322887+013431_455-85614RegionNote=Zinc finger-like
TgeneSEC24Achr5:68670538chr5:134050714ENST00000322887+013966_1038-85614RepeatGelsolin-like
TgeneSEC24Achr5:68670538chr5:134050714ENST00000398844+1723966_10389091094RepeatGelsolin-like

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRAD17chr5:68670538chr5:134050714ENST00000282891+316137_14431585Nucleotide bindingATP
HgeneRAD17chr5:68670538chr5:134050714ENST00000305138+417137_144117671Nucleotide bindingATP
HgeneRAD17chr5:68670538chr5:134050714ENST00000345306+417137_144117671Nucleotide bindingATP
HgeneRAD17chr5:68670538chr5:134050714ENST00000354312+518137_144117671Nucleotide bindingATP
HgeneRAD17chr5:68670538chr5:134050714ENST00000354868+619137_144117671Nucleotide bindingATP
HgeneRAD17chr5:68670538chr5:134050714ENST00000358030+316137_144-48506Nucleotide bindingATP
HgeneRAD17chr5:68670538chr5:134050714ENST00000361732+518137_144117671Nucleotide bindingATP
HgeneRAD17chr5:68670538chr5:134050714ENST00000380774+316137_144128682Nucleotide bindingATP
HgeneRAD17chr5:68670538chr5:134050714ENST00000509734+518137_144128682Nucleotide bindingATP
HgeneRAD17chr5:68670538chr5:134050714ENST00000521422+417137_144-48506Nucleotide bindingATP
TgeneSEC24Achr5:68670538chr5:134050714ENST00000398844+172389_2379091094Compositional biasNote=Pro-rich
TgeneSEC24Achr5:68670538chr5:134050714ENST00000398844+1723431_4559091094RegionNote=Zinc finger-like


Top

FusionGeneSequence for RAD17_SEC24A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RAD17_ENST00000361732_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_302aa
MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRFPARKRGNLSSLEQITGLENSKETLSENEPWVDKTKPETQH
ELAVHKKKIEEVETWLKAQVLERQPKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLTRVDNLSDEGALNISDRTIPQPPILQ
LSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNTASIPQPMTDLPELDTPESARIIAFISWLREQRPFFPILTVIRDESPMK

>In-frame_RAD17_ENST00000509734_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_313aa
MSKTFLRPKVSSTKVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRFPARKRGNLSSLEQITGLENSKETLSENEP
WVDKTKPETQHELAVHKKKIEEVETWLKAQVLERQPKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLTRVDNLSDEGALNIS
DRTIPQPPILQLSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNTASIPQPMTDLPELDTPESARIIAFISWLREQRPFFPI

>In-frame_RAD17_ENST00000354868_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_302aa
MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRFPARKRGNLSSLEQITGLENSKETLSENEPWVDKTKPETQH
ELAVHKKKIEEVETWLKAQVLERQPKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLTRVDNLSDEGALNISDRTIPQPPILQ
LSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNTASIPQPMTDLPELDTPESARIIAFISWLREQRPFFPILTVIRDESPMK

>In-frame_RAD17_ENST00000354312_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_302aa
MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRFPARKRGNLSSLEQITGLENSKETLSENEPWVDKTKPETQH
ELAVHKKKIEEVETWLKAQVLERQPKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLTRVDNLSDEGALNISDRTIPQPPILQ
LSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNTASIPQPMTDLPELDTPESARIIAFISWLREQRPFFPILTVIRDESPMK

>In-frame_RAD17_ENST00000345306_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_302aa
MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRFPARKRGNLSSLEQITGLENSKETLSENEPWVDKTKPETQH
ELAVHKKKIEEVETWLKAQVLERQPKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLTRVDNLSDEGALNISDRTIPQPPILQ
LSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNTASIPQPMTDLPELDTPESARIIAFISWLREQRPFFPILTVIRDESPMK

>In-frame_RAD17_ENST00000305138_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_302aa
MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRFPARKRGNLSSLEQITGLENSKETLSENEPWVDKTKPETQH
ELAVHKKKIEEVETWLKAQVLERQPKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLTRVDNLSDEGALNISDRTIPQPPILQ
LSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNTASIPQPMTDLPELDTPESARIIAFISWLREQRPFFPILTVIRDESPMK

>In-frame_RAD17_ENST00000282891_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_216aa
MNQHELAVHKKKIEEVETWLKAQVLERQPKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLTRVDNLSDEGALNISDRTIPQP
PILQLSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNTASIPQPMTDLPELDTPESARIIAFISWLREQRPFFPILTVIRDE

>In-frame_RAD17_ENST00000380774_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_313aa
MSKTFLRPKVSSTKVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRFPARKRGNLSSLEQITGLENSKETLSENEP
WVDKTKPETQHELAVHKKKIEEVETWLKAQVLERQPKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLTRVDNLSDEGALNIS
DRTIPQPPILQLSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNTASIPQPMTDLPELDTPESARIIAFISWLREQRPFFPI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RAD17_ENST00000361732_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_906nt
ATGAATCAGGTAACAGACTGGGTTGACCCATCATTTGATGATTTTCTAGAGTGTAGTGGCGTCTCTACTATTACTGCCACATCATTAGGT
GTGAATAACTCAAGTCATAGAAGAAAAAATGGGCCTTCTACATTAGAAAGCAGCAGATTTCCAGCGAGAAAAAGAGGAAATCTATCTTCC
TTAGAACAGATTTATGGTTTAGAAAATTCAAAAGAATATCTGTCTGAAAATGAACCATGGGTGGATAAATATAAACCAGAAACTCAGCAT
GAACTTGCTGTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAAGTTTTAGAAAGGCAACCAAAACAGAAATCATTC
CAGACTGGGACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAAAACCAGCCCTTGGTTTACCTTATGCTCACAACT
CATCCCAGTTTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGTGATAGAACCATACCTCAGCCCCCCATTCTTCAG
CTTTCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTACTGATGCTTTGGGTTGGAAAAAATTGTACACAG
AATTTTCTCAGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATGACAGACCTTCCAGAACTTGATACACCAGAATCT
GCCAGAATAATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATACTTTATGTAATAAGGGATGAGAGTCCAATGAAA
GCAAACTTCCTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTATGAATTCCTGTTGCATATACAGCAACAAGTGAAT

>In-frame_RAD17_ENST00000509734_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_939nt
ATGTCAAAAACTTTTCTTAGACCAAAGGTATCTTCCACAAAGGTAACAGACTGGGTTGACCCATCATTTGATGATTTTCTAGAGTGTAGT
GGCGTCTCTACTATTACTGCCACATCATTAGGTGTGAATAACTCAAGTCATAGAAGAAAAAATGGGCCTTCTACATTAGAAAGCAGCAGA
TTTCCAGCGAGAAAAAGAGGAAATCTATCTTCCTTAGAACAGATTTATGGTTTAGAAAATTCAAAAGAATATCTGTCTGAAAATGAACCA
TGGGTGGATAAATATAAACCAGAAACTCAGCATGAACTTGCTGTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAA
GTTTTAGAAAGGCAACCAAAACAGAAATCATTCCAGACTGGGACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAA
AACCAGCCCTTGGTTTACCTTATGCTCACAACTCATCCCAGTTTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGT
GATAGAACCATACCTCAGCCCCCCATTCTTCAGCTTTCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTA
CTGATGCTTTGGGTTGGAAAAAATTGTACACAGAATTTTCTCAGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATG
ACAGACCTTCCAGAACTTGATACACCAGAATCTGCCAGAATAATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATA
CTTTATGTAATAAGGGATGAGAGTCCAATGAAAGCAAACTTCCTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTAT

>In-frame_RAD17_ENST00000354868_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_906nt
ATGAATCAGGTAACAGACTGGGTTGACCCATCATTTGATGATTTTCTAGAGTGTAGTGGCGTCTCTACTATTACTGCCACATCATTAGGT
GTGAATAACTCAAGTCATAGAAGAAAAAATGGGCCTTCTACATTAGAAAGCAGCAGATTTCCAGCGAGAAAAAGAGGAAATCTATCTTCC
TTAGAACAGATTTATGGTTTAGAAAATTCAAAAGAATATCTGTCTGAAAATGAACCATGGGTGGATAAATATAAACCAGAAACTCAGCAT
GAACTTGCTGTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAAGTTTTAGAAAGGCAACCAAAACAGAAATCATTC
CAGACTGGGACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAAAACCAGCCCTTGGTTTACCTTATGCTCACAACT
CATCCCAGTTTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGTGATAGAACCATACCTCAGCCCCCCATTCTTCAG
CTTTCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTACTGATGCTTTGGGTTGGAAAAAATTGTACACAG
AATTTTCTCAGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATGACAGACCTTCCAGAACTTGATACACCAGAATCT
GCCAGAATAATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATACTTTATGTAATAAGGGATGAGAGTCCAATGAAA
GCAAACTTCCTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTATGAATTCCTGTTGCATATACAGCAACAAGTGAAT

>In-frame_RAD17_ENST00000354312_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_906nt
ATGAATCAGGTAACAGACTGGGTTGACCCATCATTTGATGATTTTCTAGAGTGTAGTGGCGTCTCTACTATTACTGCCACATCATTAGGT
GTGAATAACTCAAGTCATAGAAGAAAAAATGGGCCTTCTACATTAGAAAGCAGCAGATTTCCAGCGAGAAAAAGAGGAAATCTATCTTCC
TTAGAACAGATTTATGGTTTAGAAAATTCAAAAGAATATCTGTCTGAAAATGAACCATGGGTGGATAAATATAAACCAGAAACTCAGCAT
GAACTTGCTGTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAAGTTTTAGAAAGGCAACCAAAACAGAAATCATTC
CAGACTGGGACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAAAACCAGCCCTTGGTTTACCTTATGCTCACAACT
CATCCCAGTTTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGTGATAGAACCATACCTCAGCCCCCCATTCTTCAG
CTTTCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTACTGATGCTTTGGGTTGGAAAAAATTGTACACAG
AATTTTCTCAGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATGACAGACCTTCCAGAACTTGATACACCAGAATCT
GCCAGAATAATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATACTTTATGTAATAAGGGATGAGAGTCCAATGAAA
GCAAACTTCCTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTATGAATTCCTGTTGCATATACAGCAACAAGTGAAT

>In-frame_RAD17_ENST00000345306_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_906nt
ATGAATCAGGTAACAGACTGGGTTGACCCATCATTTGATGATTTTCTAGAGTGTAGTGGCGTCTCTACTATTACTGCCACATCATTAGGT
GTGAATAACTCAAGTCATAGAAGAAAAAATGGGCCTTCTACATTAGAAAGCAGCAGATTTCCAGCGAGAAAAAGAGGAAATCTATCTTCC
TTAGAACAGATTTATGGTTTAGAAAATTCAAAAGAATATCTGTCTGAAAATGAACCATGGGTGGATAAATATAAACCAGAAACTCAGCAT
GAACTTGCTGTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAAGTTTTAGAAAGGCAACCAAAACAGAAATCATTC
CAGACTGGGACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAAAACCAGCCCTTGGTTTACCTTATGCTCACAACT
CATCCCAGTTTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGTGATAGAACCATACCTCAGCCCCCCATTCTTCAG
CTTTCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTACTGATGCTTTGGGTTGGAAAAAATTGTACACAG
AATTTTCTCAGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATGACAGACCTTCCAGAACTTGATACACCAGAATCT
GCCAGAATAATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATACTTTATGTAATAAGGGATGAGAGTCCAATGAAA
GCAAACTTCCTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTATGAATTCCTGTTGCATATACAGCAACAAGTGAAT

>In-frame_RAD17_ENST00000305138_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_906nt
ATGAATCAGGTAACAGACTGGGTTGACCCATCATTTGATGATTTTCTAGAGTGTAGTGGCGTCTCTACTATTACTGCCACATCATTAGGT
GTGAATAACTCAAGTCATAGAAGAAAAAATGGGCCTTCTACATTAGAAAGCAGCAGATTTCCAGCGAGAAAAAGAGGAAATCTATCTTCC
TTAGAACAGATTTATGGTTTAGAAAATTCAAAAGAATATCTGTCTGAAAATGAACCATGGGTGGATAAATATAAACCAGAAACTCAGCAT
GAACTTGCTGTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAAGTTTTAGAAAGGCAACCAAAACAGAAATCATTC
CAGACTGGGACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAAAACCAGCCCTTGGTTTACCTTATGCTCACAACT
CATCCCAGTTTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGTGATAGAACCATACCTCAGCCCCCCATTCTTCAG
CTTTCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTACTGATGCTTTGGGTTGGAAAAAATTGTACACAG
AATTTTCTCAGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATGACAGACCTTCCAGAACTTGATACACCAGAATCT
GCCAGAATAATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATACTTTATGTAATAAGGGATGAGAGTCCAATGAAA
GCAAACTTCCTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTATGAATTCCTGTTGCATATACAGCAACAAGTGAAT

>In-frame_RAD17_ENST00000282891_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_648nt
ATGAATCAGCATGAACTTGCTGTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAAGTTTTAGAAAGGCAACCAAAA
CAGAAATCATTCCAGACTGGGACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAAAACCAGCCCTTGGTTTACCTT
ATGCTCACAACTCATCCCAGTTTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGTGATAGAACCATACCTCAGCCC
CCCATTCTTCAGCTTTCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTACTGATGCTTTGGGTTGGAAAA
AATTGTACACAGAATTTTCTCAGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATGACAGACCTTCCAGAACTTGAT
ACACCAGAATCTGCCAGAATAATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATACTTTATGTAATAAGGGATGAG
AGTCCAATGAAAGCAAACTTCCTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTATGAATTCCTGTTGCATATACAG

>In-frame_RAD17_ENST00000380774_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_939nt
ATGTCAAAAACTTTTCTTAGACCAAAGGTATCTTCCACAAAGGTAACAGACTGGGTTGACCCATCATTTGATGATTTTCTAGAGTGTAGT
GGCGTCTCTACTATTACTGCCACATCATTAGGTGTGAATAACTCAAGTCATAGAAGAAAAAATGGGCCTTCTACATTAGAAAGCAGCAGA
TTTCCAGCGAGAAAAAGAGGAAATCTATCTTCCTTAGAACAGATTTATGGTTTAGAAAATTCAAAAGAATATCTGTCTGAAAATGAACCA
TGGGTGGATAAATATAAACCAGAAACTCAGCATGAACTTGCTGTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAA
GTTTTAGAAAGGCAACCAAAACAGAAATCATTCCAGACTGGGACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAA
AACCAGCCCTTGGTTTACCTTATGCTCACAACTCATCCCAGTTTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGT
GATAGAACCATACCTCAGCCCCCCATTCTTCAGCTTTCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTA
CTGATGCTTTGGGTTGGAAAAAATTGTACACAGAATTTTCTCAGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATG
ACAGACCTTCCAGAACTTGATACACCAGAATCTGCCAGAATAATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATA
CTTTATGTAATAAGGGATGAGAGTCCAATGAAAGCAAACTTCCTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_RAD17_ENST00000361732_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_4115nt
GCAACGCCCGCGAGGGTCGGCTCCCGGGGCGCTGACAACCGCCTCGTGGCCCTCGGCCGGCCTCTGAAGAGGGCAGTGAGGGGCCCCCAC
CTGGGCGCCCGATGCCCAGAGCACTCTGCGCCCCCAGCCTGCCCCAGCCCAGTCCCTCCCGGCCGCGCGCCCTGACCGCAAGTGAATTCA
TGGTATTTTACTTTTTTGGGAAATACTGGAAATGAAGACCTGCAACTGTAATTTGAAATAAGGAAAACTTTAATTTTCAGTATAAAAATT
GCTCAAATAGAATTGCCTGATTTTAATGACAAAAGTATATGGGAGTCCACATTTATGTAAGAAATGAAACTATAAAATGTATAAATAATT
TGCAAATCAGAATTGCTGTCGAAAGTTTTACTATAATGAAAGATATTTTCATACTCTCAAAAATATAGAGGAAAGGGGCCAAGATTATAG
TACCAGTCACAATCTTTTGATGAGGACGAAATGAATCAGGTAACAGACTGGGTTGACCCATCATTTGATGATTTTCTAGAGTGTAGTGGC
GTCTCTACTATTACTGCCACATCATTAGGTGTGAATAACTCAAGTCATAGAAGAAAAAATGGGCCTTCTACATTAGAAAGCAGCAGATTT
CCAGCGAGAAAAAGAGGAAATCTATCTTCCTTAGAACAGATTTATGGTTTAGAAAATTCAAAAGAATATCTGTCTGAAAATGAACCATGG
GTGGATAAATATAAACCAGAAACTCAGCATGAACTTGCTGTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAAGTT
TTAGAAAGGCAACCAAAACAGAAATCATTCCAGACTGGGACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAAAAC
CAGCCCTTGGTTTACCTTATGCTCACAACTCATCCCAGTTTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGTGAT
AGAACCATACCTCAGCCCCCCATTCTTCAGCTTTCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTACTG
ATGCTTTGGGTTGGAAAAAATTGTACACAGAATTTTCTCAGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATGACA
GACCTTCCAGAACTTGATACACCAGAATCTGCCAGAATAATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATACTT
TATGTAATAAGGGATGAGAGTCCAATGAAAGCAAACTTCCTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTATGAA
TTCCTGTTGCATATACAGCAACAAGTGAATAAATGAATGAATGAAGAAATTTGACTTATTTTTAAGGAATGTCACGATAGTGCAGAATAC
CTGGAAATGTGTAATACCTTCTTTTTCTATTATGTTTGTGGACTAATGTGATGATTGAGATGTTCTCACTGTGATTTCAACAACCTATAG
CAAATAAAAGACCACAGCAGAGAATCAAACATGCAACTCTGAAATACTGTATTTTTCAAATCAGAATATAGCTACGTATGATTGGATACT
TTTTTCTTGCCAATTATGTTTGAGTTGTTATGGATTAAAATAAGAATATTGCAGAGGCAAAGTACATTTTGTAAAATAAAGATTTCTGTG
TTCTACATGTATATTTCTCATTTTTAATTTTTCTGAATCTTTGGCTGCTACATTTAAAACCTCACAAACCTAAGTGTTGCAGGGAAGTTA
CAAATTGATTGGTAGTGATGTTTTTAAAATAAAAACAATGGAAAGTAAATATAATGTAGGAAAACTAGAATTCATTCCCCACACGTGTCT
TTTTTTTTTCTTTGTTAAGGGAAAGGATCATGTTGACTAAAACTAAACTAATTCTAGTATAGCTTGAGAAAAATATGAAGAAACACATTC
AAGCTTTAAAATCTGTCAGTATTCTTTATGCTTGAAGAACAAAGTCACTTTGATTTGAAGTGAGAACTATCATTAGGTGGTTTTCTGATT
TCCTGATGAAGAGTTGGACATACTGTCTTAATCTATAGTGAAAAGAATTTGAGCTGTCTTCATAAACACTGGGACTAGCAATGATAATAG
GGAGATAAGAAACTTTAATTATCTTGATCCTTTAAGTGGATTTTATTTGGTGCATTTCTGCTCTGGGTATATAATAAAAGTGGGGGTTTT
TGGTGAAATGAGTGAAGAAATGAAAGGTTTCTAAAGTGCTATCCAAATACATCAGTAACATTTTTCTAAGGAGTTTAATTGTTAAATTGG
AAGTCATTCATAAGAAATATTTATGCTTGAATATGAAAATCTATGAAAGCATAAATGCTGCTGTTTGATTTGGTGGATATTAAGATTATA
CACATCCAACATATTAAAGTTATGAAAGAAACTTGACTTCTGAAAATCCTTAAGAGACTGCTTTCTTGATTCAGCTAGAGAAATATTATA
GTCAAAACTATTGAGTGAATTTTGTTTACAAATAGGTAAATTATACATTTGTATATTTAAAGTGCTGTGACATAGTATCTTTAAGAGTTT
GGCTCAGTTTTCACAGATTCATTTTGTCTTAAGAATTTCTTAAATATGTTCATGTATAATACTTGATCAAAATATTTTTGGGTTTTTTGT
TTTGTTTTAATGGGTTAGAAAATGTTTACAATCTTGGTCTTATATGATCACCAATGGAATAGTAACTTCCAGGTTTATATCAATATGAGC
TGACTTTAACTGAGTTGTTTGGGATAGGGAAGAAGCAGTCCCTCTACAGTATACAACTACTGCTTGCCAGCTGGATCAAAATAATCATGT
TTTATGAAAATATCTCCCTTAAGCAGTGTTAAGGTTGGTTTGCAGTGTGTAAGTGGCACATTGAACTGGAAGTTTTCTTGAAAGCTGCTT
CATCTATTAAGAAGCAATTTTCAAATTGTAGCGAATTATATTATCCCCTCTTTTAAAGAAACAGTCGTTATATGCTGATGTTTCTTAAAA
TAACTAAAATGTTCCTCTTAATGTGATTTTAAATGGAGTTATTTGTAGGTCCTTTCTTAGTAGTAAAGAATCTTCTAGAGGGAAACATTT
GTGCTTTTAGGGATAATCTTCCTTGTGCCTCACTACATCCCTAAGTGGGTATGACTCTTGTTATTACCACATGCTTTTTTAGTATATTTC
ACAAATTTACTTTTAAATATTATTTTAGATACGGTGTAACATGTGCAATTCAGAATAATTTTATAACAGGTCATGAAAAACATAACTTTA
GTTAGGATTCACAATATTTGTTCTCCACATAATGAGAGAATGAATGAGCCTTTGGAGATACTGATATAAGGCAATTATTTTTTGCAATGT
TGAATGTGTTTTTTAGTTTGATTCTTTTTTTTTCCCCCAATAGGGCACTACCTGCCATATCATCTTGTATTACTTTTTGATGTAAAGCGA
CTAATATTTACACTATGCCATATTTTTTTTAATTATAGTTGTAAATTATGAAAGATCCTTGAATTTTCTACAGATCTACAACTACTAATG
TAACAGACAAGGGCAATCTTGGTATTTAAATCTGAGCATGGCAGTTCTACCATAAAAAGTACTCTATTTTTCTAATTTCTAGGATTTTTA
AAATAACATTTCTGTAAGTCTGACATACTAATAGTCACTCAAGCAGTACCATTTATTTTAGTTTGCATATATTTTCACTGTTTTTAATTT
AATGTATTGAGTCTAATAGACTGTTTTGCAATAATTAGAATAAAGATTTATTTCTTCTAATCAAAGATGCATAACAGCTATTATCTAGGG
GACCACCAAATGTGATTTCAAAATTTTGTTAACTATTACAAATGTAATCCTTATATAGAAATTTTAATTTTGTAAAGTAGTGTATAATAT
TGTAATATTAAATTCTTGTTCTTAAATTCAAATATGTATTGATCTTCAATGTGCTGTGTTAAATCTTGCTTCTCTGAAAAGTTGGAGACA

>In-frame_RAD17_ENST00000509734_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_4346nt
CCCCGGGAGGCCGTACCTCCGAGAGGCTCGGCGTTGAGCCCGGGTAGGGCCAGGTGGCTGCCCTTTCACCTAGGGTAGTCCCTGGTCGCC
TCCGCTCTTCGCCTAAAAGGGGATGCAGCTCCGGGAAAGTAAGGCCGCCGCGGTTGCGGCTATATTATGTATATGTCTTAGAGACGTGAG
TCTATCTCTGCCTTCAAGCTTTCCTGGGCTCTCGTCGCTCCTCCTCCCGACCCGCCCATCCCATCTGGGGATGAGAAGATTGAGGGTGCA
GAGCCCTGTCCTGCAGCGGGGATTTGCGAGCTCAACCCGGCACCCCACTGATTACAGGATTACGTTGGACGAATATTTGAGCTTAGTATT
CCCTGTTCACTGTGTGGGGTGGTGGTGGGTCGGCTAGGAATAGTCTTGAAGGTCTACCTCTGACATCTCATTTCAGTAACCTCGCATCTT
CAGGGACAGTTATCTGCTTTTTAAAGGAGCAAGTGAATTCATGGTATTTTACTTTTTTGGGAAATACTGGAAATGAAGACCTGCAACTGT
AATTTGAAATAAGGAAAACTTTAATTTTCAGTATAAAAATTGCTCAAATAGAATTGCCTGATTTTAATGACAAAAGGTGAATTATAGTTT
AATGTACTGCAAGTCCTAAACTACGGATGGGAACTATTACAGTTTATAATGTCAAAAACTTTTCTTAGACCAAAGGTATCTTCCACAAAG
GTAACAGACTGGGTTGACCCATCATTTGATGATTTTCTAGAGTGTAGTGGCGTCTCTACTATTACTGCCACATCATTAGGTGTGAATAAC
TCAAGTCATAGAAGAAAAAATGGGCCTTCTACATTAGAAAGCAGCAGATTTCCAGCGAGAAAAAGAGGAAATCTATCTTCCTTAGAACAG
ATTTATGGTTTAGAAAATTCAAAAGAATATCTGTCTGAAAATGAACCATGGGTGGATAAATATAAACCAGAAACTCAGCATGAACTTGCT
GTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAAGTTTTAGAAAGGCAACCAAAACAGAAATCATTCCAGACTGGG
ACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAAAACCAGCCCTTGGTTTACCTTATGCTCACAACTCATCCCAGT
TTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGTGATAGAACCATACCTCAGCCCCCCATTCTTCAGCTTTCAGTG
GAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTACTGATGCTTTGGGTTGGAAAAAATTGTACACAGAATTTTCTC
AGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATGACAGACCTTCCAGAACTTGATACACCAGAATCTGCCAGAATA
ATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATACTTTATGTAATAAGGGATGAGAGTCCAATGAAAGCAAACTTC
CTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTATGAATTCCTGTTGCATATACAGCAACAAGTGAATAAATGAATG
AATGAAGAAATTTGACTTATTTTTAAGGAATGTCACGATAGTGCAGAATACCTGGAAATGTGTAATACCTTCTTTTTCTATTATGTTTGT
GGACTAATGTGATGATTGAGATGTTCTCACTGTGATTTCAACAACCTATAGCAAATAAAAGACCACAGCAGAGAATCAAACATGCAACTC
TGAAATACTGTATTTTTCAAATCAGAATATAGCTACGTATGATTGGATACTTTTTTCTTGCCAATTATGTTTGAGTTGTTATGGATTAAA
ATAAGAATATTGCAGAGGCAAAGTACATTTTGTAAAATAAAGATTTCTGTGTTCTACATGTATATTTCTCATTTTTAATTTTTCTGAATC
TTTGGCTGCTACATTTAAAACCTCACAAACCTAAGTGTTGCAGGGAAGTTACAAATTGATTGGTAGTGATGTTTTTAAAATAAAAACAAT
GGAAAGTAAATATAATGTAGGAAAACTAGAATTCATTCCCCACACGTGTCTTTTTTTTTTCTTTGTTAAGGGAAAGGATCATGTTGACTA
AAACTAAACTAATTCTAGTATAGCTTGAGAAAAATATGAAGAAACACATTCAAGCTTTAAAATCTGTCAGTATTCTTTATGCTTGAAGAA
CAAAGTCACTTTGATTTGAAGTGAGAACTATCATTAGGTGGTTTTCTGATTTCCTGATGAAGAGTTGGACATACTGTCTTAATCTATAGT
GAAAAGAATTTGAGCTGTCTTCATAAACACTGGGACTAGCAATGATAATAGGGAGATAAGAAACTTTAATTATCTTGATCCTTTAAGTGG
ATTTTATTTGGTGCATTTCTGCTCTGGGTATATAATAAAAGTGGGGGTTTTTGGTGAAATGAGTGAAGAAATGAAAGGTTTCTAAAGTGC
TATCCAAATACATCAGTAACATTTTTCTAAGGAGTTTAATTGTTAAATTGGAAGTCATTCATAAGAAATATTTATGCTTGAATATGAAAA
TCTATGAAAGCATAAATGCTGCTGTTTGATTTGGTGGATATTAAGATTATACACATCCAACATATTAAAGTTATGAAAGAAACTTGACTT
CTGAAAATCCTTAAGAGACTGCTTTCTTGATTCAGCTAGAGAAATATTATAGTCAAAACTATTGAGTGAATTTTGTTTACAAATAGGTAA
ATTATACATTTGTATATTTAAAGTGCTGTGACATAGTATCTTTAAGAGTTTGGCTCAGTTTTCACAGATTCATTTTGTCTTAAGAATTTC
TTAAATATGTTCATGTATAATACTTGATCAAAATATTTTTGGGTTTTTTGTTTTGTTTTAATGGGTTAGAAAATGTTTACAATCTTGGTC
TTATATGATCACCAATGGAATAGTAACTTCCAGGTTTATATCAATATGAGCTGACTTTAACTGAGTTGTTTGGGATAGGGAAGAAGCAGT
CCCTCTACAGTATACAACTACTGCTTGCCAGCTGGATCAAAATAATCATGTTTTATGAAAATATCTCCCTTAAGCAGTGTTAAGGTTGGT
TTGCAGTGTGTAAGTGGCACATTGAACTGGAAGTTTTCTTGAAAGCTGCTTCATCTATTAAGAAGCAATTTTCAAATTGTAGCGAATTAT
ATTATCCCCTCTTTTAAAGAAACAGTCGTTATATGCTGATGTTTCTTAAAATAACTAAAATGTTCCTCTTAATGTGATTTTAAATGGAGT
TATTTGTAGGTCCTTTCTTAGTAGTAAAGAATCTTCTAGAGGGAAACATTTGTGCTTTTAGGGATAATCTTCCTTGTGCCTCACTACATC
CCTAAGTGGGTATGACTCTTGTTATTACCACATGCTTTTTTAGTATATTTCACAAATTTACTTTTAAATATTATTTTAGATACGGTGTAA
CATGTGCAATTCAGAATAATTTTATAACAGGTCATGAAAAACATAACTTTAGTTAGGATTCACAATATTTGTTCTCCACATAATGAGAGA
ATGAATGAGCCTTTGGAGATACTGATATAAGGCAATTATTTTTTGCAATGTTGAATGTGTTTTTTAGTTTGATTCTTTTTTTTTCCCCCA
ATAGGGCACTACCTGCCATATCATCTTGTATTACTTTTTGATGTAAAGCGACTAATATTTACACTATGCCATATTTTTTTTAATTATAGT
TGTAAATTATGAAAGATCCTTGAATTTTCTACAGATCTACAACTACTAATGTAACAGACAAGGGCAATCTTGGTATTTAAATCTGAGCAT
GGCAGTTCTACCATAAAAAGTACTCTATTTTTCTAATTTCTAGGATTTTTAAAATAACATTTCTGTAAGTCTGACATACTAATAGTCACT
CAAGCAGTACCATTTATTTTAGTTTGCATATATTTTCACTGTTTTTAATTTAATGTATTGAGTCTAATAGACTGTTTTGCAATAATTAGA
ATAAAGATTTATTTCTTCTAATCAAAGATGCATAACAGCTATTATCTAGGGGACCACCAAATGTGATTTCAAAATTTTGTTAACTATTAC
AAATGTAATCCTTATATAGAAATTTTAATTTTGTAAAGTAGTGTATAATATTGTAATATTAAATTCTTGTTCTTAAATTCAAATATGTAT
TGATCTTCAATGTGCTGTGTTAAATCTTGCTTCTCTGAAAAGTTGGAGACAAGATTTGTCTTCCTTTTTACAGTTTGTAATTTTCACTGT

>In-frame_RAD17_ENST00000354868_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_4173nt
GAGGCCGTACCTCCGAGAGGCTCGGCGTTGAGCCCGGGTAGGGCCAGGTGGCTGCCCTTTCACCTAGGGTAGTCCCTGGTCGCCTCCGCT
CTTCGCCTAAAAGGGGATGCAGCTCCGGGAAACAAGTGAATTCATGGTATTTTACTTTTTTGGGAAATACTGGAAATGAAGACCTGCAAC
TGTAATTTGAAATAAGGAAAACTTTAATTTTCAGTATAAAAATTGCTCAAATAGAATTGCCTGATTTTAATGACAAAAGGTGAATTATAG
TTTAATGTACTGCAAGTCCTAAACTACGGATGGGAACTATTACAGTTTATAATGTCAAAAACTTTTCTTAGACCAAAGGTATCTTCCACA
AAGTATATGGGAGTCCACATTTATGTAAGAAATGAAACTATAAAATGTATAAATAATTTGCAAATCAGAATTGCTGTCGAAAGTTTTACT
ATAATGAAAGATATTTTCATACTCTCAAAAATATAGAGGAAAGGGGCCAAGATTATAGTACCAGTCACAATCTTTTGATGAGGACGAAAT
GAATCAGGTAACAGACTGGGTTGACCCATCATTTGATGATTTTCTAGAGTGTAGTGGCGTCTCTACTATTACTGCCACATCATTAGGTGT
GAATAACTCAAGTCATAGAAGAAAAAATGGGCCTTCTACATTAGAAAGCAGCAGATTTCCAGCGAGAAAAAGAGGAAATCTATCTTCCTT
AGAACAGATTTATGGTTTAGAAAATTCAAAAGAATATCTGTCTGAAAATGAACCATGGGTGGATAAATATAAACCAGAAACTCAGCATGA
ACTTGCTGTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAAGTTTTAGAAAGGCAACCAAAACAGAAATCATTCCA
GACTGGGACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAAAACCAGCCCTTGGTTTACCTTATGCTCACAACTCA
TCCCAGTTTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGTGATAGAACCATACCTCAGCCCCCCATTCTTCAGCT
TTCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTACTGATGCTTTGGGTTGGAAAAAATTGTACACAGAA
TTTTCTCAGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATGACAGACCTTCCAGAACTTGATACACCAGAATCTGC
CAGAATAATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATACTTTATGTAATAAGGGATGAGAGTCCAATGAAAGC
AAACTTCCTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTATGAATTCCTGTTGCATATACAGCAACAAGTGAATAA
ATGAATGAATGAAGAAATTTGACTTATTTTTAAGGAATGTCACGATAGTGCAGAATACCTGGAAATGTGTAATACCTTCTTTTTCTATTA
TGTTTGTGGACTAATGTGATGATTGAGATGTTCTCACTGTGATTTCAACAACCTATAGCAAATAAAAGACCACAGCAGAGAATCAAACAT
GCAACTCTGAAATACTGTATTTTTCAAATCAGAATATAGCTACGTATGATTGGATACTTTTTTCTTGCCAATTATGTTTGAGTTGTTATG
GATTAAAATAAGAATATTGCAGAGGCAAAGTACATTTTGTAAAATAAAGATTTCTGTGTTCTACATGTATATTTCTCATTTTTAATTTTT
CTGAATCTTTGGCTGCTACATTTAAAACCTCACAAACCTAAGTGTTGCAGGGAAGTTACAAATTGATTGGTAGTGATGTTTTTAAAATAA
AAACAATGGAAAGTAAATATAATGTAGGAAAACTAGAATTCATTCCCCACACGTGTCTTTTTTTTTTCTTTGTTAAGGGAAAGGATCATG
TTGACTAAAACTAAACTAATTCTAGTATAGCTTGAGAAAAATATGAAGAAACACATTCAAGCTTTAAAATCTGTCAGTATTCTTTATGCT
TGAAGAACAAAGTCACTTTGATTTGAAGTGAGAACTATCATTAGGTGGTTTTCTGATTTCCTGATGAAGAGTTGGACATACTGTCTTAAT
CTATAGTGAAAAGAATTTGAGCTGTCTTCATAAACACTGGGACTAGCAATGATAATAGGGAGATAAGAAACTTTAATTATCTTGATCCTT
TAAGTGGATTTTATTTGGTGCATTTCTGCTCTGGGTATATAATAAAAGTGGGGGTTTTTGGTGAAATGAGTGAAGAAATGAAAGGTTTCT
AAAGTGCTATCCAAATACATCAGTAACATTTTTCTAAGGAGTTTAATTGTTAAATTGGAAGTCATTCATAAGAAATATTTATGCTTGAAT
ATGAAAATCTATGAAAGCATAAATGCTGCTGTTTGATTTGGTGGATATTAAGATTATACACATCCAACATATTAAAGTTATGAAAGAAAC
TTGACTTCTGAAAATCCTTAAGAGACTGCTTTCTTGATTCAGCTAGAGAAATATTATAGTCAAAACTATTGAGTGAATTTTGTTTACAAA
TAGGTAAATTATACATTTGTATATTTAAAGTGCTGTGACATAGTATCTTTAAGAGTTTGGCTCAGTTTTCACAGATTCATTTTGTCTTAA
GAATTTCTTAAATATGTTCATGTATAATACTTGATCAAAATATTTTTGGGTTTTTTGTTTTGTTTTAATGGGTTAGAAAATGTTTACAAT
CTTGGTCTTATATGATCACCAATGGAATAGTAACTTCCAGGTTTATATCAATATGAGCTGACTTTAACTGAGTTGTTTGGGATAGGGAAG
AAGCAGTCCCTCTACAGTATACAACTACTGCTTGCCAGCTGGATCAAAATAATCATGTTTTATGAAAATATCTCCCTTAAGCAGTGTTAA
GGTTGGTTTGCAGTGTGTAAGTGGCACATTGAACTGGAAGTTTTCTTGAAAGCTGCTTCATCTATTAAGAAGCAATTTTCAAATTGTAGC
GAATTATATTATCCCCTCTTTTAAAGAAACAGTCGTTATATGCTGATGTTTCTTAAAATAACTAAAATGTTCCTCTTAATGTGATTTTAA
ATGGAGTTATTTGTAGGTCCTTTCTTAGTAGTAAAGAATCTTCTAGAGGGAAACATTTGTGCTTTTAGGGATAATCTTCCTTGTGCCTCA
CTACATCCCTAAGTGGGTATGACTCTTGTTATTACCACATGCTTTTTTAGTATATTTCACAAATTTACTTTTAAATATTATTTTAGATAC
GGTGTAACATGTGCAATTCAGAATAATTTTATAACAGGTCATGAAAAACATAACTTTAGTTAGGATTCACAATATTTGTTCTCCACATAA
TGAGAGAATGAATGAGCCTTTGGAGATACTGATATAAGGCAATTATTTTTTGCAATGTTGAATGTGTTTTTTAGTTTGATTCTTTTTTTT
TCCCCCAATAGGGCACTACCTGCCATATCATCTTGTATTACTTTTTGATGTAAAGCGACTAATATTTACACTATGCCATATTTTTTTTAA
TTATAGTTGTAAATTATGAAAGATCCTTGAATTTTCTACAGATCTACAACTACTAATGTAACAGACAAGGGCAATCTTGGTATTTAAATC
TGAGCATGGCAGTTCTACCATAAAAAGTACTCTATTTTTCTAATTTCTAGGATTTTTAAAATAACATTTCTGTAAGTCTGACATACTAAT
AGTCACTCAAGCAGTACCATTTATTTTAGTTTGCATATATTTTCACTGTTTTTAATTTAATGTATTGAGTCTAATAGACTGTTTTGCAAT
AATTAGAATAAAGATTTATTTCTTCTAATCAAAGATGCATAACAGCTATTATCTAGGGGACCACCAAATGTGATTTCAAAATTTTGTTAA
CTATTACAAATGTAATCCTTATATAGAAATTTTAATTTTGTAAAGTAGTGTATAATATTGTAATATTAAATTCTTGTTCTTAAATTCAAA
TATGTATTGATCTTCAATGTGCTGTGTTAAATCTTGCTTCTCTGAAAAGTTGGAGACAAGATTTGTCTTCCTTTTTACAGTTTGTAATTT

>In-frame_RAD17_ENST00000354312_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_4056nt
CGAGAGGCTCGGCGTTGAGCCCGGGTAGGGCCAGGTGGCTGCCCTTTCACCTAGGGTAGTCCCTGGTCGCCTCCGCTCTTCGCCTAAAAG
GGGATGCAGCTCCGGGAAACAAGTGAATTCATGGTATTTTACTTTTTTGGGAAATACTGGAAATGAAGACCTGCAACTGTAATTTGAAAT
AAGGAAAACTTTAATTTTCAGTATAAAAATTGCTCAAATAGAATTGCCTGATTTTAATGACAAAAGTATATGGGAGTCCACATTTATGTA
AGAAATGAAACTATAAAATGTATAAATAATTTGCAAATCAGAATTGCTGTCGAAAGTTTTACTATAATGAAAGATATTTTCATACTCTCA
AAAATATAGAGGAAAGGGGCCAAGATTATAGTACCAGTCACAATCTTTTGATGAGGACGAAATGAATCAGGTAACAGACTGGGTTGACCC
ATCATTTGATGATTTTCTAGAGTGTAGTGGCGTCTCTACTATTACTGCCACATCATTAGGTGTGAATAACTCAAGTCATAGAAGAAAAAA
TGGGCCTTCTACATTAGAAAGCAGCAGATTTCCAGCGAGAAAAAGAGGAAATCTATCTTCCTTAGAACAGATTTATGGTTTAGAAAATTC
AAAAGAATATCTGTCTGAAAATGAACCATGGGTGGATAAATATAAACCAGAAACTCAGCATGAACTTGCTGTGCATAAAAAGAAAATTGA
AGAAGTCGAAACCTGGTTAAAAGCTCAAGTTTTAGAAAGGCAACCAAAACAGAAATCATTCCAGACTGGGACAAATGCACGTCTAGATGA
ACGCATTTTTGCTATGTGTCAAGTGAAAAACCAGCCCTTGGTTTACCTTATGCTCACAACTCATCCCAGTTTGTATAGAGTTGACAATCT
CTCAGATGAGGGAGCACTCAACATCAGTGATAGAACCATACCTCAGCCCCCCATTCTTCAGCTTTCAGTGGAGAAGCTGAGCAGAGATGG
AGCTTTCCTCATGGATGCAGGCTCTGTACTGATGCTTTGGGTTGGAAAAAATTGTACACAGAATTTTCTCAGCCAAGTTCTAGGAGTTCA
AAACTATGCATCAATTCCACAGCCTATGACAGACCTTCCAGAACTTGATACACCAGAATCTGCCAGAATAATAGCTTTCATCTCTTGGCT
TAGAGAGCAGAGACCATTTTTCCCAATACTTTATGTAATAAGGGATGAGAGTCCAATGAAAGCAAACTTCCTTCAAAACATGATAGAAGA
CAGAACAGAATCTGCATTATCATATTATGAATTCCTGTTGCATATACAGCAACAAGTGAATAAATGAATGAATGAAGAAATTTGACTTAT
TTTTAAGGAATGTCACGATAGTGCAGAATACCTGGAAATGTGTAATACCTTCTTTTTCTATTATGTTTGTGGACTAATGTGATGATTGAG
ATGTTCTCACTGTGATTTCAACAACCTATAGCAAATAAAAGACCACAGCAGAGAATCAAACATGCAACTCTGAAATACTGTATTTTTCAA
ATCAGAATATAGCTACGTATGATTGGATACTTTTTTCTTGCCAATTATGTTTGAGTTGTTATGGATTAAAATAAGAATATTGCAGAGGCA
AAGTACATTTTGTAAAATAAAGATTTCTGTGTTCTACATGTATATTTCTCATTTTTAATTTTTCTGAATCTTTGGCTGCTACATTTAAAA
CCTCACAAACCTAAGTGTTGCAGGGAAGTTACAAATTGATTGGTAGTGATGTTTTTAAAATAAAAACAATGGAAAGTAAATATAATGTAG
GAAAACTAGAATTCATTCCCCACACGTGTCTTTTTTTTTTCTTTGTTAAGGGAAAGGATCATGTTGACTAAAACTAAACTAATTCTAGTA
TAGCTTGAGAAAAATATGAAGAAACACATTCAAGCTTTAAAATCTGTCAGTATTCTTTATGCTTGAAGAACAAAGTCACTTTGATTTGAA
GTGAGAACTATCATTAGGTGGTTTTCTGATTTCCTGATGAAGAGTTGGACATACTGTCTTAATCTATAGTGAAAAGAATTTGAGCTGTCT
TCATAAACACTGGGACTAGCAATGATAATAGGGAGATAAGAAACTTTAATTATCTTGATCCTTTAAGTGGATTTTATTTGGTGCATTTCT
GCTCTGGGTATATAATAAAAGTGGGGGTTTTTGGTGAAATGAGTGAAGAAATGAAAGGTTTCTAAAGTGCTATCCAAATACATCAGTAAC
ATTTTTCTAAGGAGTTTAATTGTTAAATTGGAAGTCATTCATAAGAAATATTTATGCTTGAATATGAAAATCTATGAAAGCATAAATGCT
GCTGTTTGATTTGGTGGATATTAAGATTATACACATCCAACATATTAAAGTTATGAAAGAAACTTGACTTCTGAAAATCCTTAAGAGACT
GCTTTCTTGATTCAGCTAGAGAAATATTATAGTCAAAACTATTGAGTGAATTTTGTTTACAAATAGGTAAATTATACATTTGTATATTTA
AAGTGCTGTGACATAGTATCTTTAAGAGTTTGGCTCAGTTTTCACAGATTCATTTTGTCTTAAGAATTTCTTAAATATGTTCATGTATAA
TACTTGATCAAAATATTTTTGGGTTTTTTGTTTTGTTTTAATGGGTTAGAAAATGTTTACAATCTTGGTCTTATATGATCACCAATGGAA
TAGTAACTTCCAGGTTTATATCAATATGAGCTGACTTTAACTGAGTTGTTTGGGATAGGGAAGAAGCAGTCCCTCTACAGTATACAACTA
CTGCTTGCCAGCTGGATCAAAATAATCATGTTTTATGAAAATATCTCCCTTAAGCAGTGTTAAGGTTGGTTTGCAGTGTGTAAGTGGCAC
ATTGAACTGGAAGTTTTCTTGAAAGCTGCTTCATCTATTAAGAAGCAATTTTCAAATTGTAGCGAATTATATTATCCCCTCTTTTAAAGA
AACAGTCGTTATATGCTGATGTTTCTTAAAATAACTAAAATGTTCCTCTTAATGTGATTTTAAATGGAGTTATTTGTAGGTCCTTTCTTA
GTAGTAAAGAATCTTCTAGAGGGAAACATTTGTGCTTTTAGGGATAATCTTCCTTGTGCCTCACTACATCCCTAAGTGGGTATGACTCTT
GTTATTACCACATGCTTTTTTAGTATATTTCACAAATTTACTTTTAAATATTATTTTAGATACGGTGTAACATGTGCAATTCAGAATAAT
TTTATAACAGGTCATGAAAAACATAACTTTAGTTAGGATTCACAATATTTGTTCTCCACATAATGAGAGAATGAATGAGCCTTTGGAGAT
ACTGATATAAGGCAATTATTTTTTGCAATGTTGAATGTGTTTTTTAGTTTGATTCTTTTTTTTTCCCCCAATAGGGCACTACCTGCCATA
TCATCTTGTATTACTTTTTGATGTAAAGCGACTAATATTTACACTATGCCATATTTTTTTTAATTATAGTTGTAAATTATGAAAGATCCT
TGAATTTTCTACAGATCTACAACTACTAATGTAACAGACAAGGGCAATCTTGGTATTTAAATCTGAGCATGGCAGTTCTACCATAAAAAG
TACTCTATTTTTCTAATTTCTAGGATTTTTAAAATAACATTTCTGTAAGTCTGACATACTAATAGTCACTCAAGCAGTACCATTTATTTT
AGTTTGCATATATTTTCACTGTTTTTAATTTAATGTATTGAGTCTAATAGACTGTTTTGCAATAATTAGAATAAAGATTTATTTCTTCTA
ATCAAAGATGCATAACAGCTATTATCTAGGGGACCACCAAATGTGATTTCAAAATTTTGTTAACTATTACAAATGTAATCCTTATATAGA
AATTTTAATTTTGTAAAGTAGTGTATAATATTGTAATATTAAATTCTTGTTCTTAAATTCAAATATGTATTGATCTTCAATGTGCTGTGT
TAAATCTTGCTTCTCTGAAAAGTTGGAGACAAGATTTGTCTTCCTTTTTACAGTTTGTAATTTTCACTGTTTTATTCCTGTTAAAAAAAA

>In-frame_RAD17_ENST00000345306_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_3902nt
AGCCCGGGTAGGGCCAGGTGGCTGCCCTTTCACCTAGGGTAGTCCCTGGTCGCCTCCGCTCTTCGCCTAAAAGGGGATGCAGCTCCGGGA
AATATATGGGAGTCCACATTTATGTAAGAAATGAAACTATAAAATGTATAAATAATTTGCAAATCAGAATTGCTGTCGAAAGTTTTACTA
TAATGAAAGATATTTTCATACTCTCAAAAATATAGAGGAAAGGGGCCAAGATTATAGTACCAGTCACAATCTTTTGATGAGGACGAAATG
AATCAGGTAACAGACTGGGTTGACCCATCATTTGATGATTTTCTAGAGTGTAGTGGCGTCTCTACTATTACTGCCACATCATTAGGTGTG
AATAACTCAAGTCATAGAAGAAAAAATGGGCCTTCTACATTAGAAAGCAGCAGATTTCCAGCGAGAAAAAGAGGAAATCTATCTTCCTTA
GAACAGATTTATGGTTTAGAAAATTCAAAAGAATATCTGTCTGAAAATGAACCATGGGTGGATAAATATAAACCAGAAACTCAGCATGAA
CTTGCTGTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAAGTTTTAGAAAGGCAACCAAAACAGAAATCATTCCAG
ACTGGGACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAAAACCAGCCCTTGGTTTACCTTATGCTCACAACTCAT
CCCAGTTTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGTGATAGAACCATACCTCAGCCCCCCATTCTTCAGCTT
TCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTACTGATGCTTTGGGTTGGAAAAAATTGTACACAGAAT
TTTCTCAGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATGACAGACCTTCCAGAACTTGATACACCAGAATCTGCC
AGAATAATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATACTTTATGTAATAAGGGATGAGAGTCCAATGAAAGCA
AACTTCCTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTATGAATTCCTGTTGCATATACAGCAACAAGTGAATAAA
TGAATGAATGAAGAAATTTGACTTATTTTTAAGGAATGTCACGATAGTGCAGAATACCTGGAAATGTGTAATACCTTCTTTTTCTATTAT
GTTTGTGGACTAATGTGATGATTGAGATGTTCTCACTGTGATTTCAACAACCTATAGCAAATAAAAGACCACAGCAGAGAATCAAACATG
CAACTCTGAAATACTGTATTTTTCAAATCAGAATATAGCTACGTATGATTGGATACTTTTTTCTTGCCAATTATGTTTGAGTTGTTATGG
ATTAAAATAAGAATATTGCAGAGGCAAAGTACATTTTGTAAAATAAAGATTTCTGTGTTCTACATGTATATTTCTCATTTTTAATTTTTC
TGAATCTTTGGCTGCTACATTTAAAACCTCACAAACCTAAGTGTTGCAGGGAAGTTACAAATTGATTGGTAGTGATGTTTTTAAAATAAA
AACAATGGAAAGTAAATATAATGTAGGAAAACTAGAATTCATTCCCCACACGTGTCTTTTTTTTTTCTTTGTTAAGGGAAAGGATCATGT
TGACTAAAACTAAACTAATTCTAGTATAGCTTGAGAAAAATATGAAGAAACACATTCAAGCTTTAAAATCTGTCAGTATTCTTTATGCTT
GAAGAACAAAGTCACTTTGATTTGAAGTGAGAACTATCATTAGGTGGTTTTCTGATTTCCTGATGAAGAGTTGGACATACTGTCTTAATC
TATAGTGAAAAGAATTTGAGCTGTCTTCATAAACACTGGGACTAGCAATGATAATAGGGAGATAAGAAACTTTAATTATCTTGATCCTTT
AAGTGGATTTTATTTGGTGCATTTCTGCTCTGGGTATATAATAAAAGTGGGGGTTTTTGGTGAAATGAGTGAAGAAATGAAAGGTTTCTA
AAGTGCTATCCAAATACATCAGTAACATTTTTCTAAGGAGTTTAATTGTTAAATTGGAAGTCATTCATAAGAAATATTTATGCTTGAATA
TGAAAATCTATGAAAGCATAAATGCTGCTGTTTGATTTGGTGGATATTAAGATTATACACATCCAACATATTAAAGTTATGAAAGAAACT
TGACTTCTGAAAATCCTTAAGAGACTGCTTTCTTGATTCAGCTAGAGAAATATTATAGTCAAAACTATTGAGTGAATTTTGTTTACAAAT
AGGTAAATTATACATTTGTATATTTAAAGTGCTGTGACATAGTATCTTTAAGAGTTTGGCTCAGTTTTCACAGATTCATTTTGTCTTAAG
AATTTCTTAAATATGTTCATGTATAATACTTGATCAAAATATTTTTGGGTTTTTTGTTTTGTTTTAATGGGTTAGAAAATGTTTACAATC
TTGGTCTTATATGATCACCAATGGAATAGTAACTTCCAGGTTTATATCAATATGAGCTGACTTTAACTGAGTTGTTTGGGATAGGGAAGA
AGCAGTCCCTCTACAGTATACAACTACTGCTTGCCAGCTGGATCAAAATAATCATGTTTTATGAAAATATCTCCCTTAAGCAGTGTTAAG
GTTGGTTTGCAGTGTGTAAGTGGCACATTGAACTGGAAGTTTTCTTGAAAGCTGCTTCATCTATTAAGAAGCAATTTTCAAATTGTAGCG
AATTATATTATCCCCTCTTTTAAAGAAACAGTCGTTATATGCTGATGTTTCTTAAAATAACTAAAATGTTCCTCTTAATGTGATTTTAAA
TGGAGTTATTTGTAGGTCCTTTCTTAGTAGTAAAGAATCTTCTAGAGGGAAACATTTGTGCTTTTAGGGATAATCTTCCTTGTGCCTCAC
TACATCCCTAAGTGGGTATGACTCTTGTTATTACCACATGCTTTTTTAGTATATTTCACAAATTTACTTTTAAATATTATTTTAGATACG
GTGTAACATGTGCAATTCAGAATAATTTTATAACAGGTCATGAAAAACATAACTTTAGTTAGGATTCACAATATTTGTTCTCCACATAAT
GAGAGAATGAATGAGCCTTTGGAGATACTGATATAAGGCAATTATTTTTTGCAATGTTGAATGTGTTTTTTAGTTTGATTCTTTTTTTTT
CCCCCAATAGGGCACTACCTGCCATATCATCTTGTATTACTTTTTGATGTAAAGCGACTAATATTTACACTATGCCATATTTTTTTTAAT
TATAGTTGTAAATTATGAAAGATCCTTGAATTTTCTACAGATCTACAACTACTAATGTAACAGACAAGGGCAATCTTGGTATTTAAATCT
GAGCATGGCAGTTCTACCATAAAAAGTACTCTATTTTTCTAATTTCTAGGATTTTTAAAATAACATTTCTGTAAGTCTGACATACTAATA
GTCACTCAAGCAGTACCATTTATTTTAGTTTGCATATATTTTCACTGTTTTTAATTTAATGTATTGAGTCTAATAGACTGTTTTGCAATA
ATTAGAATAAAGATTTATTTCTTCTAATCAAAGATGCATAACAGCTATTATCTAGGGGACCACCAAATGTGATTTCAAAATTTTGTTAAC
TATTACAAATGTAATCCTTATATAGAAATTTTAATTTTGTAAAGTAGTGTATAATATTGTAATATTAAATTCTTGTTCTTAAATTCAAAT
ATGTATTGATCTTCAATGTGCTGTGTTAAATCTTGCTTCTCTGAAAAGTTGGAGACAAGATTTGTCTTCCTTTTTACAGTTTGTAATTTT

>In-frame_RAD17_ENST00000305138_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_4277nt
ACCTGTATACCTTTTGAAACGTCACAGTCTCTAATCGTGAACGATTTGGGGCGGAGGGCTGAACAATGTGTTTTCTAGTGTGTCGAGGTG
TTTATAGGCTATGTGTGCCTCCAAACTGTAAAGTAGTCCAGTATACTTTCCAATGTATAAGTTTGTAGACCTTAAACTTTTCTTCTGGCT
AACTTAAAATCGTTGAATTCACTAGTTTGCATAAACATTTAAGAATTTGAAAACACGGTTGAAAAACAGTGTTACCAAGAAATTTTGTAA
TAACATGTTCAAATGAAGACAAAAATTTTACAGTTTAAGACTTAAATTCTTCGTCCACAGCAAGTGAATTCATGGTATTTTACTTTTTTG
GGAAATACTGGAAATGAAGACCTGCAACTGTAATTTGAAATAAGGAAAACTTTAATTTTCAGTATAAAAATTGCTCAAATAGAATTGCCT
GATTTTAATGACAAAAGTATATGGGAGTCCACATTTATGTAAGAAATGAAACTATAAAATGTATAAATAATTTGCAAATCAGAATTGCTG
TCGAAAGTTTTACTATAATGAAAGATATTTTCATACTCTCAAAAATATAGAGGAAAGGGGCCAAGATTATAGTACCAGTCACAATCTTTT
GATGAGGACGAAATGAATCAGGTAACAGACTGGGTTGACCCATCATTTGATGATTTTCTAGAGTGTAGTGGCGTCTCTACTATTACTGCC
ACATCATTAGGTGTGAATAACTCAAGTCATAGAAGAAAAAATGGGCCTTCTACATTAGAAAGCAGCAGATTTCCAGCGAGAAAAAGAGGA
AATCTATCTTCCTTAGAACAGATTTATGGTTTAGAAAATTCAAAAGAATATCTGTCTGAAAATGAACCATGGGTGGATAAATATAAACCA
GAAACTCAGCATGAACTTGCTGTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAAGTTTTAGAAAGGCAACCAAAA
CAGAAATCATTCCAGACTGGGACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAAAACCAGCCCTTGGTTTACCTT
ATGCTCACAACTCATCCCAGTTTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGTGATAGAACCATACCTCAGCCC
CCCATTCTTCAGCTTTCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTACTGATGCTTTGGGTTGGAAAA
AATTGTACACAGAATTTTCTCAGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATGACAGACCTTCCAGAACTTGAT
ACACCAGAATCTGCCAGAATAATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATACTTTATGTAATAAGGGATGAG
AGTCCAATGAAAGCAAACTTCCTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTATGAATTCCTGTTGCATATACAG
CAACAAGTGAATAAATGAATGAATGAAGAAATTTGACTTATTTTTAAGGAATGTCACGATAGTGCAGAATACCTGGAAATGTGTAATACC
TTCTTTTTCTATTATGTTTGTGGACTAATGTGATGATTGAGATGTTCTCACTGTGATTTCAACAACCTATAGCAAATAAAAGACCACAGC
AGAGAATCAAACATGCAACTCTGAAATACTGTATTTTTCAAATCAGAATATAGCTACGTATGATTGGATACTTTTTTCTTGCCAATTATG
TTTGAGTTGTTATGGATTAAAATAAGAATATTGCAGAGGCAAAGTACATTTTGTAAAATAAAGATTTCTGTGTTCTACATGTATATTTCT
CATTTTTAATTTTTCTGAATCTTTGGCTGCTACATTTAAAACCTCACAAACCTAAGTGTTGCAGGGAAGTTACAAATTGATTGGTAGTGA
TGTTTTTAAAATAAAAACAATGGAAAGTAAATATAATGTAGGAAAACTAGAATTCATTCCCCACACGTGTCTTTTTTTTTTCTTTGTTAA
GGGAAAGGATCATGTTGACTAAAACTAAACTAATTCTAGTATAGCTTGAGAAAAATATGAAGAAACACATTCAAGCTTTAAAATCTGTCA
GTATTCTTTATGCTTGAAGAACAAAGTCACTTTGATTTGAAGTGAGAACTATCATTAGGTGGTTTTCTGATTTCCTGATGAAGAGTTGGA
CATACTGTCTTAATCTATAGTGAAAAGAATTTGAGCTGTCTTCATAAACACTGGGACTAGCAATGATAATAGGGAGATAAGAAACTTTAA
TTATCTTGATCCTTTAAGTGGATTTTATTTGGTGCATTTCTGCTCTGGGTATATAATAAAAGTGGGGGTTTTTGGTGAAATGAGTGAAGA
AATGAAAGGTTTCTAAAGTGCTATCCAAATACATCAGTAACATTTTTCTAAGGAGTTTAATTGTTAAATTGGAAGTCATTCATAAGAAAT
ATTTATGCTTGAATATGAAAATCTATGAAAGCATAAATGCTGCTGTTTGATTTGGTGGATATTAAGATTATACACATCCAACATATTAAA
GTTATGAAAGAAACTTGACTTCTGAAAATCCTTAAGAGACTGCTTTCTTGATTCAGCTAGAGAAATATTATAGTCAAAACTATTGAGTGA
ATTTTGTTTACAAATAGGTAAATTATACATTTGTATATTTAAAGTGCTGTGACATAGTATCTTTAAGAGTTTGGCTCAGTTTTCACAGAT
TCATTTTGTCTTAAGAATTTCTTAAATATGTTCATGTATAATACTTGATCAAAATATTTTTGGGTTTTTTGTTTTGTTTTAATGGGTTAG
AAAATGTTTACAATCTTGGTCTTATATGATCACCAATGGAATAGTAACTTCCAGGTTTATATCAATATGAGCTGACTTTAACTGAGTTGT
TTGGGATAGGGAAGAAGCAGTCCCTCTACAGTATACAACTACTGCTTGCCAGCTGGATCAAAATAATCATGTTTTATGAAAATATCTCCC
TTAAGCAGTGTTAAGGTTGGTTTGCAGTGTGTAAGTGGCACATTGAACTGGAAGTTTTCTTGAAAGCTGCTTCATCTATTAAGAAGCAAT
TTTCAAATTGTAGCGAATTATATTATCCCCTCTTTTAAAGAAACAGTCGTTATATGCTGATGTTTCTTAAAATAACTAAAATGTTCCTCT
TAATGTGATTTTAAATGGAGTTATTTGTAGGTCCTTTCTTAGTAGTAAAGAATCTTCTAGAGGGAAACATTTGTGCTTTTAGGGATAATC
TTCCTTGTGCCTCACTACATCCCTAAGTGGGTATGACTCTTGTTATTACCACATGCTTTTTTAGTATATTTCACAAATTTACTTTTAAAT
ATTATTTTAGATACGGTGTAACATGTGCAATTCAGAATAATTTTATAACAGGTCATGAAAAACATAACTTTAGTTAGGATTCACAATATT
TGTTCTCCACATAATGAGAGAATGAATGAGCCTTTGGAGATACTGATATAAGGCAATTATTTTTTGCAATGTTGAATGTGTTTTTTAGTT
TGATTCTTTTTTTTTCCCCCAATAGGGCACTACCTGCCATATCATCTTGTATTACTTTTTGATGTAAAGCGACTAATATTTACACTATGC
CATATTTTTTTTAATTATAGTTGTAAATTATGAAAGATCCTTGAATTTTCTACAGATCTACAACTACTAATGTAACAGACAAGGGCAATC
TTGGTATTTAAATCTGAGCATGGCAGTTCTACCATAAAAAGTACTCTATTTTTCTAATTTCTAGGATTTTTAAAATAACATTTCTGTAAG
TCTGACATACTAATAGTCACTCAAGCAGTACCATTTATTTTAGTTTGCATATATTTTCACTGTTTTTAATTTAATGTATTGAGTCTAATA
GACTGTTTTGCAATAATTAGAATAAAGATTTATTTCTTCTAATCAAAGATGCATAACAGCTATTATCTAGGGGACCACCAAATGTGATTT
CAAAATTTTGTTAACTATTACAAATGTAATCCTTATATAGAAATTTTAATTTTGTAAAGTAGTGTATAATATTGTAATATTAAATTCTTG
TTCTTAAATTCAAATATGTATTGATCTTCAATGTGCTGTGTTAAATCTTGCTTCTCTGAAAAGTTGGAGACAAGATTTGTCTTCCTTTTT

>In-frame_RAD17_ENST00000282891_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_3689nt
CAAGTGAATTCATGGTATTTTACTTTTTTGGGAAATACTGGAAATGAAGACCTGCAACTGTAATTTGAAATAAGGAAAACTTTAATTTTC
AGTATAAAAATTGCTCAAATAGAATTGCCTGATTTTAATGACAAAAGTATATGGGAGTCCACATTTATGTAAGAAATGAAACTATAAAAT
GTATAAATAATTTGCAAATCAGAATTGCTGTCGAAAGTTTTACTATAATGAAAGATATTTTCATACTCTCAAAAATATAGAGGAAAGGGG
CCAAGATTATAGTACCAGTCACAATCTTTTGATGAGGACGAAATGAATCAGCATGAACTTGCTGTGCATAAAAAGAAAATTGAAGAAGTC
GAAACCTGGTTAAAAGCTCAAGTTTTAGAAAGGCAACCAAAACAGAAATCATTCCAGACTGGGACAAATGCACGTCTAGATGAACGCATT
TTTGCTATGTGTCAAGTGAAAAACCAGCCCTTGGTTTACCTTATGCTCACAACTCATCCCAGTTTGTATAGAGTTGACAATCTCTCAGAT
GAGGGAGCACTCAACATCAGTGATAGAACCATACCTCAGCCCCCCATTCTTCAGCTTTCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTC
CTCATGGATGCAGGCTCTGTACTGATGCTTTGGGTTGGAAAAAATTGTACACAGAATTTTCTCAGCCAAGTTCTAGGAGTTCAAAACTAT
GCATCAATTCCACAGCCTATGACAGACCTTCCAGAACTTGATACACCAGAATCTGCCAGAATAATAGCTTTCATCTCTTGGCTTAGAGAG
CAGAGACCATTTTTCCCAATACTTTATGTAATAAGGGATGAGAGTCCAATGAAAGCAAACTTCCTTCAAAACATGATAGAAGACAGAACA
GAATCTGCATTATCATATTATGAATTCCTGTTGCATATACAGCAACAAGTGAATAAATGAATGAATGAAGAAATTTGACTTATTTTTAAG
GAATGTCACGATAGTGCAGAATACCTGGAAATGTGTAATACCTTCTTTTTCTATTATGTTTGTGGACTAATGTGATGATTGAGATGTTCT
CACTGTGATTTCAACAACCTATAGCAAATAAAAGACCACAGCAGAGAATCAAACATGCAACTCTGAAATACTGTATTTTTCAAATCAGAA
TATAGCTACGTATGATTGGATACTTTTTTCTTGCCAATTATGTTTGAGTTGTTATGGATTAAAATAAGAATATTGCAGAGGCAAAGTACA
TTTTGTAAAATAAAGATTTCTGTGTTCTACATGTATATTTCTCATTTTTAATTTTTCTGAATCTTTGGCTGCTACATTTAAAACCTCACA
AACCTAAGTGTTGCAGGGAAGTTACAAATTGATTGGTAGTGATGTTTTTAAAATAAAAACAATGGAAAGTAAATATAATGTAGGAAAACT
AGAATTCATTCCCCACACGTGTCTTTTTTTTTTCTTTGTTAAGGGAAAGGATCATGTTGACTAAAACTAAACTAATTCTAGTATAGCTTG
AGAAAAATATGAAGAAACACATTCAAGCTTTAAAATCTGTCAGTATTCTTTATGCTTGAAGAACAAAGTCACTTTGATTTGAAGTGAGAA
CTATCATTAGGTGGTTTTCTGATTTCCTGATGAAGAGTTGGACATACTGTCTTAATCTATAGTGAAAAGAATTTGAGCTGTCTTCATAAA
CACTGGGACTAGCAATGATAATAGGGAGATAAGAAACTTTAATTATCTTGATCCTTTAAGTGGATTTTATTTGGTGCATTTCTGCTCTGG
GTATATAATAAAAGTGGGGGTTTTTGGTGAAATGAGTGAAGAAATGAAAGGTTTCTAAAGTGCTATCCAAATACATCAGTAACATTTTTC
TAAGGAGTTTAATTGTTAAATTGGAAGTCATTCATAAGAAATATTTATGCTTGAATATGAAAATCTATGAAAGCATAAATGCTGCTGTTT
GATTTGGTGGATATTAAGATTATACACATCCAACATATTAAAGTTATGAAAGAAACTTGACTTCTGAAAATCCTTAAGAGACTGCTTTCT
TGATTCAGCTAGAGAAATATTATAGTCAAAACTATTGAGTGAATTTTGTTTACAAATAGGTAAATTATACATTTGTATATTTAAAGTGCT
GTGACATAGTATCTTTAAGAGTTTGGCTCAGTTTTCACAGATTCATTTTGTCTTAAGAATTTCTTAAATATGTTCATGTATAATACTTGA
TCAAAATATTTTTGGGTTTTTTGTTTTGTTTTAATGGGTTAGAAAATGTTTACAATCTTGGTCTTATATGATCACCAATGGAATAGTAAC
TTCCAGGTTTATATCAATATGAGCTGACTTTAACTGAGTTGTTTGGGATAGGGAAGAAGCAGTCCCTCTACAGTATACAACTACTGCTTG
CCAGCTGGATCAAAATAATCATGTTTTATGAAAATATCTCCCTTAAGCAGTGTTAAGGTTGGTTTGCAGTGTGTAAGTGGCACATTGAAC
TGGAAGTTTTCTTGAAAGCTGCTTCATCTATTAAGAAGCAATTTTCAAATTGTAGCGAATTATATTATCCCCTCTTTTAAAGAAACAGTC
GTTATATGCTGATGTTTCTTAAAATAACTAAAATGTTCCTCTTAATGTGATTTTAAATGGAGTTATTTGTAGGTCCTTTCTTAGTAGTAA
AGAATCTTCTAGAGGGAAACATTTGTGCTTTTAGGGATAATCTTCCTTGTGCCTCACTACATCCCTAAGTGGGTATGACTCTTGTTATTA
CCACATGCTTTTTTAGTATATTTCACAAATTTACTTTTAAATATTATTTTAGATACGGTGTAACATGTGCAATTCAGAATAATTTTATAA
CAGGTCATGAAAAACATAACTTTAGTTAGGATTCACAATATTTGTTCTCCACATAATGAGAGAATGAATGAGCCTTTGGAGATACTGATA
TAAGGCAATTATTTTTTGCAATGTTGAATGTGTTTTTTAGTTTGATTCTTTTTTTTTCCCCCAATAGGGCACTACCTGCCATATCATCTT
GTATTACTTTTTGATGTAAAGCGACTAATATTTACACTATGCCATATTTTTTTTAATTATAGTTGTAAATTATGAAAGATCCTTGAATTT
TCTACAGATCTACAACTACTAATGTAACAGACAAGGGCAATCTTGGTATTTAAATCTGAGCATGGCAGTTCTACCATAAAAAGTACTCTA
TTTTTCTAATTTCTAGGATTTTTAAAATAACATTTCTGTAAGTCTGACATACTAATAGTCACTCAAGCAGTACCATTTATTTTAGTTTGC
ATATATTTTCACTGTTTTTAATTTAATGTATTGAGTCTAATAGACTGTTTTGCAATAATTAGAATAAAGATTTATTTCTTCTAATCAAAG
ATGCATAACAGCTATTATCTAGGGGACCACCAAATGTGATTTCAAAATTTTGTTAACTATTACAAATGTAATCCTTATATAGAAATTTTA
ATTTTGTAAAGTAGTGTATAATATTGTAATATTAAATTCTTGTTCTTAAATTCAAATATGTATTGATCTTCAATGTGCTGTGTTAAATCT

>In-frame_RAD17_ENST00000380774_chr5_68670538_+_SEC24A_ENST00000398844_chr5_134050714_+_3730nt
GTGAATTATAGTTTAATGTACTGCAAGTCCTAAACTACGGATGGGAACTATTACAGTTTATAATGTCAAAAACTTTTCTTAGACCAAAGG
TATCTTCCACAAAGGTAACAGACTGGGTTGACCCATCATTTGATGATTTTCTAGAGTGTAGTGGCGTCTCTACTATTACTGCCACATCAT
TAGGTGTGAATAACTCAAGTCATAGAAGAAAAAATGGGCCTTCTACATTAGAAAGCAGCAGATTTCCAGCGAGAAAAAGAGGAAATCTAT
CTTCCTTAGAACAGATTTATGGTTTAGAAAATTCAAAAGAATATCTGTCTGAAAATGAACCATGGGTGGATAAATATAAACCAGAAACTC
AGCATGAACTTGCTGTGCATAAAAAGAAAATTGAAGAAGTCGAAACCTGGTTAAAAGCTCAAGTTTTAGAAAGGCAACCAAAACAGAAAT
CATTCCAGACTGGGACAAATGCACGTCTAGATGAACGCATTTTTGCTATGTGTCAAGTGAAAAACCAGCCCTTGGTTTACCTTATGCTCA
CAACTCATCCCAGTTTGTATAGAGTTGACAATCTCTCAGATGAGGGAGCACTCAACATCAGTGATAGAACCATACCTCAGCCCCCCATTC
TTCAGCTTTCAGTGGAGAAGCTGAGCAGAGATGGAGCTTTCCTCATGGATGCAGGCTCTGTACTGATGCTTTGGGTTGGAAAAAATTGTA
CACAGAATTTTCTCAGCCAAGTTCTAGGAGTTCAAAACTATGCATCAATTCCACAGCCTATGACAGACCTTCCAGAACTTGATACACCAG
AATCTGCCAGAATAATAGCTTTCATCTCTTGGCTTAGAGAGCAGAGACCATTTTTCCCAATACTTTATGTAATAAGGGATGAGAGTCCAA
TGAAAGCAAACTTCCTTCAAAACATGATAGAAGACAGAACAGAATCTGCATTATCATATTATGAATTCCTGTTGCATATACAGCAACAAG
TGAATAAATGAATGAATGAAGAAATTTGACTTATTTTTAAGGAATGTCACGATAGTGCAGAATACCTGGAAATGTGTAATACCTTCTTTT
TCTATTATGTTTGTGGACTAATGTGATGATTGAGATGTTCTCACTGTGATTTCAACAACCTATAGCAAATAAAAGACCACAGCAGAGAAT
CAAACATGCAACTCTGAAATACTGTATTTTTCAAATCAGAATATAGCTACGTATGATTGGATACTTTTTTCTTGCCAATTATGTTTGAGT
TGTTATGGATTAAAATAAGAATATTGCAGAGGCAAAGTACATTTTGTAAAATAAAGATTTCTGTGTTCTACATGTATATTTCTCATTTTT
AATTTTTCTGAATCTTTGGCTGCTACATTTAAAACCTCACAAACCTAAGTGTTGCAGGGAAGTTACAAATTGATTGGTAGTGATGTTTTT
AAAATAAAAACAATGGAAAGTAAATATAATGTAGGAAAACTAGAATTCATTCCCCACACGTGTCTTTTTTTTTTCTTTGTTAAGGGAAAG
GATCATGTTGACTAAAACTAAACTAATTCTAGTATAGCTTGAGAAAAATATGAAGAAACACATTCAAGCTTTAAAATCTGTCAGTATTCT
TTATGCTTGAAGAACAAAGTCACTTTGATTTGAAGTGAGAACTATCATTAGGTGGTTTTCTGATTTCCTGATGAAGAGTTGGACATACTG
TCTTAATCTATAGTGAAAAGAATTTGAGCTGTCTTCATAAACACTGGGACTAGCAATGATAATAGGGAGATAAGAAACTTTAATTATCTT
GATCCTTTAAGTGGATTTTATTTGGTGCATTTCTGCTCTGGGTATATAATAAAAGTGGGGGTTTTTGGTGAAATGAGTGAAGAAATGAAA
GGTTTCTAAAGTGCTATCCAAATACATCAGTAACATTTTTCTAAGGAGTTTAATTGTTAAATTGGAAGTCATTCATAAGAAATATTTATG
CTTGAATATGAAAATCTATGAAAGCATAAATGCTGCTGTTTGATTTGGTGGATATTAAGATTATACACATCCAACATATTAAAGTTATGA
AAGAAACTTGACTTCTGAAAATCCTTAAGAGACTGCTTTCTTGATTCAGCTAGAGAAATATTATAGTCAAAACTATTGAGTGAATTTTGT
TTACAAATAGGTAAATTATACATTTGTATATTTAAAGTGCTGTGACATAGTATCTTTAAGAGTTTGGCTCAGTTTTCACAGATTCATTTT
GTCTTAAGAATTTCTTAAATATGTTCATGTATAATACTTGATCAAAATATTTTTGGGTTTTTTGTTTTGTTTTAATGGGTTAGAAAATGT
TTACAATCTTGGTCTTATATGATCACCAATGGAATAGTAACTTCCAGGTTTATATCAATATGAGCTGACTTTAACTGAGTTGTTTGGGAT
AGGGAAGAAGCAGTCCCTCTACAGTATACAACTACTGCTTGCCAGCTGGATCAAAATAATCATGTTTTATGAAAATATCTCCCTTAAGCA
GTGTTAAGGTTGGTTTGCAGTGTGTAAGTGGCACATTGAACTGGAAGTTTTCTTGAAAGCTGCTTCATCTATTAAGAAGCAATTTTCAAA
TTGTAGCGAATTATATTATCCCCTCTTTTAAAGAAACAGTCGTTATATGCTGATGTTTCTTAAAATAACTAAAATGTTCCTCTTAATGTG
ATTTTAAATGGAGTTATTTGTAGGTCCTTTCTTAGTAGTAAAGAATCTTCTAGAGGGAAACATTTGTGCTTTTAGGGATAATCTTCCTTG
TGCCTCACTACATCCCTAAGTGGGTATGACTCTTGTTATTACCACATGCTTTTTTAGTATATTTCACAAATTTACTTTTAAATATTATTT
TAGATACGGTGTAACATGTGCAATTCAGAATAATTTTATAACAGGTCATGAAAAACATAACTTTAGTTAGGATTCACAATATTTGTTCTC
CACATAATGAGAGAATGAATGAGCCTTTGGAGATACTGATATAAGGCAATTATTTTTTGCAATGTTGAATGTGTTTTTTAGTTTGATTCT
TTTTTTTTCCCCCAATAGGGCACTACCTGCCATATCATCTTGTATTACTTTTTGATGTAAAGCGACTAATATTTACACTATGCCATATTT
TTTTTAATTATAGTTGTAAATTATGAAAGATCCTTGAATTTTCTACAGATCTACAACTACTAATGTAACAGACAAGGGCAATCTTGGTAT
TTAAATCTGAGCATGGCAGTTCTACCATAAAAAGTACTCTATTTTTCTAATTTCTAGGATTTTTAAAATAACATTTCTGTAAGTCTGACA
TACTAATAGTCACTCAAGCAGTACCATTTATTTTAGTTTGCATATATTTTCACTGTTTTTAATTTAATGTATTGAGTCTAATAGACTGTT
TTGCAATAATTAGAATAAAGATTTATTTCTTCTAATCAAAGATGCATAACAGCTATTATCTAGGGGACCACCAAATGTGATTTCAAAATT
TTGTTAACTATTACAAATGTAATCCTTATATAGAAATTTTAATTTTGTAAAGTAGTGTATAATATTGTAATATTAAATTCTTGTTCTTAA
ATTCAAATATGTATTGATCTTCAATGTGCTGTGTTAAATCTTGCTTCTCTGAAAAGTTGGAGACAAGATTTGTCTTCCTTTTTACAGTTT


Top

FusionGenePPI for RAD17_SEC24A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RAD17ATM, ATR, PRKDC, RAD9B, RAD9A, RFC2, RFC3, RFC4, RFC5, POLE, POLE2, POLE3, POLE4, HUS1, RAD1, NHP2L1, RFC1, USP20, ALK, CLSPN, FOXO3, H2AFX, CDH1, CBX6, CBX7, PRMT6, COPS7A, CHEK2, CHEK1, TOP1, TOP2A, TOP3ASEC24ATRIP13, CUL3, SEC23A, SEC24C, SEC24D, SEC24B, AHCYL1, CLNS1A, PSMD1, SEPHS2, SSSCA1, THADA, KIAA1598, PRDX5, STAT6, IGBP1, UBE2C, STMN2, UBE2B, RAB9A, TUBB6, TLE3, DSTN, PCMT1, S100A6, TTC1, TTC9C, USP34, UNK, STUB1, CSTB, PSMD2, NUBP2, TACC3, CBFA2T3, JMJD6, ARFIP1, C18orf25, CYHR1, DNM1L, KIF1B, MAN2B1, TSNAX, VPS26A, EWSR1, TFG, KCNJ10, GFOD1, SEC23B, NTRK1, TMEM17, XPO1, SEC16A, GTSE1, UBXN2B, PTAR1, PTPRG, KIAA0226L


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneRAD17chr5:68670538chr5:134050714ENST00000282891+316432_68131585MCM7
HgeneRAD17chr5:68670538chr5:134050714ENST00000305138+417432_681117671MCM7
HgeneRAD17chr5:68670538chr5:134050714ENST00000345306+417432_681117671MCM7
HgeneRAD17chr5:68670538chr5:134050714ENST00000354312+518432_681117671MCM7
HgeneRAD17chr5:68670538chr5:134050714ENST00000354868+619432_681117671MCM7
HgeneRAD17chr5:68670538chr5:134050714ENST00000358030+316432_681-48506MCM7
HgeneRAD17chr5:68670538chr5:134050714ENST00000361732+518432_681117671MCM7
HgeneRAD17chr5:68670538chr5:134050714ENST00000380774+316432_681128682MCM7
HgeneRAD17chr5:68670538chr5:134050714ENST00000509734+518432_681128682MCM7
HgeneRAD17chr5:68670538chr5:134050714ENST00000521422+417432_681-48506MCM7


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RAD17_SEC24A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RAD17_SEC24A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource