FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2970

FusionGeneSummary for ASH1L_RGS7

check button Fusion gene summary
Fusion gene informationFusion gene name: ASH1L_RGS7
Fusion gene ID: 2970
HgeneTgene
Gene symbol

ASH1L

RGS7

Gene ID

55870

6000

Gene nameASH1 like histone lysine methyltransferaseregulator of G protein signaling 7
SynonymsASH1|ASH1L1|KMT2H|MRD52-
Cytomap

1q22

1q43|1q23.1

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase ASH1LASH1-like proteinabsent small and homeotic disks protein 1 homologash1 (absent, small, or homeotic)-likelysine N-methyltransferase 2Hprobable histone-lysine N-methyltransferase ASH1Lregulator of G-protein signaling 7regulator of G-protein signaling RGS7regulator of G-protein signalling 7
Modification date2018051920180522
UniProtAcc

Q9NR48

P49802

Ensembl transtripts involved in fusion geneENST00000368346, ENST00000392403, 
ENST00000548830, 
ENST00000331110, 
ENST00000348120, ENST00000366563, 
ENST00000366564, ENST00000366565, 
ENST00000446183, ENST00000366562, 
ENST00000401882, ENST00000407727, 
Fusion gene scores* DoF score27 X 14 X 13=49147 X 4 X 6=168
# samples 306
** MAII scorelog2(30/4914*10)=-4.03386345186628
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/168*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ASH1L [Title/Abstract] AND RGS7 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTranscription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneASH1L

GO:0097676

histone H3-K36 dimethylation

26002201

TgeneRGS7

GO:0043547

positive regulation of GTPase activity

10521509


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCESCTCGA-EA-A5O9-01AASH1Lchr1

155447677

-RGS7chr1

240979715

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000368346ENST00000331110ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000368346ENST00000348120ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000368346ENST00000366563ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000368346ENST00000366564ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000368346ENST00000366565ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000368346ENST00000446183ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000368346ENST00000366562ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000368346ENST00000401882ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000368346ENST00000407727ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000392403ENST00000331110ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000392403ENST00000348120ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000392403ENST00000366563ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000392403ENST00000366564ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000392403ENST00000366565ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000392403ENST00000446183ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000392403ENST00000366562ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000392403ENST00000401882ASH1Lchr1

155447677

-RGS7chr1

240979715

-
In-frameENST00000392403ENST00000407727ASH1Lchr1

155447677

-RGS7chr1

240979715

-
intron-3CDSENST00000548830ENST00000331110ASH1Lchr1

155447677

-RGS7chr1

240979715

-
intron-3CDSENST00000548830ENST00000348120ASH1Lchr1

155447677

-RGS7chr1

240979715

-
intron-3CDSENST00000548830ENST00000366563ASH1Lchr1

155447677

-RGS7chr1

240979715

-
intron-3CDSENST00000548830ENST00000366564ASH1Lchr1

155447677

-RGS7chr1

240979715

-
intron-3CDSENST00000548830ENST00000366565ASH1Lchr1

155447677

-RGS7chr1

240979715

-
intron-3CDSENST00000548830ENST00000446183ASH1Lchr1

155447677

-RGS7chr1

240979715

-
intron-3CDSENST00000548830ENST00000366562ASH1Lchr1

155447677

-RGS7chr1

240979715

-
intron-3CDSENST00000548830ENST00000401882ASH1Lchr1

155447677

-RGS7chr1

240979715

-
intron-3CDSENST00000548830ENST00000407727ASH1Lchr1

155447677

-RGS7chr1

240979715

-

Top

FusionProtFeatures for ASH1L_RGS7


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ASH1L

Q9NR48

RGS7

P49802

Histone methyltransferase specifically methylating 'Lys-36' of histone H3 (H3K36me). {ECO:0000269|PubMed:21239497}. Regulates G protein-coupled receptor signaling cascades.Inhibits signal transduction by increasing the GTPase activity ofG protein alpha subunits, thereby driving them into their inactiveGDP-bound form (PubMed:10521509, PubMed:10862767). The RGS7/GNB5dimer enhances GNAO1 GTPase activity (PubMed:10521509). May play arole in synaptic vesicle exocytosis (PubMed:12659861). Modulatesthe activity of potassium channels that are activated by GNAO1 inresponse to muscarinic acetylcholine receptor M2/CHRM2 signaling(PubMed:15897264). {ECO:0000269|PubMed:10521509,ECO:0000269|PubMed:10862767, ECO:0000269|PubMed:15897264,ECO:0000305|PubMed:12659861}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneASH1Lchr1:155447677chr1:240979715ENST00000368346-3281380_142416612970Compositional biasNote=Pro-rich
HgeneASH1Lchr1:155447677chr1:240979715ENST00000392403-3281380_142416612965Compositional biasNote=Pro-rich
HgeneASH1Lchr1:155447677chr1:240979715ENST00000368346-3281347_135916612970DNA bindingNote=A.T hook 2
HgeneASH1Lchr1:155447677chr1:240979715ENST00000368346-328887_89916612970DNA bindingNote=A.T hook 1
HgeneASH1Lchr1:155447677chr1:240979715ENST00000392403-3281347_135916612965DNA bindingNote=A.T hook 2
HgeneASH1Lchr1:155447677chr1:240979715ENST00000392403-328887_89916612965DNA bindingNote=A.T hook 1
TgeneRGS7chr1:155447677chr1:240979715ENST00000348120-615255_316175626DomainNote=G protein gamma
TgeneRGS7chr1:155447677chr1:240979715ENST00000348120-615333_448175626DomainRGS
TgeneRGS7chr1:155447677chr1:240979715ENST00000366562-816255_316228470DomainNote=G protein gamma
TgeneRGS7chr1:155447677chr1:240979715ENST00000366562-816333_448228470DomainRGS
TgeneRGS7chr1:155447677chr1:240979715ENST00000366563-918255_316228689DomainNote=G protein gamma
TgeneRGS7chr1:155447677chr1:240979715ENST00000366563-918333_448228689DomainRGS
TgeneRGS7chr1:155447677chr1:240979715ENST00000366564-917255_316228470DomainNote=G protein gamma
TgeneRGS7chr1:155447677chr1:240979715ENST00000366564-917333_448228470DomainRGS
TgeneRGS7chr1:155447677chr1:240979715ENST00000366565-918255_316228488DomainNote=G protein gamma
TgeneRGS7chr1:155447677chr1:240979715ENST00000366565-918333_448228488DomainRGS
TgeneRGS7chr1:155447677chr1:240979715ENST00000401882-614255_316175425DomainNote=G protein gamma
TgeneRGS7chr1:155447677chr1:240979715ENST00000401882-614333_448175425DomainRGS
TgeneRGS7chr1:155447677chr1:240979715ENST00000407727-817255_316228496DomainNote=G protein gamma
TgeneRGS7chr1:155447677chr1:240979715ENST00000407727-817333_448228496DomainRGS

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneASH1Lchr1:155447677chr1:240979715ENST00000368346-3281580_179116612970Compositional biasNote=Ser-rich
HgeneASH1Lchr1:155447677chr1:240979715ENST00000392403-3281580_179116612965Compositional biasNote=Ser-rich
HgeneASH1Lchr1:155447677chr1:240979715ENST00000368346-3281847_185916612970DNA bindingNote=A.T hook 3
HgeneASH1Lchr1:155447677chr1:240979715ENST00000392403-3281847_185916612965DNA bindingNote=A.T hook 3
HgeneASH1Lchr1:155447677chr1:240979715ENST00000368346-3282091_214216612970DomainAWS
HgeneASH1Lchr1:155447677chr1:240979715ENST00000368346-3282145_226116612970DomainSET
HgeneASH1Lchr1:155447677chr1:240979715ENST00000368346-3282269_228516612970DomainPost-SET
HgeneASH1Lchr1:155447677chr1:240979715ENST00000368346-3282463_253316612970DomainBromo
HgeneASH1Lchr1:155447677chr1:240979715ENST00000368346-3282661_279816612970DomainBAH
HgeneASH1Lchr1:155447677chr1:240979715ENST00000392403-3282091_214216612965DomainAWS
HgeneASH1Lchr1:155447677chr1:240979715ENST00000392403-3282145_226116612965DomainSET
HgeneASH1Lchr1:155447677chr1:240979715ENST00000392403-3282269_228516612965DomainPost-SET
HgeneASH1Lchr1:155447677chr1:240979715ENST00000392403-3282463_253316612965DomainBromo
HgeneASH1Lchr1:155447677chr1:240979715ENST00000392403-3282661_279816612965DomainBAH
HgeneASH1Lchr1:155447677chr1:240979715ENST00000368346-3282069_228816612970RegionNote=Catalytic domain
HgeneASH1Lchr1:155447677chr1:240979715ENST00000392403-3282069_228816612965RegionNote=Catalytic domain
HgeneASH1Lchr1:155447677chr1:240979715ENST00000368346-3282585_263116612970Zinc fingerNote=PHD-type
HgeneASH1Lchr1:155447677chr1:240979715ENST00000392403-3282585_263116612965Zinc fingerNote=PHD-type
TgeneRGS7chr1:155447677chr1:240979715ENST00000348120-61537_112175626DomainDEP
TgeneRGS7chr1:155447677chr1:240979715ENST00000366562-81637_112228470DomainDEP
TgeneRGS7chr1:155447677chr1:240979715ENST00000366563-91837_112228689DomainDEP
TgeneRGS7chr1:155447677chr1:240979715ENST00000366564-91737_112228470DomainDEP
TgeneRGS7chr1:155447677chr1:240979715ENST00000366565-91837_112228488DomainDEP
TgeneRGS7chr1:155447677chr1:240979715ENST00000401882-61437_112175425DomainDEP
TgeneRGS7chr1:155447677chr1:240979715ENST00000407727-81737_112228496DomainDEP


Top

FusionGeneSequence for ASH1L_RGS7


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000331110_chr1_240979715_-_1911aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGQKH

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000348120_chr1_240979715_-_1911aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGQKH

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000366563_chr1_240979715_-_1911aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGQKH

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000366564_chr1_240979715_-_1903aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGEIS

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000366565_chr1_240979715_-_1921aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKVWKL

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000446183_chr1_240979715_-_1911aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGQKH

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000366562_chr1_240979715_-_1903aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGEIS

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000401882_chr1_240979715_-_1911aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGQKH

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000407727_chr1_240979715_-_1929aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKVWKL

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000331110_chr1_240979715_-_1911aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGQKH

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000348120_chr1_240979715_-_1911aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGQKH

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000366563_chr1_240979715_-_1911aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGQKH

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000366564_chr1_240979715_-_1903aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGEIS

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000366565_chr1_240979715_-_1921aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKVWKL

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000446183_chr1_240979715_-_1911aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGQKH

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000366562_chr1_240979715_-_1903aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGEIS

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000401882_chr1_240979715_-_1911aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKGQKH

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000407727_chr1_240979715_-_1929aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVCLWFTK_T_KSQSYPHTHTRN_TSNRR_VTTTDKILANTVR_TSVKNV
KSR_QSTKLHGTVFRIRPVSFAT_PF_PMAVR_HHFLGT_GKQRTEPAEGKTMGFWHGRGIERPSWERTVP_ISRVRIQLGKFKILAGSG
GPEKEAT_RSTLKSSGNMARVSGSRSPQCT_LGFQEL_QNHTEREGTWTIHI_RCSGAHLQTDEK_FIPTFTKIQCLSGASTGKEKVWKL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000331110_chr1_240979715_-_5734nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGCAGAAACAT

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000348120_chr1_240979715_-_5734nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGCAGAAACAT

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000366563_chr1_240979715_-_5734nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGCAGAAACAT

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000366564_chr1_240979715_-_5710nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGGAAATCTCT

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000366565_chr1_240979715_-_5764nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGTCTGGAAACTC
AATGGATCGCAGAACATCTTTTGAAAAATTTGCACAGAATGTGGGGAAATCTCTCACGTCCAAGAGGTTAACAAGCCTTGCTCAGTCTTA

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000446183_chr1_240979715_-_5734nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGCAGAAACAT

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000366562_chr1_240979715_-_5710nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGGAAATCTCT

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000401882_chr1_240979715_-_5734nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGCAGAAACAT

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000407727_chr1_240979715_-_5788nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGTCTGGAAACTC
AATGGATCGCAGAACATCTTTTGAAAAATTTGCACAGAATGTGGGCAGAAACATCCCTATTTTCCCATGCCATAAAAACTGTACACCAAC

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000331110_chr1_240979715_-_5734nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGCAGAAACAT

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000348120_chr1_240979715_-_5734nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGCAGAAACAT

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000366563_chr1_240979715_-_5734nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGCAGAAACAT

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000366564_chr1_240979715_-_5710nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGGAAATCTCT

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000366565_chr1_240979715_-_5764nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGTCTGGAAACTC
AATGGATCGCAGAACATCTTTTGAAAAATTTGCACAGAATGTGGGGAAATCTCTCACGTCCAAGAGGTTAACAAGCCTTGCTCAGTCTTA

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000446183_chr1_240979715_-_5734nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGCAGAAACAT

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000366562_chr1_240979715_-_5710nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGGAAATCTCT

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000401882_chr1_240979715_-_5734nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGGGCAGAAACAT

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000407727_chr1_240979715_-_5788nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCCACACACCCAC
ACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTC
AAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTAACCCATGGCT
GTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCATGGACGAGGC
ATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGCTGGCAGTGGA
GGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCCCCAGTGCTAT
TAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGGAGCACATTTA
CAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGTCTGGAAACTC
AATGGATCGCAGAACATCTTTTGAAAAATTTGCACAGAATGTGGGCAGAAACATCCCTATTTTCCCATGCCATAAAAACTGTACACCAAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000331110_chr1_240979715_-_6405nt
CGCGTACGGGCTGGCTGGCGCGCGGGGCGGCCGAAGGTGGTGGTTGGTGGGAGCAGCCAGCGACGAGCCCGTAGACACTCGTACGCGTGC
GGGCGGGCGTGCGCGCTACGCGGACGGAGTCGGGCGGAGCGGGGGACGGTGGGAAAGAACGCAAGGAGGAAGGAGTGGAAGGTTGAGGGG
GGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCCGCCGCCGCCGCCGCCGCTC
CCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCTCAGTTTGCCCCCTTTAGCC
TTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCCGTGGAC
CCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCTCGGCCTCGGCCTCCGACAC
GAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATAAGATTCCTTGGCAATAACA
TACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAG
TACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAA
CATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATT
GAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAA
GCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAA
GAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAA
GCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAG
AGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACC
GAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACA
TAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGT
AGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAAC
TATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAA
GAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTG
TGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGAT
CAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCA
GGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCAT
ATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTC
ATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGC
TTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTT
AACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGA
ATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAA
AGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGAC
TTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGT
ATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACC
TCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATG
TAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACG
CCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCA
CAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCC
TCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAAT
TTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAAT
GAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGA
CAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTG
TAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAA
TAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAA
ACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATAT
AGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGC
TCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTAT
TTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCA
TTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTT
GCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCAT
TCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTT
TGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCA
TGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTT
TATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCC
AACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAA
AAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGG
ATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCAC
TCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGC
CAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCC
CAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACA
ACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCG
ATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGT
CCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATC
CCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTC
AAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAA
GGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCC
ACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGT
TAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTA
ACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCA
TGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGC
TGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCC
CCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGG
AGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGG
GCAGAAACATCCCTATTTTCCCATGCCATAAAAACTGTACACCAACACTGAGGGCCAGCACTAACCTGTTATGAAAAGAGGTCATCGTTG

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000348120_chr1_240979715_-_7079nt
CGCGTACGGGCTGGCTGGCGCGCGGGGCGGCCGAAGGTGGTGGTTGGTGGGAGCAGCCAGCGACGAGCCCGTAGACACTCGTACGCGTGC
GGGCGGGCGTGCGCGCTACGCGGACGGAGTCGGGCGGAGCGGGGGACGGTGGGAAAGAACGCAAGGAGGAAGGAGTGGAAGGTTGAGGGG
GGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCCGCCGCCGCCGCCGCCGCTC
CCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCTCAGTTTGCCCCCTTTAGCC
TTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCCGTGGAC
CCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCTCGGCCTCGGCCTCCGACAC
GAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATAAGATTCCTTGGCAATAACA
TACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAG
TACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAA
CATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATT
GAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAA
GCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAA
GAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAA
GCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAG
AGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACC
GAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACA
TAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGT
AGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAAC
TATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAA
GAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTG
TGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGAT
CAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCA
GGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCAT
ATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTC
ATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGC
TTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTT
AACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGA
ATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAA
AGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGAC
TTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGT
ATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACC
TCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATG
TAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACG
CCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCA
CAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCC
TCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAAT
TTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAAT
GAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGA
CAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTG
TAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAA
TAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAA
ACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATAT
AGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGC
TCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTAT
TTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCA
TTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTT
GCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCAT
TCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTT
TGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCA
TGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTT
TATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCC
AACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAA
AAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGG
ATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCAC
TCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGC
CAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCC
CAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACA
ACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCG
ATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGT
CCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATC
CCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTC
AAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAA
GGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCC
ACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGT
TAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTA
ACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCA
TGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGC
TGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCC
CCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGG
AGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGG
GCAGAAACATCCCTATTTTCCCATGCCATAAAAACTGTACACCAACACTGAGGGCCAGCACTAACCTGTTATGAAAAGAGGGGAAATCTC
TCACGTCCAAGAGGTTAACAAGCCTTGCTCAGTCTTACTAAACGGATCATCTTGTAGCATGAATGCAGACTGGAGTCACTGCACACACTT
TGTAGCTCAATGTTGTGACCTGGAGCAGAGGACATTAGAACAAGATGTTGCATGAGCAAAGGACCTAAATTGTTATTTTTGTGTGTACAT
TCCATCTCCAATGGACTCTTCCGTCTCAATGCCTCCATTCCAAACTGTTGTCTGCTTTCTTTCTCCTTCTACTATGCTGGATCTGTGTCT
CTTCCTTTTTAACAAGTTCAAGTGAAGTAAAACCTTTTCTTTTTTTCCTTCTTTCTCTCTCTCTCTCTCTCAAAGCTTCAGTTAGACACA
CAGTTCACTGAAAATTCAGTCAGTCAAAAACTGGAAGAACTGTAAAAGAAAAAAGTATATATCAATAAGTATACATGTGGCTTCACATTT
ATTAAACAATAAATTCCGCACAGAAAGTTTCATTTCACCAATGTGTCACAGTCAGAAACAAACTCATGTCTTCGTCTGTTGTCTGTACAT
TCTCCGTTAATGTTTCTCGCATTTATTTTTATACCATATTTAAAGAAGAAACACCTTTTACTCCAAATGTATTAAAGTTGATCCCTTCTC

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000366563_chr1_240979715_-_7079nt
CGCGTACGGGCTGGCTGGCGCGCGGGGCGGCCGAAGGTGGTGGTTGGTGGGAGCAGCCAGCGACGAGCCCGTAGACACTCGTACGCGTGC
GGGCGGGCGTGCGCGCTACGCGGACGGAGTCGGGCGGAGCGGGGGACGGTGGGAAAGAACGCAAGGAGGAAGGAGTGGAAGGTTGAGGGG
GGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCCGCCGCCGCCGCCGCCGCTC
CCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCTCAGTTTGCCCCCTTTAGCC
TTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCCGTGGAC
CCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCTCGGCCTCGGCCTCCGACAC
GAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATAAGATTCCTTGGCAATAACA
TACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAG
TACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAA
CATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATT
GAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAA
GCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAA
GAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAA
GCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAG
AGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACC
GAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACA
TAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGT
AGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAAC
TATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAA
GAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTG
TGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGAT
CAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCA
GGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCAT
ATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTC
ATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGC
TTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTT
AACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGA
ATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAA
AGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGAC
TTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGT
ATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACC
TCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATG
TAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACG
CCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCA
CAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCC
TCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAAT
TTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAAT
GAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGA
CAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTG
TAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAA
TAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAA
ACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATAT
AGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGC
TCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTAT
TTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCA
TTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTT
GCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCAT
TCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTT
TGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCA
TGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTT
TATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCC
AACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAA
AAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGG
ATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCAC
TCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGC
CAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCC
CAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACA
ACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCG
ATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGT
CCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATC
CCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTC
AAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAA
GGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCC
ACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGT
TAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTA
ACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCA
TGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGC
TGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCC
CCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGG
AGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGG
GCAGAAACATCCCTATTTTCCCATGCCATAAAAACTGTACACCAACACTGAGGGCCAGCACTAACCTGTTATGAAAAGAGGGGAAATCTC
TCACGTCCAAGAGGTTAACAAGCCTTGCTCAGTCTTACTAAACGGATCATCTTGTAGCATGAATGCAGACTGGAGTCACTGCACACACTT
TGTAGCTCAATGTTGTGACCTGGAGCAGAGGACATTAGAACAAGATGTTGCATGAGCAAAGGACCTAAATTGTTATTTTTGTGTGTACAT
TCCATCTCCAATGGACTCTTCCGTCTCAATGCCTCCATTCCAAACTGTTGTCTGCTTTCTTTCTCCTTCTACTATGCTGGATCTGTGTCT
CTTCCTTTTTAACAAGTTCAAGTGAAGTAAAACCTTTTCTTTTTTTCCTTCTTTCTCTCTCTCTCTCTCTCAAAGCTTCAGTTAGACACA
CAGTTCACTGAAAATTCAGTCAGTCAAAAACTGGAAGAACTGTAAAAGAAAAAAGTATATATCAATAAGTATACATGTGGCTTCACATTT
ATTAAACAATAAATTCCGCACAGAAAGTTTCATTTCACCAATGTGTCACAGTCAGAAACAAACTCATGTCTTCGTCTGTTGTCTGTACAT
TCTCCGTTAATGTTTCTCGCATTTATTTTTATACCATATTTAAAGAAGAAACACCTTTTACTCCAAATGTATTAAAGTTGATCCCTTCTC

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000366564_chr1_240979715_-_6998nt
CGCGTACGGGCTGGCTGGCGCGCGGGGCGGCCGAAGGTGGTGGTTGGTGGGAGCAGCCAGCGACGAGCCCGTAGACACTCGTACGCGTGC
GGGCGGGCGTGCGCGCTACGCGGACGGAGTCGGGCGGAGCGGGGGACGGTGGGAAAGAACGCAAGGAGGAAGGAGTGGAAGGTTGAGGGG
GGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCCGCCGCCGCCGCCGCCGCTC
CCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCTCAGTTTGCCCCCTTTAGCC
TTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCCGTGGAC
CCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCTCGGCCTCGGCCTCCGACAC
GAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATAAGATTCCTTGGCAATAACA
TACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAG
TACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAA
CATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATT
GAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAA
GCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAA
GAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAA
GCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAG
AGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACC
GAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACA
TAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGT
AGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAAC
TATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAA
GAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTG
TGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGAT
CAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCA
GGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCAT
ATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTC
ATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGC
TTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTT
AACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGA
ATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAA
AGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGAC
TTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGT
ATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACC
TCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATG
TAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACG
CCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCA
CAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCC
TCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAAT
TTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAAT
GAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGA
CAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTG
TAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAA
TAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAA
ACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATAT
AGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGC
TCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTAT
TTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCA
TTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTT
GCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCAT
TCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTT
TGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCA
TGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTT
TATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCC
AACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAA
AAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGG
ATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCAC
TCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGC
CAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCC
CAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACA
ACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCG
ATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGT
CCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATC
CCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTC
AAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAA
GGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCC
ACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGT
TAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTA
ACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCA
TGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGC
TGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCC
CCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGG
AGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGG
GGAAATCTCTCACGTCCAAGAGGTTAACAAGCCTTGCTCAGTCTTACTAAACGGATCATCTTGTAGCATGAATGCAGACTGGAGTCACTG
CACACACTTTGTAGCTCAATGTTGTGACCTGGAGCAGAGGACATTAGAACAAGATGTTGCATGAGCAAAGGACCTAAATTGTTATTTTTG
TGTGTACATTCCATCTCCAATGGACTCTTCCGTCTCAATGCCTCCATTCCAAACTGTTGTCTGCTTTCTTTCTCCTTCTACTATGCTGGA
TCTGTGTCTCTTCCTTTTTAACAAGTTCAAGTGAAGTAAAACCTTTTCTTTTTTTCCTTCTTTCTCTCTCTCTCTCTCTCAAAGCTTCAG
TTAGACACACAGTTCACTGAAAATTCAGTCAGTCAAAAACTGGAAGAACTGTAAAAGAAAAAAGTATATATCAATAAGTATACATGTGGC
TTCACATTTATTAAACAATAAATTCCGCACAGAAAGTTTCATTTCACCAATGTGTCACAGTCAGAAACAAACTCATGTCTTCGTCTGTTG
TCTGTACATTCTCCGTTAATGTTTCTCGCATTTATTTTTATACCATATTTAAAGAAGAAACACCTTTTACTCCAAATGTATTAAAGTTGA

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000366565_chr1_240979715_-_7052nt
CGCGTACGGGCTGGCTGGCGCGCGGGGCGGCCGAAGGTGGTGGTTGGTGGGAGCAGCCAGCGACGAGCCCGTAGACACTCGTACGCGTGC
GGGCGGGCGTGCGCGCTACGCGGACGGAGTCGGGCGGAGCGGGGGACGGTGGGAAAGAACGCAAGGAGGAAGGAGTGGAAGGTTGAGGGG
GGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCCGCCGCCGCCGCCGCCGCTC
CCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCTCAGTTTGCCCCCTTTAGCC
TTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCCGTGGAC
CCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCTCGGCCTCGGCCTCCGACAC
GAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATAAGATTCCTTGGCAATAACA
TACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAG
TACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAA
CATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATT
GAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAA
GCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAA
GAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAA
GCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAG
AGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACC
GAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACA
TAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGT
AGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAAC
TATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAA
GAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTG
TGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGAT
CAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCA
GGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCAT
ATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTC
ATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGC
TTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTT
AACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGA
ATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAA
AGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGAC
TTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGT
ATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACC
TCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATG
TAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACG
CCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCA
CAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCC
TCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAAT
TTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAAT
GAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGA
CAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTG
TAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAA
TAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAA
ACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATAT
AGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGC
TCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTAT
TTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCA
TTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTT
GCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCAT
TCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTT
TGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCA
TGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTT
TATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCC
AACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAA
AAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGG
ATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCAC
TCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGC
CAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCC
CAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACA
ACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCG
ATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGT
CCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATC
CCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTC
AAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAA
GGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCC
ACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGT
TAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTA
ACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCA
TGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGC
TGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCC
CCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGG
AGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGT
CTGGAAACTCAATGGATCGCAGAACATCTTTTGAAAAATTTGCACAGAATGTGGGGAAATCTCTCACGTCCAAGAGGTTAACAAGCCTTG
CTCAGTCTTACTAAACGGATCATCTTGTAGCATGAATGCAGACTGGAGTCACTGCACACACTTTGTAGCTCAATGTTGTGACCTGGAGCA
GAGGACATTAGAACAAGATGTTGCATGAGCAAAGGACCTAAATTGTTATTTTTGTGTGTACATTCCATCTCCAATGGACTCTTCCGTCTC
AATGCCTCCATTCCAAACTGTTGTCTGCTTTCTTTCTCCTTCTACTATGCTGGATCTGTGTCTCTTCCTTTTTAACAAGTTCAAGTGAAG
TAAAACCTTTTCTTTTTTTCCTTCTTTCTCTCTCTCTCTCTCTCAAAGCTTCAGTTAGACACACAGTTCACTGAAAATTCAGTCAGTCAA
AAACTGGAAGAACTGTAAAAGAAAAAAGTATATATCAATAAGTATACATGTGGCTTCACATTTATTAAACAATAAATTCCGCACAGAAAG
TTTCATTTCACCAATGTGTCACAGTCAGAAACAAACTCATGTCTTCGTCTGTTGTCTGTACATTCTCCGTTAATGTTTCTCGCATTTATT
TTTATACCATATTTAAAGAAGAAACACCTTTTACTCCAAATGTATTAAAGTTGATCCCTTCTCTGTAAATTTGTGTATGTTTATATTGTT

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000446183_chr1_240979715_-_6934nt
CGCGTACGGGCTGGCTGGCGCGCGGGGCGGCCGAAGGTGGTGGTTGGTGGGAGCAGCCAGCGACGAGCCCGTAGACACTCGTACGCGTGC
GGGCGGGCGTGCGCGCTACGCGGACGGAGTCGGGCGGAGCGGGGGACGGTGGGAAAGAACGCAAGGAGGAAGGAGTGGAAGGTTGAGGGG
GGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCCGCCGCCGCCGCCGCCGCTC
CCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCTCAGTTTGCCCCCTTTAGCC
TTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCCGTGGAC
CCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCTCGGCCTCGGCCTCCGACAC
GAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATAAGATTCCTTGGCAATAACA
TACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAG
TACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAA
CATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATT
GAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAA
GCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAA
GAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAA
GCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAG
AGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACC
GAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACA
TAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGT
AGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAAC
TATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAA
GAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTG
TGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGAT
CAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCA
GGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCAT
ATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTC
ATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGC
TTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTT
AACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGA
ATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAA
AGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGAC
TTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGT
ATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACC
TCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATG
TAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACG
CCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCA
CAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCC
TCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAAT
TTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAAT
GAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGA
CAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTG
TAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAA
TAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAA
ACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATAT
AGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGC
TCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTAT
TTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCA
TTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTT
GCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCAT
TCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTT
TGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCA
TGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTT
TATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCC
AACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAA
AAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGG
ATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCAC
TCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGC
CAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCC
CAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACA
ACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCG
ATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGT
CCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATC
CCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTC
AAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAA
GGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCC
ACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGT
TAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTA
ACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCA
TGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGC
TGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCC
CCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGG
AGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGG
GCAGAAACATCCCTATTTTCCCATGCCATAAAAACTGTACACCAACACTGAGGGCCAGCACTAACCTGTTATGAAAAGAGGGGAAATCTC
TCACGTCCAAGAGGTTAACAAGCCTTGCTCAGTCTTACTAAACGGATCATCTTGTAGCATGAATGCAGACTGGAGTCACTGCACACACTT
TGTAGCTCAATGTTGTGACCTGGAGCAGAGGACATTAGAACAAGATGTTGCATGAGCAAAGGACCTAAATTGTTATTTTTGTGTGTACAT
TCCATCTCCAATGGACTCTTCCGTCTCAATGCCTCCATTCCAAACTGTTGTCTGCTTTCTTTCTCCTTCTACTATGCTGGATCTGTGTCT
CTTCCTTTTTAACAAGTTCAAGTGAAGTAAAACCTTTTCTTTTTTTCCTTCTTTCTCTCTCTCTCTCTCTCAAAGCTTCAGTTAGACACA
CAGTTCACTGAAAATTCAGTCAGTCAAAAACTGGAAGAACTGTAAAAGAAAAAAGTATATATCAATAAGTATACATGTGGCTTCACATTT
ATTAAACAATAAATTCCGCACAGAAAGTTTCATTTCACCAATGTGTCACAGTCAGAAACAAACTCATGTCTTCGTCTGTTGTCTGTACAT

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000366562_chr1_240979715_-_6350nt
CGCGTACGGGCTGGCTGGCGCGCGGGGCGGCCGAAGGTGGTGGTTGGTGGGAGCAGCCAGCGACGAGCCCGTAGACACTCGTACGCGTGC
GGGCGGGCGTGCGCGCTACGCGGACGGAGTCGGGCGGAGCGGGGGACGGTGGGAAAGAACGCAAGGAGGAAGGAGTGGAAGGTTGAGGGG
GGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCCGCCGCCGCCGCCGCCGCTC
CCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCTCAGTTTGCCCCCTTTAGCC
TTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCCGTGGAC
CCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCTCGGCCTCGGCCTCCGACAC
GAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATAAGATTCCTTGGCAATAACA
TACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAG
TACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAA
CATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATT
GAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAA
GCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAA
GAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAA
GCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAG
AGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACC
GAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACA
TAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGT
AGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAAC
TATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAA
GAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTG
TGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGAT
CAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCA
GGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCAT
ATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTC
ATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGC
TTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTT
AACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGA
ATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAA
AGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGAC
TTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGT
ATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACC
TCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATG
TAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACG
CCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCA
CAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCC
TCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAAT
TTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAAT
GAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGA
CAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTG
TAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAA
TAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAA
ACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATAT
AGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGC
TCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTAT
TTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCA
TTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTT
GCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCAT
TCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTT
TGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCA
TGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTT
TATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCC
AACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAA
AAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGG
ATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCAC
TCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGC
CAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCC
CAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACA
ACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCG
ATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGT
CCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATC
CCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTC
AAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAA
GGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCC
ACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGT
TAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTA
ACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCA
TGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGC
TGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCC
CCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGG
AGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGG

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000401882_chr1_240979715_-_6374nt
CGCGTACGGGCTGGCTGGCGCGCGGGGCGGCCGAAGGTGGTGGTTGGTGGGAGCAGCCAGCGACGAGCCCGTAGACACTCGTACGCGTGC
GGGCGGGCGTGCGCGCTACGCGGACGGAGTCGGGCGGAGCGGGGGACGGTGGGAAAGAACGCAAGGAGGAAGGAGTGGAAGGTTGAGGGG
GGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCCGCCGCCGCCGCCGCCGCTC
CCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCTCAGTTTGCCCCCTTTAGCC
TTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCCGTGGAC
CCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCTCGGCCTCGGCCTCCGACAC
GAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATAAGATTCCTTGGCAATAACA
TACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAG
TACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAA
CATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATT
GAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAA
GCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAA
GAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAA
GCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAG
AGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACC
GAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACA
TAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGT
AGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAAC
TATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAA
GAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTG
TGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGAT
CAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCA
GGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCAT
ATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTC
ATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGC
TTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTT
AACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGA
ATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAA
AGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGAC
TTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGT
ATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACC
TCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATG
TAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACG
CCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCA
CAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCC
TCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAAT
TTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAAT
GAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGA
CAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTG
TAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAA
TAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAA
ACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATAT
AGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGC
TCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTAT
TTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCA
TTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTT
GCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCAT
TCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTT
TGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCA
TGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTT
TATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCC
AACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAA
AAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGG
ATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCAC
TCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGC
CAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCC
CAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACA
ACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCG
ATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGT
CCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATC
CCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTC
AAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAA
GGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCC
ACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGT
TAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTA
ACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCA
TGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGC
TGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCC
CCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGG
AGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGG

>In-frame_ASH1L_ENST00000368346_chr1_155447677_-_RGS7_ENST00000407727_chr1_240979715_-_6428nt
CGCGTACGGGCTGGCTGGCGCGCGGGGCGGCCGAAGGTGGTGGTTGGTGGGAGCAGCCAGCGACGAGCCCGTAGACACTCGTACGCGTGC
GGGCGGGCGTGCGCGCTACGCGGACGGAGTCGGGCGGAGCGGGGGACGGTGGGAAAGAACGCAAGGAGGAAGGAGTGGAAGGTTGAGGGG
GGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCCGCCGCCGCCGCCGCCGCTC
CCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCTCAGTTTGCCCCCTTTAGCC
TTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCCGTGGAC
CCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCTCGGCCTCGGCCTCCGACAC
GAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATAAGATTCCTTGGCAATAACA
TACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAG
TACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAA
CATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATT
GAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAA
GCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAA
GAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAA
GCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAG
AGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACC
GAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACA
TAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGT
AGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAAC
TATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAA
GAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTG
TGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGAT
CAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCA
GGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCAT
ATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTC
ATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGC
TTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTT
AACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGA
ATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAA
AGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGAC
TTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGT
ATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACC
TCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATG
TAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACG
CCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCA
CAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCC
TCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAAT
TTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAAT
GAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGA
CAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTG
TAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAA
TAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAA
ACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATAT
AGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGC
TCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTAT
TTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCA
TTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTT
GCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCAT
TCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTT
TGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCA
TGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTT
TATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCC
AACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAA
AAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGG
ATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCAC
TCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGC
CAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCC
CAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACA
ACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCG
ATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGT
CCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATC
CCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTC
AAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAA
GGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATTAGAAGTCACAGTCCTACCC
ACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATACAGTTAGATAGACATCGGT
TAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTTTTGCCACCTGACCCTTCTA
ACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTAAAACGATGGGGTTTTGGCA
TGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCGGAAAATTTAAGATTCTGGC
TGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAGTTTCTGGCTCCCGGAGCCC
CCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATACACATTTGAAGATGCTCAGG
AGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTTCTACAGGCAAAGAAAAAGT
CTGGAAACTCAATGGATCGCAGAACATCTTTTGAAAAATTTGCACAGAATGTGGGCAGAAACATCCCTATTTTCCCATGCCATAAAAACT

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000331110_chr1_240979715_-_6244nt
GGAGTGGAAGGTTGAGGGGGGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCC
GCCGCCGCCGCCGCCGCTCCCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCT
CAGTTTGCCCCCTTTAGCCTTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCG
GGAGGGATCCGCCGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCT
CGGCCTCGGCCTCCGACACGAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATA
AGATTCCTTGGCAATAACATACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAA
AGAGTCCTTCTGCCATCAGTACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCA
AACGGAATCGAGAAAGAAACATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTT
CAGAGGGAAATTTAAAATTGAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTG
CCATAAAAACAACTATTAAGCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAG
ACCCTTCAAAGTTGTACAAGAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAA
ACAATCCTTTGTCTAAGAAGCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGG
ATCCTGATTTAAAGGACAGAGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCA
AGTCTTCCAAGACAAAACCGAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCT
CTGTAGCTGGAATAATACATAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGC
CAGTGTTTAATGCAGCAGTAGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACT
TAGGCAAAAAGCCAGGAACTATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAG
TGCATAAAGAGTCTGGCAAGAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTG
GCCTAGTGGCCAAGGACTGTGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTT
GTCCTTTGGCAGGTCTGATCAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTA
GTACAAACATCAATAATCAGGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTAC
GGCAGAATAAAGAAAGCATATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCA
TTCAGCAAGACAGTTTCTCATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGG
ACTTTAAAATGGGAGGTGCTTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTA
CTGTATCTGTTAATCCTTTAACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAAC
TAATCGAAGAAATTTCTGAATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATA
GTATAAGTATTGAATGTAAAGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTG
GAAAAAAGCCAAGTTTGACTTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTT
TTTTAAAACTGGGTGCAGTATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAA
AAAGAAAAGGAAGAAAACCTCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGC
TTTTTAAAAACGTTTCATGTAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAG
ATCATGACTTCCTTAAACGCCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTC
ATAAGTCTTTTGCTACTCACAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGC
CTAAATCTAAGGAGATGCCTCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGG
AAGAACAAGAACCCCCAATTTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAG
GCAGGCCTAAGAGGCAAATGAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCA
AGCTAGAATCTGAAAGTGACAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACA
GTCATAGGCCAAGTGTCTGTAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAA
CAATTATCCGCAAAATAAATAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATA
AAGGGAAAGTGCAATCCAAACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCA
AGAAAGGAACCATTTATATAGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTG
CTGTTCTTGAGCAAACAGCTCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTG
AGATTCTTCCATCACCTATTTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCA
GTTCAGTGCCATATTTGCATTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGT
TATCTCCTCCTACTTTGTTGCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGT
CTCATAGTGATGAGACCATTCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAA
AAAAGAGGAGGCATTCTTTTGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACA
AATGTAAGCGCAGGAATCATGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAA
ATAGACAGGATCCAGACTTTATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTA
TCCCCCGAGATCTTCTGCCAACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACA
TTCGAAAACCTGACTTAAAAAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTT
TTCCTCTTTCTAGTACTGGATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACT
ATGGAAGGTATCCTCCCACTCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTC
ATTTACTTCTCAATCCTGCCAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCC
TTTCCATGAGTACCTACCCCAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAG
AACACCGTTCTTCTGAACAACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAA
AGGATGCTGTTGGAGAGCGATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAA
ACAGAGAGGAACAGTGGGTCCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAG
AAAGTTCTCCAAGCTTATCCCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAA
TAGGCAGCTGCAGAGTTTCAAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCAC
TAAATCGGCTTCACAGAAAGGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATT
AGAAGTCACAGTCCTACCCACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATA
CAGTTAGATAGACATCGGTTAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTT
TTGCCACCTGACCCTTCTAACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTA
AAACGATGGGGTTTTGGCATGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCG
GAAAATTTAAGATTCTGGCTGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAG
TTTCTGGCTCCCGGAGCCCCCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATAC
ACATTTGAAGATGCTCAGGAGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTT
CTACAGGCAAAGAAAAAGGGCAGAAACATCCCTATTTTCCCATGCCATAAAAACTGTACACCAACACTGAGGGCCAGCACTAACCTGTTA

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000348120_chr1_240979715_-_6918nt
GGAGTGGAAGGTTGAGGGGGGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCC
GCCGCCGCCGCCGCCGCTCCCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCT
CAGTTTGCCCCCTTTAGCCTTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCG
GGAGGGATCCGCCGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCT
CGGCCTCGGCCTCCGACACGAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATA
AGATTCCTTGGCAATAACATACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAA
AGAGTCCTTCTGCCATCAGTACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCA
AACGGAATCGAGAAAGAAACATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTT
CAGAGGGAAATTTAAAATTGAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTG
CCATAAAAACAACTATTAAGCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAG
ACCCTTCAAAGTTGTACAAGAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAA
ACAATCCTTTGTCTAAGAAGCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGG
ATCCTGATTTAAAGGACAGAGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCA
AGTCTTCCAAGACAAAACCGAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCT
CTGTAGCTGGAATAATACATAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGC
CAGTGTTTAATGCAGCAGTAGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACT
TAGGCAAAAAGCCAGGAACTATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAG
TGCATAAAGAGTCTGGCAAGAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTG
GCCTAGTGGCCAAGGACTGTGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTT
GTCCTTTGGCAGGTCTGATCAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTA
GTACAAACATCAATAATCAGGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTAC
GGCAGAATAAAGAAAGCATATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCA
TTCAGCAAGACAGTTTCTCATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGG
ACTTTAAAATGGGAGGTGCTTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTA
CTGTATCTGTTAATCCTTTAACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAAC
TAATCGAAGAAATTTCTGAATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATA
GTATAAGTATTGAATGTAAAGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTG
GAAAAAAGCCAAGTTTGACTTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTT
TTTTAAAACTGGGTGCAGTATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAA
AAAGAAAAGGAAGAAAACCTCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGC
TTTTTAAAAACGTTTCATGTAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAG
ATCATGACTTCCTTAAACGCCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTC
ATAAGTCTTTTGCTACTCACAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGC
CTAAATCTAAGGAGATGCCTCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGG
AAGAACAAGAACCCCCAATTTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAG
GCAGGCCTAAGAGGCAAATGAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCA
AGCTAGAATCTGAAAGTGACAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACA
GTCATAGGCCAAGTGTCTGTAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAA
CAATTATCCGCAAAATAAATAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATA
AAGGGAAAGTGCAATCCAAACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCA
AGAAAGGAACCATTTATATAGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTG
CTGTTCTTGAGCAAACAGCTCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTG
AGATTCTTCCATCACCTATTTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCA
GTTCAGTGCCATATTTGCATTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGT
TATCTCCTCCTACTTTGTTGCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGT
CTCATAGTGATGAGACCATTCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAA
AAAAGAGGAGGCATTCTTTTGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACA
AATGTAAGCGCAGGAATCATGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAA
ATAGACAGGATCCAGACTTTATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTA
TCCCCCGAGATCTTCTGCCAACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACA
TTCGAAAACCTGACTTAAAAAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTT
TTCCTCTTTCTAGTACTGGATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACT
ATGGAAGGTATCCTCCCACTCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTC
ATTTACTTCTCAATCCTGCCAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCC
TTTCCATGAGTACCTACCCCAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAG
AACACCGTTCTTCTGAACAACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAA
AGGATGCTGTTGGAGAGCGATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAA
ACAGAGAGGAACAGTGGGTCCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAG
AAAGTTCTCCAAGCTTATCCCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAA
TAGGCAGCTGCAGAGTTTCAAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCAC
TAAATCGGCTTCACAGAAAGGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATT
AGAAGTCACAGTCCTACCCACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATA
CAGTTAGATAGACATCGGTTAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTT
TTGCCACCTGACCCTTCTAACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTA
AAACGATGGGGTTTTGGCATGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCG
GAAAATTTAAGATTCTGGCTGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAG
TTTCTGGCTCCCGGAGCCCCCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATAC
ACATTTGAAGATGCTCAGGAGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTT
CTACAGGCAAAGAAAAAGGGCAGAAACATCCCTATTTTCCCATGCCATAAAAACTGTACACCAACACTGAGGGCCAGCACTAACCTGTTA
TGAAAAGAGGGGAAATCTCTCACGTCCAAGAGGTTAACAAGCCTTGCTCAGTCTTACTAAACGGATCATCTTGTAGCATGAATGCAGACT
GGAGTCACTGCACACACTTTGTAGCTCAATGTTGTGACCTGGAGCAGAGGACATTAGAACAAGATGTTGCATGAGCAAAGGACCTAAATT
GTTATTTTTGTGTGTACATTCCATCTCCAATGGACTCTTCCGTCTCAATGCCTCCATTCCAAACTGTTGTCTGCTTTCTTTCTCCTTCTA
CTATGCTGGATCTGTGTCTCTTCCTTTTTAACAAGTTCAAGTGAAGTAAAACCTTTTCTTTTTTTCCTTCTTTCTCTCTCTCTCTCTCTC
AAAGCTTCAGTTAGACACACAGTTCACTGAAAATTCAGTCAGTCAAAAACTGGAAGAACTGTAAAAGAAAAAAGTATATATCAATAAGTA
TACATGTGGCTTCACATTTATTAAACAATAAATTCCGCACAGAAAGTTTCATTTCACCAATGTGTCACAGTCAGAAACAAACTCATGTCT
TCGTCTGTTGTCTGTACATTCTCCGTTAATGTTTCTCGCATTTATTTTTATACCATATTTAAAGAAGAAACACCTTTTACTCCAAATGTA

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000366563_chr1_240979715_-_6918nt
GGAGTGGAAGGTTGAGGGGGGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCC
GCCGCCGCCGCCGCCGCTCCCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCT
CAGTTTGCCCCCTTTAGCCTTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCG
GGAGGGATCCGCCGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCT
CGGCCTCGGCCTCCGACACGAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATA
AGATTCCTTGGCAATAACATACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAA
AGAGTCCTTCTGCCATCAGTACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCA
AACGGAATCGAGAAAGAAACATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTT
CAGAGGGAAATTTAAAATTGAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTG
CCATAAAAACAACTATTAAGCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAG
ACCCTTCAAAGTTGTACAAGAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAA
ACAATCCTTTGTCTAAGAAGCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGG
ATCCTGATTTAAAGGACAGAGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCA
AGTCTTCCAAGACAAAACCGAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCT
CTGTAGCTGGAATAATACATAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGC
CAGTGTTTAATGCAGCAGTAGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACT
TAGGCAAAAAGCCAGGAACTATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAG
TGCATAAAGAGTCTGGCAAGAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTG
GCCTAGTGGCCAAGGACTGTGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTT
GTCCTTTGGCAGGTCTGATCAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTA
GTACAAACATCAATAATCAGGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTAC
GGCAGAATAAAGAAAGCATATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCA
TTCAGCAAGACAGTTTCTCATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGG
ACTTTAAAATGGGAGGTGCTTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTA
CTGTATCTGTTAATCCTTTAACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAAC
TAATCGAAGAAATTTCTGAATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATA
GTATAAGTATTGAATGTAAAGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTG
GAAAAAAGCCAAGTTTGACTTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTT
TTTTAAAACTGGGTGCAGTATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAA
AAAGAAAAGGAAGAAAACCTCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGC
TTTTTAAAAACGTTTCATGTAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAG
ATCATGACTTCCTTAAACGCCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTC
ATAAGTCTTTTGCTACTCACAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGC
CTAAATCTAAGGAGATGCCTCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGG
AAGAACAAGAACCCCCAATTTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAG
GCAGGCCTAAGAGGCAAATGAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCA
AGCTAGAATCTGAAAGTGACAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACA
GTCATAGGCCAAGTGTCTGTAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAA
CAATTATCCGCAAAATAAATAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATA
AAGGGAAAGTGCAATCCAAACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCA
AGAAAGGAACCATTTATATAGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTG
CTGTTCTTGAGCAAACAGCTCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTG
AGATTCTTCCATCACCTATTTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCA
GTTCAGTGCCATATTTGCATTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGT
TATCTCCTCCTACTTTGTTGCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGT
CTCATAGTGATGAGACCATTCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAA
AAAAGAGGAGGCATTCTTTTGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACA
AATGTAAGCGCAGGAATCATGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAA
ATAGACAGGATCCAGACTTTATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTA
TCCCCCGAGATCTTCTGCCAACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACA
TTCGAAAACCTGACTTAAAAAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTT
TTCCTCTTTCTAGTACTGGATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACT
ATGGAAGGTATCCTCCCACTCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTC
ATTTACTTCTCAATCCTGCCAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCC
TTTCCATGAGTACCTACCCCAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAG
AACACCGTTCTTCTGAACAACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAA
AGGATGCTGTTGGAGAGCGATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAA
ACAGAGAGGAACAGTGGGTCCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAG
AAAGTTCTCCAAGCTTATCCCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAA
TAGGCAGCTGCAGAGTTTCAAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCAC
TAAATCGGCTTCACAGAAAGGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATT
AGAAGTCACAGTCCTACCCACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATA
CAGTTAGATAGACATCGGTTAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTT
TTGCCACCTGACCCTTCTAACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTA
AAACGATGGGGTTTTGGCATGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCG
GAAAATTTAAGATTCTGGCTGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAG
TTTCTGGCTCCCGGAGCCCCCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATAC
ACATTTGAAGATGCTCAGGAGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTT
CTACAGGCAAAGAAAAAGGGCAGAAACATCCCTATTTTCCCATGCCATAAAAACTGTACACCAACACTGAGGGCCAGCACTAACCTGTTA
TGAAAAGAGGGGAAATCTCTCACGTCCAAGAGGTTAACAAGCCTTGCTCAGTCTTACTAAACGGATCATCTTGTAGCATGAATGCAGACT
GGAGTCACTGCACACACTTTGTAGCTCAATGTTGTGACCTGGAGCAGAGGACATTAGAACAAGATGTTGCATGAGCAAAGGACCTAAATT
GTTATTTTTGTGTGTACATTCCATCTCCAATGGACTCTTCCGTCTCAATGCCTCCATTCCAAACTGTTGTCTGCTTTCTTTCTCCTTCTA
CTATGCTGGATCTGTGTCTCTTCCTTTTTAACAAGTTCAAGTGAAGTAAAACCTTTTCTTTTTTTCCTTCTTTCTCTCTCTCTCTCTCTC
AAAGCTTCAGTTAGACACACAGTTCACTGAAAATTCAGTCAGTCAAAAACTGGAAGAACTGTAAAAGAAAAAAGTATATATCAATAAGTA
TACATGTGGCTTCACATTTATTAAACAATAAATTCCGCACAGAAAGTTTCATTTCACCAATGTGTCACAGTCAGAAACAAACTCATGTCT
TCGTCTGTTGTCTGTACATTCTCCGTTAATGTTTCTCGCATTTATTTTTATACCATATTTAAAGAAGAAACACCTTTTACTCCAAATGTA

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000366564_chr1_240979715_-_6837nt
GGAGTGGAAGGTTGAGGGGGGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCC
GCCGCCGCCGCCGCCGCTCCCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCT
CAGTTTGCCCCCTTTAGCCTTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCG
GGAGGGATCCGCCGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCT
CGGCCTCGGCCTCCGACACGAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATA
AGATTCCTTGGCAATAACATACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAA
AGAGTCCTTCTGCCATCAGTACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCA
AACGGAATCGAGAAAGAAACATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTT
CAGAGGGAAATTTAAAATTGAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTG
CCATAAAAACAACTATTAAGCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAG
ACCCTTCAAAGTTGTACAAGAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAA
ACAATCCTTTGTCTAAGAAGCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGG
ATCCTGATTTAAAGGACAGAGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCA
AGTCTTCCAAGACAAAACCGAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCT
CTGTAGCTGGAATAATACATAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGC
CAGTGTTTAATGCAGCAGTAGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACT
TAGGCAAAAAGCCAGGAACTATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAG
TGCATAAAGAGTCTGGCAAGAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTG
GCCTAGTGGCCAAGGACTGTGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTT
GTCCTTTGGCAGGTCTGATCAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTA
GTACAAACATCAATAATCAGGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTAC
GGCAGAATAAAGAAAGCATATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCA
TTCAGCAAGACAGTTTCTCATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGG
ACTTTAAAATGGGAGGTGCTTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTA
CTGTATCTGTTAATCCTTTAACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAAC
TAATCGAAGAAATTTCTGAATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATA
GTATAAGTATTGAATGTAAAGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTG
GAAAAAAGCCAAGTTTGACTTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTT
TTTTAAAACTGGGTGCAGTATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAA
AAAGAAAAGGAAGAAAACCTCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGC
TTTTTAAAAACGTTTCATGTAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAG
ATCATGACTTCCTTAAACGCCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTC
ATAAGTCTTTTGCTACTCACAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGC
CTAAATCTAAGGAGATGCCTCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGG
AAGAACAAGAACCCCCAATTTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAG
GCAGGCCTAAGAGGCAAATGAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCA
AGCTAGAATCTGAAAGTGACAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACA
GTCATAGGCCAAGTGTCTGTAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAA
CAATTATCCGCAAAATAAATAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATA
AAGGGAAAGTGCAATCCAAACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCA
AGAAAGGAACCATTTATATAGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTG
CTGTTCTTGAGCAAACAGCTCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTG
AGATTCTTCCATCACCTATTTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCA
GTTCAGTGCCATATTTGCATTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGT
TATCTCCTCCTACTTTGTTGCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGT
CTCATAGTGATGAGACCATTCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAA
AAAAGAGGAGGCATTCTTTTGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACA
AATGTAAGCGCAGGAATCATGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAA
ATAGACAGGATCCAGACTTTATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTA
TCCCCCGAGATCTTCTGCCAACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACA
TTCGAAAACCTGACTTAAAAAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTT
TTCCTCTTTCTAGTACTGGATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACT
ATGGAAGGTATCCTCCCACTCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTC
ATTTACTTCTCAATCCTGCCAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCC
TTTCCATGAGTACCTACCCCAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAG
AACACCGTTCTTCTGAACAACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAA
AGGATGCTGTTGGAGAGCGATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAA
ACAGAGAGGAACAGTGGGTCCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAG
AAAGTTCTCCAAGCTTATCCCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAA
TAGGCAGCTGCAGAGTTTCAAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCAC
TAAATCGGCTTCACAGAAAGGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATT
AGAAGTCACAGTCCTACCCACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATA
CAGTTAGATAGACATCGGTTAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTT
TTGCCACCTGACCCTTCTAACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTA
AAACGATGGGGTTTTGGCATGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCG
GAAAATTTAAGATTCTGGCTGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAG
TTTCTGGCTCCCGGAGCCCCCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATAC
ACATTTGAAGATGCTCAGGAGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTT
CTACAGGCAAAGAAAAAGGGGAAATCTCTCACGTCCAAGAGGTTAACAAGCCTTGCTCAGTCTTACTAAACGGATCATCTTGTAGCATGA
ATGCAGACTGGAGTCACTGCACACACTTTGTAGCTCAATGTTGTGACCTGGAGCAGAGGACATTAGAACAAGATGTTGCATGAGCAAAGG
ACCTAAATTGTTATTTTTGTGTGTACATTCCATCTCCAATGGACTCTTCCGTCTCAATGCCTCCATTCCAAACTGTTGTCTGCTTTCTTT
CTCCTTCTACTATGCTGGATCTGTGTCTCTTCCTTTTTAACAAGTTCAAGTGAAGTAAAACCTTTTCTTTTTTTCCTTCTTTCTCTCTCT
CTCTCTCTCAAAGCTTCAGTTAGACACACAGTTCACTGAAAATTCAGTCAGTCAAAAACTGGAAGAACTGTAAAAGAAAAAAGTATATAT
CAATAAGTATACATGTGGCTTCACATTTATTAAACAATAAATTCCGCACAGAAAGTTTCATTTCACCAATGTGTCACAGTCAGAAACAAA
CTCATGTCTTCGTCTGTTGTCTGTACATTCTCCGTTAATGTTTCTCGCATTTATTTTTATACCATATTTAAAGAAGAAACACCTTTTACT

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000366565_chr1_240979715_-_6891nt
GGAGTGGAAGGTTGAGGGGGGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCC
GCCGCCGCCGCCGCCGCTCCCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCT
CAGTTTGCCCCCTTTAGCCTTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCG
GGAGGGATCCGCCGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCT
CGGCCTCGGCCTCCGACACGAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATA
AGATTCCTTGGCAATAACATACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAA
AGAGTCCTTCTGCCATCAGTACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCA
AACGGAATCGAGAAAGAAACATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTT
CAGAGGGAAATTTAAAATTGAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTG
CCATAAAAACAACTATTAAGCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAG
ACCCTTCAAAGTTGTACAAGAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAA
ACAATCCTTTGTCTAAGAAGCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGG
ATCCTGATTTAAAGGACAGAGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCA
AGTCTTCCAAGACAAAACCGAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCT
CTGTAGCTGGAATAATACATAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGC
CAGTGTTTAATGCAGCAGTAGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACT
TAGGCAAAAAGCCAGGAACTATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAG
TGCATAAAGAGTCTGGCAAGAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTG
GCCTAGTGGCCAAGGACTGTGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTT
GTCCTTTGGCAGGTCTGATCAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTA
GTACAAACATCAATAATCAGGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTAC
GGCAGAATAAAGAAAGCATATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCA
TTCAGCAAGACAGTTTCTCATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGG
ACTTTAAAATGGGAGGTGCTTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTA
CTGTATCTGTTAATCCTTTAACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAAC
TAATCGAAGAAATTTCTGAATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATA
GTATAAGTATTGAATGTAAAGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTG
GAAAAAAGCCAAGTTTGACTTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTT
TTTTAAAACTGGGTGCAGTATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAA
AAAGAAAAGGAAGAAAACCTCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGC
TTTTTAAAAACGTTTCATGTAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAG
ATCATGACTTCCTTAAACGCCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTC
ATAAGTCTTTTGCTACTCACAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGC
CTAAATCTAAGGAGATGCCTCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGG
AAGAACAAGAACCCCCAATTTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAG
GCAGGCCTAAGAGGCAAATGAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCA
AGCTAGAATCTGAAAGTGACAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACA
GTCATAGGCCAAGTGTCTGTAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAA
CAATTATCCGCAAAATAAATAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATA
AAGGGAAAGTGCAATCCAAACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCA
AGAAAGGAACCATTTATATAGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTG
CTGTTCTTGAGCAAACAGCTCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTG
AGATTCTTCCATCACCTATTTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCA
GTTCAGTGCCATATTTGCATTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGT
TATCTCCTCCTACTTTGTTGCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGT
CTCATAGTGATGAGACCATTCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAA
AAAAGAGGAGGCATTCTTTTGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACA
AATGTAAGCGCAGGAATCATGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAA
ATAGACAGGATCCAGACTTTATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTA
TCCCCCGAGATCTTCTGCCAACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACA
TTCGAAAACCTGACTTAAAAAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTT
TTCCTCTTTCTAGTACTGGATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACT
ATGGAAGGTATCCTCCCACTCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTC
ATTTACTTCTCAATCCTGCCAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCC
TTTCCATGAGTACCTACCCCAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAG
AACACCGTTCTTCTGAACAACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAA
AGGATGCTGTTGGAGAGCGATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAA
ACAGAGAGGAACAGTGGGTCCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAG
AAAGTTCTCCAAGCTTATCCCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAA
TAGGCAGCTGCAGAGTTTCAAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCAC
TAAATCGGCTTCACAGAAAGGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATT
AGAAGTCACAGTCCTACCCACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATA
CAGTTAGATAGACATCGGTTAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTT
TTGCCACCTGACCCTTCTAACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTA
AAACGATGGGGTTTTGGCATGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCG
GAAAATTTAAGATTCTGGCTGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAG
TTTCTGGCTCCCGGAGCCCCCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATAC
ACATTTGAAGATGCTCAGGAGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTT
CTACAGGCAAAGAAAAAGTCTGGAAACTCAATGGATCGCAGAACATCTTTTGAAAAATTTGCACAGAATGTGGGGAAATCTCTCACGTCC
AAGAGGTTAACAAGCCTTGCTCAGTCTTACTAAACGGATCATCTTGTAGCATGAATGCAGACTGGAGTCACTGCACACACTTTGTAGCTC
AATGTTGTGACCTGGAGCAGAGGACATTAGAACAAGATGTTGCATGAGCAAAGGACCTAAATTGTTATTTTTGTGTGTACATTCCATCTC
CAATGGACTCTTCCGTCTCAATGCCTCCATTCCAAACTGTTGTCTGCTTTCTTTCTCCTTCTACTATGCTGGATCTGTGTCTCTTCCTTT
TTAACAAGTTCAAGTGAAGTAAAACCTTTTCTTTTTTTCCTTCTTTCTCTCTCTCTCTCTCTCAAAGCTTCAGTTAGACACACAGTTCAC
TGAAAATTCAGTCAGTCAAAAACTGGAAGAACTGTAAAAGAAAAAAGTATATATCAATAAGTATACATGTGGCTTCACATTTATTAAACA
ATAAATTCCGCACAGAAAGTTTCATTTCACCAATGTGTCACAGTCAGAAACAAACTCATGTCTTCGTCTGTTGTCTGTACATTCTCCGTT
AATGTTTCTCGCATTTATTTTTATACCATATTTAAAGAAGAAACACCTTTTACTCCAAATGTATTAAAGTTGATCCCTTCTCTGTAAATT

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000446183_chr1_240979715_-_6773nt
GGAGTGGAAGGTTGAGGGGGGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCC
GCCGCCGCCGCCGCCGCTCCCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCT
CAGTTTGCCCCCTTTAGCCTTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCG
GGAGGGATCCGCCGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCT
CGGCCTCGGCCTCCGACACGAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATA
AGATTCCTTGGCAATAACATACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAA
AGAGTCCTTCTGCCATCAGTACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCA
AACGGAATCGAGAAAGAAACATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTT
CAGAGGGAAATTTAAAATTGAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTG
CCATAAAAACAACTATTAAGCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAG
ACCCTTCAAAGTTGTACAAGAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAA
ACAATCCTTTGTCTAAGAAGCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGG
ATCCTGATTTAAAGGACAGAGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCA
AGTCTTCCAAGACAAAACCGAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCT
CTGTAGCTGGAATAATACATAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGC
CAGTGTTTAATGCAGCAGTAGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACT
TAGGCAAAAAGCCAGGAACTATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAG
TGCATAAAGAGTCTGGCAAGAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTG
GCCTAGTGGCCAAGGACTGTGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTT
GTCCTTTGGCAGGTCTGATCAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTA
GTACAAACATCAATAATCAGGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTAC
GGCAGAATAAAGAAAGCATATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCA
TTCAGCAAGACAGTTTCTCATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGG
ACTTTAAAATGGGAGGTGCTTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTA
CTGTATCTGTTAATCCTTTAACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAAC
TAATCGAAGAAATTTCTGAATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATA
GTATAAGTATTGAATGTAAAGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTG
GAAAAAAGCCAAGTTTGACTTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTT
TTTTAAAACTGGGTGCAGTATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAA
AAAGAAAAGGAAGAAAACCTCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGC
TTTTTAAAAACGTTTCATGTAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAG
ATCATGACTTCCTTAAACGCCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTC
ATAAGTCTTTTGCTACTCACAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGC
CTAAATCTAAGGAGATGCCTCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGG
AAGAACAAGAACCCCCAATTTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAG
GCAGGCCTAAGAGGCAAATGAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCA
AGCTAGAATCTGAAAGTGACAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACA
GTCATAGGCCAAGTGTCTGTAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAA
CAATTATCCGCAAAATAAATAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATA
AAGGGAAAGTGCAATCCAAACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCA
AGAAAGGAACCATTTATATAGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTG
CTGTTCTTGAGCAAACAGCTCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTG
AGATTCTTCCATCACCTATTTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCA
GTTCAGTGCCATATTTGCATTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGT
TATCTCCTCCTACTTTGTTGCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGT
CTCATAGTGATGAGACCATTCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAA
AAAAGAGGAGGCATTCTTTTGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACA
AATGTAAGCGCAGGAATCATGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAA
ATAGACAGGATCCAGACTTTATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTA
TCCCCCGAGATCTTCTGCCAACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACA
TTCGAAAACCTGACTTAAAAAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTT
TTCCTCTTTCTAGTACTGGATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACT
ATGGAAGGTATCCTCCCACTCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTC
ATTTACTTCTCAATCCTGCCAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCC
TTTCCATGAGTACCTACCCCAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAG
AACACCGTTCTTCTGAACAACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAA
AGGATGCTGTTGGAGAGCGATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAA
ACAGAGAGGAACAGTGGGTCCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAG
AAAGTTCTCCAAGCTTATCCCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAA
TAGGCAGCTGCAGAGTTTCAAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCAC
TAAATCGGCTTCACAGAAAGGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATT
AGAAGTCACAGTCCTACCCACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATA
CAGTTAGATAGACATCGGTTAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTT
TTGCCACCTGACCCTTCTAACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTA
AAACGATGGGGTTTTGGCATGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCG
GAAAATTTAAGATTCTGGCTGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAG
TTTCTGGCTCCCGGAGCCCCCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATAC
ACATTTGAAGATGCTCAGGAGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTT
CTACAGGCAAAGAAAAAGGGCAGAAACATCCCTATTTTCCCATGCCATAAAAACTGTACACCAACACTGAGGGCCAGCACTAACCTGTTA
TGAAAAGAGGGGAAATCTCTCACGTCCAAGAGGTTAACAAGCCTTGCTCAGTCTTACTAAACGGATCATCTTGTAGCATGAATGCAGACT
GGAGTCACTGCACACACTTTGTAGCTCAATGTTGTGACCTGGAGCAGAGGACATTAGAACAAGATGTTGCATGAGCAAAGGACCTAAATT
GTTATTTTTGTGTGTACATTCCATCTCCAATGGACTCTTCCGTCTCAATGCCTCCATTCCAAACTGTTGTCTGCTTTCTTTCTCCTTCTA
CTATGCTGGATCTGTGTCTCTTCCTTTTTAACAAGTTCAAGTGAAGTAAAACCTTTTCTTTTTTTCCTTCTTTCTCTCTCTCTCTCTCTC
AAAGCTTCAGTTAGACACACAGTTCACTGAAAATTCAGTCAGTCAAAAACTGGAAGAACTGTAAAAGAAAAAAGTATATATCAATAAGTA
TACATGTGGCTTCACATTTATTAAACAATAAATTCCGCACAGAAAGTTTCATTTCACCAATGTGTCACAGTCAGAAACAAACTCATGTCT

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000366562_chr1_240979715_-_6189nt
GGAGTGGAAGGTTGAGGGGGGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCC
GCCGCCGCCGCCGCCGCTCCCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCT
CAGTTTGCCCCCTTTAGCCTTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCG
GGAGGGATCCGCCGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCT
CGGCCTCGGCCTCCGACACGAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATA
AGATTCCTTGGCAATAACATACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAA
AGAGTCCTTCTGCCATCAGTACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCA
AACGGAATCGAGAAAGAAACATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTT
CAGAGGGAAATTTAAAATTGAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTG
CCATAAAAACAACTATTAAGCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAG
ACCCTTCAAAGTTGTACAAGAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAA
ACAATCCTTTGTCTAAGAAGCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGG
ATCCTGATTTAAAGGACAGAGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCA
AGTCTTCCAAGACAAAACCGAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCT
CTGTAGCTGGAATAATACATAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGC
CAGTGTTTAATGCAGCAGTAGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACT
TAGGCAAAAAGCCAGGAACTATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAG
TGCATAAAGAGTCTGGCAAGAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTG
GCCTAGTGGCCAAGGACTGTGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTT
GTCCTTTGGCAGGTCTGATCAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTA
GTACAAACATCAATAATCAGGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTAC
GGCAGAATAAAGAAAGCATATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCA
TTCAGCAAGACAGTTTCTCATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGG
ACTTTAAAATGGGAGGTGCTTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTA
CTGTATCTGTTAATCCTTTAACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAAC
TAATCGAAGAAATTTCTGAATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATA
GTATAAGTATTGAATGTAAAGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTG
GAAAAAAGCCAAGTTTGACTTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTT
TTTTAAAACTGGGTGCAGTATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAA
AAAGAAAAGGAAGAAAACCTCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGC
TTTTTAAAAACGTTTCATGTAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAG
ATCATGACTTCCTTAAACGCCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTC
ATAAGTCTTTTGCTACTCACAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGC
CTAAATCTAAGGAGATGCCTCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGG
AAGAACAAGAACCCCCAATTTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAG
GCAGGCCTAAGAGGCAAATGAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCA
AGCTAGAATCTGAAAGTGACAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACA
GTCATAGGCCAAGTGTCTGTAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAA
CAATTATCCGCAAAATAAATAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATA
AAGGGAAAGTGCAATCCAAACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCA
AGAAAGGAACCATTTATATAGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTG
CTGTTCTTGAGCAAACAGCTCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTG
AGATTCTTCCATCACCTATTTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCA
GTTCAGTGCCATATTTGCATTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGT
TATCTCCTCCTACTTTGTTGCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGT
CTCATAGTGATGAGACCATTCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAA
AAAAGAGGAGGCATTCTTTTGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACA
AATGTAAGCGCAGGAATCATGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAA
ATAGACAGGATCCAGACTTTATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTA
TCCCCCGAGATCTTCTGCCAACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACA
TTCGAAAACCTGACTTAAAAAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTT
TTCCTCTTTCTAGTACTGGATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACT
ATGGAAGGTATCCTCCCACTCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTC
ATTTACTTCTCAATCCTGCCAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCC
TTTCCATGAGTACCTACCCCAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAG
AACACCGTTCTTCTGAACAACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAA
AGGATGCTGTTGGAGAGCGATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAA
ACAGAGAGGAACAGTGGGTCCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAG
AAAGTTCTCCAAGCTTATCCCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAA
TAGGCAGCTGCAGAGTTTCAAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCAC
TAAATCGGCTTCACAGAAAGGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATT
AGAAGTCACAGTCCTACCCACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATA
CAGTTAGATAGACATCGGTTAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTT
TTGCCACCTGACCCTTCTAACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTA
AAACGATGGGGTTTTGGCATGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCG
GAAAATTTAAGATTCTGGCTGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAG
TTTCTGGCTCCCGGAGCCCCCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATAC
ACATTTGAAGATGCTCAGGAGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTT

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000401882_chr1_240979715_-_6213nt
GGAGTGGAAGGTTGAGGGGGGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCC
GCCGCCGCCGCCGCCGCTCCCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCT
CAGTTTGCCCCCTTTAGCCTTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCG
GGAGGGATCCGCCGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCT
CGGCCTCGGCCTCCGACACGAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATA
AGATTCCTTGGCAATAACATACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAA
AGAGTCCTTCTGCCATCAGTACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCA
AACGGAATCGAGAAAGAAACATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTT
CAGAGGGAAATTTAAAATTGAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTG
CCATAAAAACAACTATTAAGCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAG
ACCCTTCAAAGTTGTACAAGAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAA
ACAATCCTTTGTCTAAGAAGCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGG
ATCCTGATTTAAAGGACAGAGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCA
AGTCTTCCAAGACAAAACCGAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCT
CTGTAGCTGGAATAATACATAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGC
CAGTGTTTAATGCAGCAGTAGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACT
TAGGCAAAAAGCCAGGAACTATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAG
TGCATAAAGAGTCTGGCAAGAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTG
GCCTAGTGGCCAAGGACTGTGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTT
GTCCTTTGGCAGGTCTGATCAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTA
GTACAAACATCAATAATCAGGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTAC
GGCAGAATAAAGAAAGCATATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCA
TTCAGCAAGACAGTTTCTCATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGG
ACTTTAAAATGGGAGGTGCTTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTA
CTGTATCTGTTAATCCTTTAACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAAC
TAATCGAAGAAATTTCTGAATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATA
GTATAAGTATTGAATGTAAAGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTG
GAAAAAAGCCAAGTTTGACTTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTT
TTTTAAAACTGGGTGCAGTATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAA
AAAGAAAAGGAAGAAAACCTCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGC
TTTTTAAAAACGTTTCATGTAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAG
ATCATGACTTCCTTAAACGCCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTC
ATAAGTCTTTTGCTACTCACAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGC
CTAAATCTAAGGAGATGCCTCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGG
AAGAACAAGAACCCCCAATTTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAG
GCAGGCCTAAGAGGCAAATGAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCA
AGCTAGAATCTGAAAGTGACAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACA
GTCATAGGCCAAGTGTCTGTAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAA
CAATTATCCGCAAAATAAATAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATA
AAGGGAAAGTGCAATCCAAACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCA
AGAAAGGAACCATTTATATAGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTG
CTGTTCTTGAGCAAACAGCTCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTG
AGATTCTTCCATCACCTATTTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCA
GTTCAGTGCCATATTTGCATTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGT
TATCTCCTCCTACTTTGTTGCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGT
CTCATAGTGATGAGACCATTCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAA
AAAAGAGGAGGCATTCTTTTGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACA
AATGTAAGCGCAGGAATCATGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAA
ATAGACAGGATCCAGACTTTATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTA
TCCCCCGAGATCTTCTGCCAACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACA
TTCGAAAACCTGACTTAAAAAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTT
TTCCTCTTTCTAGTACTGGATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACT
ATGGAAGGTATCCTCCCACTCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTC
ATTTACTTCTCAATCCTGCCAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCC
TTTCCATGAGTACCTACCCCAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAG
AACACCGTTCTTCTGAACAACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAA
AGGATGCTGTTGGAGAGCGATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAA
ACAGAGAGGAACAGTGGGTCCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAG
AAAGTTCTCCAAGCTTATCCCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAA
TAGGCAGCTGCAGAGTTTCAAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCAC
TAAATCGGCTTCACAGAAAGGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATT
AGAAGTCACAGTCCTACCCACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATA
CAGTTAGATAGACATCGGTTAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTT
TTGCCACCTGACCCTTCTAACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTA
AAACGATGGGGTTTTGGCATGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCG
GAAAATTTAAGATTCTGGCTGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAG
TTTCTGGCTCCCGGAGCCCCCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATAC
ACATTTGAAGATGCTCAGGAGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTT
CTACAGGCAAAGAAAAAGGGCAGAAACATCCCTATTTTCCCATGCCATAAAAACTGTACACCAACACTGAGGGCCAGCACTAACCTGTTA

>In-frame_ASH1L_ENST00000392403_chr1_155447677_-_RGS7_ENST00000407727_chr1_240979715_-_6267nt
GGAGTGGAAGGTTGAGGGGGGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCC
GCCGCCGCCGCCGCCGCTCCCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCT
CAGTTTGCCCCCTTTAGCCTTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCG
GGAGGGATCCGCCGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCT
CGGCCTCGGCCTCCGACACGAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATA
AGATTCCTTGGCAATAACATACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAA
AGAGTCCTTCTGCCATCAGTACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCA
AACGGAATCGAGAAAGAAACATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTT
CAGAGGGAAATTTAAAATTGAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTG
CCATAAAAACAACTATTAAGCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAG
ACCCTTCAAAGTTGTACAAGAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAA
ACAATCCTTTGTCTAAGAAGCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGG
ATCCTGATTTAAAGGACAGAGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCA
AGTCTTCCAAGACAAAACCGAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCT
CTGTAGCTGGAATAATACATAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGC
CAGTGTTTAATGCAGCAGTAGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACT
TAGGCAAAAAGCCAGGAACTATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAG
TGCATAAAGAGTCTGGCAAGAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTG
GCCTAGTGGCCAAGGACTGTGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTT
GTCCTTTGGCAGGTCTGATCAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTA
GTACAAACATCAATAATCAGGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTAC
GGCAGAATAAAGAAAGCATATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCA
TTCAGCAAGACAGTTTCTCATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGG
ACTTTAAAATGGGAGGTGCTTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTA
CTGTATCTGTTAATCCTTTAACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAAC
TAATCGAAGAAATTTCTGAATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATA
GTATAAGTATTGAATGTAAAGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTG
GAAAAAAGCCAAGTTTGACTTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTT
TTTTAAAACTGGGTGCAGTATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAA
AAAGAAAAGGAAGAAAACCTCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGC
TTTTTAAAAACGTTTCATGTAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAG
ATCATGACTTCCTTAAACGCCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTC
ATAAGTCTTTTGCTACTCACAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGC
CTAAATCTAAGGAGATGCCTCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGG
AAGAACAAGAACCCCCAATTTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAG
GCAGGCCTAAGAGGCAAATGAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCA
AGCTAGAATCTGAAAGTGACAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACA
GTCATAGGCCAAGTGTCTGTAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAA
CAATTATCCGCAAAATAAATAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATA
AAGGGAAAGTGCAATCCAAACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCA
AGAAAGGAACCATTTATATAGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTG
CTGTTCTTGAGCAAACAGCTCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTG
AGATTCTTCCATCACCTATTTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCA
GTTCAGTGCCATATTTGCATTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGT
TATCTCCTCCTACTTTGTTGCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGT
CTCATAGTGATGAGACCATTCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAA
AAAAGAGGAGGCATTCTTTTGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACA
AATGTAAGCGCAGGAATCATGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAA
ATAGACAGGATCCAGACTTTATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTA
TCCCCCGAGATCTTCTGCCAACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACA
TTCGAAAACCTGACTTAAAAAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTT
TTCCTCTTTCTAGTACTGGATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACT
ATGGAAGGTATCCTCCCACTCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTC
ATTTACTTCTCAATCCTGCCAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCC
TTTCCATGAGTACCTACCCCAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAG
AACACCGTTCTTCTGAACAACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAA
AGGATGCTGTTGGAGAGCGATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAA
ACAGAGAGGAACAGTGGGTCCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAG
AAAGTTCTCCAAGCTTATCCCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAA
TAGGCAGCTGCAGAGTTTCAAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCAC
TAAATCGGCTTCACAGAAAGGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGTCTGTCTATGGTTTACAAAATGATATT
AGAAGTCACAGTCCTACCCACACACCCACACCAGAAACTAAACCTCCAACAGAAGATGAGTTACAACAACAGATAAAATATTGGCAAATA
CAGTTAGATAGACATCGGTTAAAAATGTCAAAAGTCGCTGACAGTCTACTAAGTTACACGGAACAGTATTTAGAATACGACCCGTTTCTT
TTGCCACCTGACCCTTCTAACCCATGGCTGTCCGATGACACCACTTTCTGGGAACTTGAGGCAAGCAAAGAACCGAGCCAGCAGAGGGTA
AAACGATGGGGTTTTGGCATGGACGAGGCATTGAAAGACCCAGTTGGGAGAGAACAGTTCCTTAAATTTCTAGAGTCAGAATTCAGCTCG
GAAAATTTAAGATTCTGGCTGGCAGTGGAGGACCTGAAAAAGAGGCCTATTAAAGAAGTACCCTCAAGAGTTCAGGAAATATGGCAAGAG
TTTCTGGCTCCCGGAGCCCCCAGTGCTATTAACTTGGATTCCAAGAGTTATGACAAAACCACACAGAACGTGAAGGAACCTGGACGATAC
ACATTTGAAGATGCTCAGGAGCACATTTACAAACTGATGAAAAGTGATTCATACCCACGTTTTATAAGATCCAGTGCCTATCAGGAGCTT
CTACAGGCAAAGAAAAAGTCTGGAAACTCAATGGATCGCAGAACATCTTTTGAAAAATTTGCACAGAATGTGGGCAGAAACATCCCTATT


Top

FusionGenePPI for ASH1L_RGS7


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ASH1LHIST1H3A, H3F3A, SMAD7, THAP7, MORF4L1, PARD6A, SIKE1, MORF4L2, NXF2, CDX1RGS7PKD1, GNAQ, SNAPIN, GNB5, GNAI3, GNAZ, CCT5, HSP90AA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ASH1L_RGS7


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ASH1L_RGS7


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneASH1LC0023903Liver neoplasms1CTD_human
TgeneRGS7C3714756Intellectual Disability1CTD_human