FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29656

FusionGeneSummary for PUM1_KIAA1211

check button Fusion gene summary
Fusion gene informationFusion gene name: PUM1_KIAA1211
Fusion gene ID: 29656
HgeneTgene
Gene symbol

PUM1

KIAA1211

Gene ID

9698

57482

Gene namepumilio RNA binding family member 1KIAA1211
SynonymsHSPUM|PUMH|PUMH1|PUML1|SCA47-
Cytomap

1p35.2

4q12

Type of geneprotein-codingprotein-coding
Descriptionpumilio homolog 1pumilio-1uncharacterized protein KIAA1211
Modification date2018051920180519
UniProtAcc

Q14671

Q6ZU35

Ensembl transtripts involved in fusion geneENST00000424085, ENST00000257075, 
ENST00000373747, ENST00000426105, 
ENST00000440538, ENST00000373741, 
ENST00000423018, ENST00000373742, 
ENST00000490546, 
ENST00000264229, 
ENST00000541073, ENST00000504228, 
ENST00000505410, 
Fusion gene scores* DoF score26 X 16 X 15=62406 X 4 X 4=96
# samples 346
** MAII scorelog2(34/6240*10)=-4.19793937761191
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/96*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PUM1 [Title/Abstract] AND KIAA1211 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePUM1

GO:0010608

posttranscriptional regulation of gene expression

25100735

HgenePUM1

GO:0043488

regulation of mRNA stability

26724866

HgenePUM1

GO:0051726

regulation of cell cycle

20818387

HgenePUM1

GO:0051983

regulation of chromosome segregation

26724866

HgenePUM1

GO:1900246

positive regulation of RIG-I signaling pathway

25340845

HgenePUM1

GO:2000637

positive regulation of gene silencing by miRNA

20818387|22345517


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-BB-7861-01APUM1chr1

31465237

-KIAA1211chr4

57189543

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000424085ENST00000264229PUM1chr1

31465237

-KIAA1211chr4

57189543

+
intron-3CDSENST00000424085ENST00000541073PUM1chr1

31465237

-KIAA1211chr4

57189543

+
intron-3CDSENST00000424085ENST00000504228PUM1chr1

31465237

-KIAA1211chr4

57189543

+
intron-intronENST00000424085ENST00000505410PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000257075ENST00000264229PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000257075ENST00000541073PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000257075ENST00000504228PUM1chr1

31465237

-KIAA1211chr4

57189543

+
5CDS-intronENST00000257075ENST00000505410PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000373747ENST00000264229PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000373747ENST00000541073PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000373747ENST00000504228PUM1chr1

31465237

-KIAA1211chr4

57189543

+
5CDS-intronENST00000373747ENST00000505410PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000426105ENST00000264229PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000426105ENST00000541073PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000426105ENST00000504228PUM1chr1

31465237

-KIAA1211chr4

57189543

+
5CDS-intronENST00000426105ENST00000505410PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000440538ENST00000264229PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000440538ENST00000541073PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000440538ENST00000504228PUM1chr1

31465237

-KIAA1211chr4

57189543

+
5CDS-intronENST00000440538ENST00000505410PUM1chr1

31465237

-KIAA1211chr4

57189543

+
Frame-shiftENST00000373741ENST00000264229PUM1chr1

31465237

-KIAA1211chr4

57189543

+
Frame-shiftENST00000373741ENST00000541073PUM1chr1

31465237

-KIAA1211chr4

57189543

+
Frame-shiftENST00000373741ENST00000504228PUM1chr1

31465237

-KIAA1211chr4

57189543

+
5CDS-intronENST00000373741ENST00000505410PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000423018ENST00000264229PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000423018ENST00000541073PUM1chr1

31465237

-KIAA1211chr4

57189543

+
In-frameENST00000423018ENST00000504228PUM1chr1

31465237

-KIAA1211chr4

57189543

+
5CDS-intronENST00000423018ENST00000505410PUM1chr1

31465237

-KIAA1211chr4

57189543

+
Frame-shiftENST00000373742ENST00000264229PUM1chr1

31465237

-KIAA1211chr4

57189543

+
Frame-shiftENST00000373742ENST00000541073PUM1chr1

31465237

-KIAA1211chr4

57189543

+
Frame-shiftENST00000373742ENST00000504228PUM1chr1

31465237

-KIAA1211chr4

57189543

+
5CDS-intronENST00000373742ENST00000505410PUM1chr1

31465237

-KIAA1211chr4

57189543

+
intron-3CDSENST00000490546ENST00000264229PUM1chr1

31465237

-KIAA1211chr4

57189543

+
intron-3CDSENST00000490546ENST00000541073PUM1chr1

31465237

-KIAA1211chr4

57189543

+
intron-3CDSENST00000490546ENST00000504228PUM1chr1

31465237

-KIAA1211chr4

57189543

+
intron-intronENST00000490546ENST00000505410PUM1chr1

31465237

-KIAA1211chr4

57189543

+

Top

FusionProtFeatures for PUM1_KIAA1211


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PUM1

Q14671

KIAA1211

Q6ZU35

Sequence-specific RNA-binding protein that acts as apost-transcriptional repressor by binding the 3'-UTR of mRNAtargets. Binds to an RNA consensus sequence, the Pumilio ResponseElement (PRE), 5'-UGUANAUA-3', that is related to the NanosResponse Element (NRE) (PubMed:21572425, PubMed:18328718,PubMed:21653694, PubMed:21397187). Mediates post-transcriptionalrepression of transcripts via different mechanisms: acts viadirect recruitment of the CCR4-POP2-NOT deadenylase leading totranslational inhibition and mRNA degradation (PubMed:22955276).Also mediates deadenylation-independent repression by promotingaccessibility of miRNAs (PubMed:18776931, PubMed:20818387,PubMed:20860814, PubMed:22345517). Following growth factorstimulation, phosphorylated and binds to the 3'-UTR of CDKN1B/p27mRNA, inducing a local conformational change that exposes miRNA-binding sites, promoting association of miR-221 and miR-222,efficient suppression of CDKN1B/p27 expression, and rapid entry tothe cell cycle (PubMed:20818387). Acts as a post-transcriptionalrepressor of E2F3 mRNAs by binding to its 3'-UTR and facilitatingmiRNA regulation (PubMed:22345517). Represses a program of genesnecessary to maintain genomic stability such as key mitotic, DNArepair and DNA replication factors. Its ability to repress thosetarget mRNAs is regulated by the lncRNA NORAD (non-coding RNAactivated by DNA damage) which, due to its high abundance andmultitude of PUMILIO binding sites, is able to sequester asignificant fraction of PUM1 and PUM2 in the cytoplasm(PubMed:26724866). Involved in neuronal functions by regulatingATXN1 mRNA levels: acts by binding to the 3'-UTR of ATXN1transcripts, leading to their down-regulation independently of themiRNA machinery (PubMed:25768905). Plays a role in cytoplasmicsensing of viral infection (PubMed:25340845). In testis, acts as apost-transcriptional regulator of spermatogenesis by binding tothe 3'-UTR of mRNAs coding for regulators of p53/TP53. Involved inembryonic stem cell renewal by facilitating the exit from theground state: acts by targeting mRNAs coding for naivepluripotency transcription factors and accelerates their down-regulation at the onset of differentiation (By similarity). Bindsspecifically to miRNA MIR199A precursor, with PUM2, regulatesmiRNA MIR199A expression at a postranscriptional level(PubMed:28431233). {ECO:0000250|UniProtKB:Q80U78,ECO:0000269|PubMed:18328718, ECO:0000269|PubMed:18776931,ECO:0000269|PubMed:20818387, ECO:0000269|PubMed:20860814,ECO:0000269|PubMed:21397187, ECO:0000269|PubMed:21572425,ECO:0000269|PubMed:21653694, ECO:0000269|PubMed:22345517,ECO:0000269|PubMed:22955276, ECO:0000269|PubMed:25340845,ECO:0000269|PubMed:25768905, ECO:0000269|PubMed:26724866,ECO:0000269|PubMed:28431233}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PUM1_KIAA1211


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PUM1_ENST00000257075_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_557aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTS
DHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLK
EEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQF
DYSGTQVPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKM
SVSACSLEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWL

>In-frame_PUM1_ENST00000257075_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_557aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTS
DHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLK
EEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQF
DYSGTQVPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKM
SVSACSLEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWL

>In-frame_PUM1_ENST00000257075_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_557aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTS
DHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLK
EEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQF
DYSGTQVPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKM
SVSACSLEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWL

>In-frame_PUM1_ENST00000373747_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_557aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTS
DHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLK
EEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQF
DYSGTQVPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKM
SVSACSLEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWL

>In-frame_PUM1_ENST00000373747_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_557aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTS
DHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLK
EEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQF
DYSGTQVPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKM
SVSACSLEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWL

>In-frame_PUM1_ENST00000373747_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_557aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTS
DHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLK
EEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQF
DYSGTQVPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKM
SVSACSLEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWL

>In-frame_PUM1_ENST00000426105_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_557aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTS
DHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLK
EEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQF
DYSGTQVPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKM
SVSACSLEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWL

>In-frame_PUM1_ENST00000426105_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_557aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTS
DHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLK
EEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQF
DYSGTQVPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKM
SVSACSLEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWL

>In-frame_PUM1_ENST00000426105_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_557aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTS
DHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLK
EEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQF
DYSGTQVPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKM
SVSACSLEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWL

>In-frame_PUM1_ENST00000440538_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_557aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTS
DHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLK
EEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQF
DYSGTQVPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKM
SVSACSLEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWL

>In-frame_PUM1_ENST00000440538_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_557aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTS
DHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLK
EEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQF
DYSGTQVPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKM
SVSACSLEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWL

>In-frame_PUM1_ENST00000440538_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_557aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTS
DHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLK
EEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQF
DYSGTQVPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKM
SVSACSLEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWL

>In-frame_PUM1_ENST00000423018_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_461aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEGPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVM
DKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQFDYSGTQ
VPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKMSVSACS
LEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWLWPKGKQ

>In-frame_PUM1_ENST00000423018_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_461aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEGPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVM
DKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQFDYSGTQ
VPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKMSVSACS
LEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWLWPKGKQ

>In-frame_PUM1_ENST00000423018_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_461aa
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHG
EQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEGPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVM
DKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQFDYSGTQ
VPVDSAAATVGLFDYNSQQQRSRCFRADTPXMAPNLQRKWKLLSRCGXRXHCKSKRGFGSSRRRGRRESKPERPNRQKSSPKKMSVSACS
LEAAVSAEQVPCTSPLLCQKRRGPRLQCPGLSAENSXKRPILFLRLXQWRSPTRLPQRRWXKKSPRGFPPRMLPPCQQNQPGWLWPKGKQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PUM1_ENST00000257075_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_1673nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAA
AAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCA
GATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCA
CGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTT
GGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAG
GAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGT
AATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGT
GCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTT
GATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGC
TTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGC
AAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATG
TCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCG
AGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGG
CTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTT

>In-frame_PUM1_ENST00000257075_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_1673nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAA
AAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCA
GATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCA
CGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTT
GGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAG
GAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGT
AATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGT
GCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTT
GATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGC
TTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGC
AAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATG
TCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCG
AGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGG
CTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTT

>In-frame_PUM1_ENST00000257075_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_1673nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAA
AAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCA
GATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCA
CGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTT
GGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAG
GAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGT
AATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGT
GCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTT
GATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGC
TTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGC
AAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATG
TCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCG
AGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGG
CTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTT

>In-frame_PUM1_ENST00000373747_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_1673nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAA
AAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCA
GATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCA
CGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTT
GGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAG
GAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGT
AATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGT
GCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTT
GATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGC
TTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGC
AAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATG
TCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCG
AGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGG
CTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTT

>In-frame_PUM1_ENST00000373747_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_1673nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAA
AAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCA
GATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCA
CGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTT
GGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAG
GAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGT
AATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGT
GCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTT
GATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGC
TTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGC
AAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATG
TCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCG
AGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGG
CTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTT

>In-frame_PUM1_ENST00000373747_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_1673nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAA
AAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCA
GATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCA
CGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTT
GGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAG
GAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGT
AATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGT
GCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTT
GATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGC
TTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGC
AAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATG
TCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCG
AGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGG
CTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTT

>In-frame_PUM1_ENST00000426105_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_1673nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAA
AAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCA
GATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCA
CGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTT
GGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAG
GAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGT
AATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGT
GCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTT
GATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGC
TTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGC
AAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATG
TCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCG
AGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGG
CTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTT

>In-frame_PUM1_ENST00000426105_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_1673nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAA
AAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCA
GATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCA
CGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTT
GGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAG
GAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGT
AATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGT
GCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTT
GATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGC
TTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGC
AAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATG
TCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCG
AGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGG
CTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTT

>In-frame_PUM1_ENST00000426105_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_1673nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAA
AAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCA
GATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCA
CGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTT
GGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAG
GAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGT
AATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGT
GCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTT
GATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGC
TTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGC
AAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATG
TCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCG
AGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGG
CTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTT

>In-frame_PUM1_ENST00000440538_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_1673nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAA
AAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCA
GATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCA
CGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTT
GGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAG
GAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGT
AATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGT
GCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTT
GATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGC
TTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGC
AAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATG
TCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCG
AGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGG
CTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTT

>In-frame_PUM1_ENST00000440538_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_1673nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAA
AAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCA
GATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCA
CGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTT
GGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAG
GAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGT
AATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGT
GCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTT
GATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGC
TTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGC
AAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATG
TCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCG
AGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGG
CTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTT

>In-frame_PUM1_ENST00000440538_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_1673nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAA
AAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCA
GATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCA
CGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTT
GGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAG
GAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGT
AATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGT
GCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTT
GATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGC
TTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGC
AAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATG
TCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCG
AGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGG
CTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTT

>In-frame_PUM1_ENST00000423018_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_1385nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGGGCCCAAGGGATGCAGAC
AGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAGGAGGAGGGTGATGTGATG
GACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGTAATTGCCAGAACTCTGCT
AATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGTGCCAAGCCTGTGGAGGAT
TTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTTGATTATTCAGGCACGCAG
GTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGCTTCAGAGCAGACACTCCT
TAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGCAAAAGGGGTTTCGGGAGC
AGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATGTCAGTGTCAGCGTGCAGC
CTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCGAGACTGCAGTGTCCAGGC
TTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGGCTCCCCCAGCGCCGCTGG
TAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTTTGGCCAAAAGGAAAGCAA

>In-frame_PUM1_ENST00000423018_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_1385nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGGGCCCAAGGGATGCAGAC
AGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAGGAGGAGGGTGATGTGATG
GACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGTAATTGCCAGAACTCTGCT
AATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGTGCCAAGCCTGTGGAGGAT
TTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTTGATTATTCAGGCACGCAG
GTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGCTTCAGAGCAGACACTCCT
TAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGCAAAAGGGGTTTCGGGAGC
AGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATGTCAGTGTCAGCGTGCAGC
CTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCGAGACTGCAGTGTCCAGGC
TTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGGCTCCCCCAGCGCCGCTGG
TAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTTTGGCCAAAAGGAAAGCAA

>In-frame_PUM1_ENST00000423018_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_1385nt
ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCT
AATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACT
CACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGT
GAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACAT
CAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGGGCCCAAGGGATGCAGAC
AGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAGGAGGAGGGTGATGTGATG
GACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGTAATTGCCAGAACTCTGCT
AATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGTGCCAAGCCTGTGGAGGAT
TTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTTGATTATTCAGGCACGCAG
GTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGCTTCAGAGCAGACACTCCT
TAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGCAAAAGGGGTTTCGGGAGC
AGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATGTCAGTGTCAGCGTGCAGC
CTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCGAGACTGCAGTGTCCAGGC
TTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGGCTCCCCCAGCGCCGCTGG
TAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTTTGGCCAAAAGGAAAGCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PUM1_ENST00000257075_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_1783nt
GGAGTGAAAGGTAAGGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCGTGTTGG
TGGAATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACC
AGCTAATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGG
GACTCACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCA
TGGTGAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGA
ACATCAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGG
TAAAAAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAAC
ATCAGATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTC
CCCACGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGG
ATTTGGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTT
GAAGGAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCC
TGGTAATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAA
TGGTGCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCA
GTTTGATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCG
ATGCTTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAA
AAGCAAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAA
AATGTCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGG
CCCGAGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGAC
TCGGCTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTG

>In-frame_PUM1_ENST00000257075_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_2055nt
GGAGTGAAAGGTAAGGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCGTGTTGG
TGGAATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACC
AGCTAATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGG
GACTCACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCA
TGGTGAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGA
ACATCAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGG
TAAAAAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAAC
ATCAGATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTC
CCCACGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGG
ATTTGGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTT
GAAGGAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCC
TGGTAATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAA
TGGTGCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCA
GTTTGATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCG
ATGCTTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAA
AAGCAAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAA
AATGTCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGG
CCCGAGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGAC
TCGGCTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTG
GCTTTGGCCAAAAGGAAAGCAAAGGCTTGGAGCGACTGTCCACAGATTATTAAGTAAAGAGTGACTCTCACCCATCCCTACTGCCAGTTA
TTGGCTCCTCTCTTGCCCTTTTTATTTATTTATTTTTTATATGGGGTAAAGAAATCAAGCTAGGGAAAAGAAGCATGTTTTATAGGCTCC
AAAATAATGTTTAGAAACTGAACTGGTGGTGTTCATTGTAAAGAGTGGATTTGCACAACCCTAGGTCCTGGTGCCTCGAGCTCCTCCTAG

>In-frame_PUM1_ENST00000257075_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_2588nt
GGAGTGAAAGGTAAGGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCGTGTTGG
TGGAATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACC
AGCTAATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGG
GACTCACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCA
TGGTGAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGA
ACATCAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGG
TAAAAAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAAC
ATCAGATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTC
CCCACGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGG
ATTTGGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTT
GAAGGAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCC
TGGTAATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAA
TGGTGCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCA
GTTTGATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCG
ATGCTTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAA
AAGCAAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAA
AATGTCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGG
CCCGAGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGAC
TCGGCTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTG
GCTTTGGCCAAAAGGAAAGCAAAGGCTTGGAGCGACTGTCCACAGATTATTAAGTAAAGAGTGACTCTCACCCATCCCTACTGCCAGTTA
TTGGCTCCTCTCTTGCCCTTTTTATTTATTTATTTTTTATATGGGGTAAAGAAATCAAGCTAGGGAAAAGAAGCATGTTTTATAGGCTCC
AAAATAATGTTTAGAAACTGAACTGGTGGTGTTCATTGTAAAGAGTGGATTTGCACAACCCTAGGTCCTGGTGCCTCGAGCTCCTCCTAG
TTCTCAAGAGAAAATTCCGTCCACAGGACCACATGAAGCAAAATCTCTAAGCTAAGAACTCGTGAGAGCCTGCCATGCCCATTTCATGGC
CTTGCACACACACCCACCCACACACCATTCAGAACATGTACTTTTGCCAACCTTTGGTAATGGTTTTTTGATTCTATGCACTAATTTTCT
TTGTCCAAAACATTTACTCTACCATATGTCTGGGAATGTTTATCCTTTCTACAGTAATGGTGAAAGGATCATATCTAGCTAAAAGCAAGA
ACACCCATTCTCCTGAATGCAGTGAGTAATTGGGAATCACAAGGAACATTCTGGCACCCAACTGTGCCCATCTTAGTTTTCATGAGTTTT
CCCCACTCTGAAGCTGTAACCCAGAAGGCACATCCATTCACATTTTTACCGCACTGTGGATTCATAGTGTGGGGCCCTGTTATTCCAATA
CCCTCCTTAAGGACATGTGAAGCATTTGGCCCAGTTGGCTCCCAGGGAACATTTTAATTTAATGTAGTGAAGAAAGACAATTCTAGATCA

>In-frame_PUM1_ENST00000373747_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_1789nt
GTTGTCGGAGTGAAAGGTAAGGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCG
TGTTGGTGGAATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCA
AGAACCAGCTAATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGC
AGCTGGGACTCACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAG
GCAGCATGGTGAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCA
TGCAGAACATCAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTT
GCCAGGTAAAAAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTG
GGGAACATCAGATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGT
ACTGTCCCCACGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAA
AGGAGGATTTGGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGG
AGATTTGAAGGAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCG
TACCCCTGGTAATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAG
CACCAATGGTGCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCC
TCTTCAGTTTGATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAG
AAGCCGATGCTTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCA
CTGCAAAAGCAAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCC
AAAGAAAATGTCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAG
AAGAGGCCCGAGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATC
TCCGACTCGGCTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCC

>In-frame_PUM1_ENST00000373747_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_2061nt
GTTGTCGGAGTGAAAGGTAAGGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCG
TGTTGGTGGAATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCA
AGAACCAGCTAATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGC
AGCTGGGACTCACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAG
GCAGCATGGTGAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCA
TGCAGAACATCAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTT
GCCAGGTAAAAAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTG
GGGAACATCAGATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGT
ACTGTCCCCACGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAA
AGGAGGATTTGGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGG
AGATTTGAAGGAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCG
TACCCCTGGTAATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAG
CACCAATGGTGCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCC
TCTTCAGTTTGATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAG
AAGCCGATGCTTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCA
CTGCAAAAGCAAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCC
AAAGAAAATGTCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAG
AAGAGGCCCGAGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATC
TCCGACTCGGCTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCC
TGGCTGGCTTTGGCCAAAAGGAAAGCAAAGGCTTGGAGCGACTGTCCACAGATTATTAAGTAAAGAGTGACTCTCACCCATCCCTACTGC
CAGTTATTGGCTCCTCTCTTGCCCTTTTTATTTATTTATTTTTTATATGGGGTAAAGAAATCAAGCTAGGGAAAAGAAGCATGTTTTATA
GGCTCCAAAATAATGTTTAGAAACTGAACTGGTGGTGTTCATTGTAAAGAGTGGATTTGCACAACCCTAGGTCCTGGTGCCTCGAGCTCC

>In-frame_PUM1_ENST00000373747_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_2594nt
GTTGTCGGAGTGAAAGGTAAGGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCG
TGTTGGTGGAATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCA
AGAACCAGCTAATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGC
AGCTGGGACTCACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAG
GCAGCATGGTGAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCA
TGCAGAACATCAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTT
GCCAGGTAAAAAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTG
GGGAACATCAGATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGT
ACTGTCCCCACGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAA
AGGAGGATTTGGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGG
AGATTTGAAGGAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCG
TACCCCTGGTAATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAG
CACCAATGGTGCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCC
TCTTCAGTTTGATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAG
AAGCCGATGCTTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCA
CTGCAAAAGCAAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCC
AAAGAAAATGTCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAG
AAGAGGCCCGAGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATC
TCCGACTCGGCTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCC
TGGCTGGCTTTGGCCAAAAGGAAAGCAAAGGCTTGGAGCGACTGTCCACAGATTATTAAGTAAAGAGTGACTCTCACCCATCCCTACTGC
CAGTTATTGGCTCCTCTCTTGCCCTTTTTATTTATTTATTTTTTATATGGGGTAAAGAAATCAAGCTAGGGAAAAGAAGCATGTTTTATA
GGCTCCAAAATAATGTTTAGAAACTGAACTGGTGGTGTTCATTGTAAAGAGTGGATTTGCACAACCCTAGGTCCTGGTGCCTCGAGCTCC
TCCTAGTTCTCAAGAGAAAATTCCGTCCACAGGACCACATGAAGCAAAATCTCTAAGCTAAGAACTCGTGAGAGCCTGCCATGCCCATTT
CATGGCCTTGCACACACACCCACCCACACACCATTCAGAACATGTACTTTTGCCAACCTTTGGTAATGGTTTTTTGATTCTATGCACTAA
TTTTCTTTGTCCAAAACATTTACTCTACCATATGTCTGGGAATGTTTATCCTTTCTACAGTAATGGTGAAAGGATCATATCTAGCTAAAA
GCAAGAACACCCATTCTCCTGAATGCAGTGAGTAATTGGGAATCACAAGGAACATTCTGGCACCCAACTGTGCCCATCTTAGTTTTCATG
AGTTTTCCCCACTCTGAAGCTGTAACCCAGAAGGCACATCCATTCACATTTTTACCGCACTGTGGATTCATAGTGTGGGGCCCTGTTATT
CCAATACCCTCCTTAAGGACATGTGAAGCATTTGGCCCAGTTGGCTCCCAGGGAACATTTTAATTTAATGTAGTGAAGAAAGACAATTCT

>In-frame_PUM1_ENST00000426105_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_1780nt
GTGAAAGGTAAGGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCGTGTTGGTGG
AATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGC
TAATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGAC
TCACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGG
TGAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACA
TCAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAA
AAAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATC
AGATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCC
ACGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATT
TGGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAA
GGAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGG
TAATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGG
TGCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTT
TGATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATG
CTTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAG
CAAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAAT
GTCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCC
GAGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCG
GCTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCT

>In-frame_PUM1_ENST00000426105_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_2052nt
GTGAAAGGTAAGGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCGTGTTGGTGG
AATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGC
TAATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGAC
TCACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGG
TGAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACA
TCAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAA
AAAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATC
AGATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCC
ACGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATT
TGGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAA
GGAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGG
TAATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGG
TGCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTT
TGATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATG
CTTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAG
CAAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAAT
GTCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCC
GAGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCG
GCTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCT
TTGGCCAAAAGGAAAGCAAAGGCTTGGAGCGACTGTCCACAGATTATTAAGTAAAGAGTGACTCTCACCCATCCCTACTGCCAGTTATTG
GCTCCTCTCTTGCCCTTTTTATTTATTTATTTTTTATATGGGGTAAAGAAATCAAGCTAGGGAAAAGAAGCATGTTTTATAGGCTCCAAA
ATAATGTTTAGAAACTGAACTGGTGGTGTTCATTGTAAAGAGTGGATTTGCACAACCCTAGGTCCTGGTGCCTCGAGCTCCTCCTAGTTC

>In-frame_PUM1_ENST00000426105_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_2585nt
GTGAAAGGTAAGGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCGTGTTGGTGG
AATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGC
TAATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGAC
TCACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGG
TGAGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACA
TCAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAA
AAAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATC
AGATCATTCAGTTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCC
ACGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATT
TGGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAA
GGAGGAGGGTGATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGG
TAATTGCCAGAACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGG
TGCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTT
TGATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATG
CTTCAGAGCAGACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAG
CAAAAGGGGTTTCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAAT
GTCAGTGTCAGCGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCC
GAGACTGCAGTGTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCG
GCTCCCCCAGCGCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCT
TTGGCCAAAAGGAAAGCAAAGGCTTGGAGCGACTGTCCACAGATTATTAAGTAAAGAGTGACTCTCACCCATCCCTACTGCCAGTTATTG
GCTCCTCTCTTGCCCTTTTTATTTATTTATTTTTTATATGGGGTAAAGAAATCAAGCTAGGGAAAAGAAGCATGTTTTATAGGCTCCAAA
ATAATGTTTAGAAACTGAACTGGTGGTGTTCATTGTAAAGAGTGGATTTGCACAACCCTAGGTCCTGGTGCCTCGAGCTCCTCCTAGTTC
TCAAGAGAAAATTCCGTCCACAGGACCACATGAAGCAAAATCTCTAAGCTAAGAACTCGTGAGAGCCTGCCATGCCCATTTCATGGCCTT
GCACACACACCCACCCACACACCATTCAGAACATGTACTTTTGCCAACCTTTGGTAATGGTTTTTTGATTCTATGCACTAATTTTCTTTG
TCCAAAACATTTACTCTACCATATGTCTGGGAATGTTTATCCTTTCTACAGTAATGGTGAAAGGATCATATCTAGCTAAAAGCAAGAACA
CCCATTCTCCTGAATGCAGTGAGTAATTGGGAATCACAAGGAACATTCTGGCACCCAACTGTGCCCATCTTAGTTTTCATGAGTTTTCCC
CACTCTGAAGCTGTAACCCAGAAGGCACATCCATTCACATTTTTACCGCACTGTGGATTCATAGTGTGGGGCCCTGTTATTCCAATACCC
TCCTTAAGGACATGTGAAGCATTTGGCCCAGTTGGCTCCCAGGGAACATTTTAATTTAATGTAGTGAAGAAAGACAATTCTAGATCAGAG

>In-frame_PUM1_ENST00000440538_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_1769nt
GGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCGTGTTGGTGGAATGAGCGTTG
CATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCTAATCCCAACA
TGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACTCACTCCAGCC
CTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGTGAGCAGCTTG
GGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACATCAGGTGCGTT
CCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAAAAGTTTTGGG
AAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCAGATCATTCAG
TTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCACGATCGGAGA
GTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTTGGCCCAAGGG
ATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAGGAGGAGGGTG
ATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGTAATTGCCAGA
ACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGTGCCAAGCCTG
TGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTTGATTATTCAG
GCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGCTTCAGAGCAG
ACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGCAAAAGGGGTT
TCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATGTCAGTGTCAG
CGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCGAGACTGCAGT
GTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGGCTCCCCCAGC
GCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTTTGGCCAAAAG

>In-frame_PUM1_ENST00000440538_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_2041nt
GGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCGTGTTGGTGGAATGAGCGTTG
CATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCTAATCCCAACA
TGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACTCACTCCAGCC
CTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGTGAGCAGCTTG
GGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACATCAGGTGCGTT
CCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAAAAGTTTTGGG
AAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCAGATCATTCAG
TTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCACGATCGGAGA
GTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTTGGCCCAAGGG
ATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAGGAGGAGGGTG
ATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGTAATTGCCAGA
ACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGTGCCAAGCCTG
TGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTTGATTATTCAG
GCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGCTTCAGAGCAG
ACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGCAAAAGGGGTT
TCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATGTCAGTGTCAG
CGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCGAGACTGCAGT
GTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGGCTCCCCCAGC
GCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTTTGGCCAAAAG
GAAAGCAAAGGCTTGGAGCGACTGTCCACAGATTATTAAGTAAAGAGTGACTCTCACCCATCCCTACTGCCAGTTATTGGCTCCTCTCTT
GCCCTTTTTATTTATTTATTTTTTATATGGGGTAAAGAAATCAAGCTAGGGAAAAGAAGCATGTTTTATAGGCTCCAAAATAATGTTTAG
AAACTGAACTGGTGGTGTTCATTGTAAAGAGTGGATTTGCACAACCCTAGGTCCTGGTGCCTCGAGCTCCTCCTAGTTCTCAAGAGAAAA

>In-frame_PUM1_ENST00000440538_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_2574nt
GGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCGTGTTGGTGGAATGAGCGTTG
CATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCTAATCCCAACA
TGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACTCACTCCAGCC
CTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGTGAGCAGCTTG
GGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACATCAGGTGCGTT
CCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGCAGCTCTTGCCAGGTAAAAAGTTTTGGG
AAACAGATGAATCCAGCAAAGATGGACCAAAAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCAGATCATTCAG
TTTCCCAGCCAATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCACGATCGGAGA
GTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCTGTCTAAGAAAAGGAGGATTTGGCCCAAGGG
ATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAGGAGGAGGGTG
ATGTGATGGACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGTAATTGCCAGA
ACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGTGCCAAGCCTG
TGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTTGATTATTCAG
GCACGCAGGTACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGCTTCAGAGCAG
ACACTCCTTAGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGCAAAAGGGGTT
TCGGGAGCAGCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATGTCAGTGTCAG
CGTGCAGCCTGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCGAGACTGCAGT
GTCCAGGCTTGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGGCTCCCCCAGC
GCCGCTGGTAAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTTTGGCCAAAAG
GAAAGCAAAGGCTTGGAGCGACTGTCCACAGATTATTAAGTAAAGAGTGACTCTCACCCATCCCTACTGCCAGTTATTGGCTCCTCTCTT
GCCCTTTTTATTTATTTATTTTTTATATGGGGTAAAGAAATCAAGCTAGGGAAAAGAAGCATGTTTTATAGGCTCCAAAATAATGTTTAG
AAACTGAACTGGTGGTGTTCATTGTAAAGAGTGGATTTGCACAACCCTAGGTCCTGGTGCCTCGAGCTCCTCCTAGTTCTCAAGAGAAAA
TTCCGTCCACAGGACCACATGAAGCAAAATCTCTAAGCTAAGAACTCGTGAGAGCCTGCCATGCCCATTTCATGGCCTTGCACACACACC
CACCCACACACCATTCAGAACATGTACTTTTGCCAACCTTTGGTAATGGTTTTTTGATTCTATGCACTAATTTTCTTTGTCCAAAACATT
TACTCTACCATATGTCTGGGAATGTTTATCCTTTCTACAGTAATGGTGAAAGGATCATATCTAGCTAAAAGCAAGAACACCCATTCTCCT
GAATGCAGTGAGTAATTGGGAATCACAAGGAACATTCTGGCACCCAACTGTGCCCATCTTAGTTTTCATGAGTTTTCCCCACTCTGAAGC
TGTAACCCAGAAGGCACATCCATTCACATTTTTACCGCACTGTGGATTCATAGTGTGGGGCCCTGTTATTCCAATACCCTCCTTAAGGAC
ATGTGAAGCATTTGGCCCAGTTGGCTCCCAGGGAACATTTTAATTTAATGTAGTGAAGAAAGACAATTCTAGATCAGAGCTACAAGTTCA

>In-frame_PUM1_ENST00000423018_chr1_31465237_-_KIAA1211_ENST00000264229_chr4_57189543_+_1490nt
GAAAGGTAAGGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCGTGTTGGTGGAA
TGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCTA
ATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACTC
ACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGTG
AGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACATC
AGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGGGCCCAAGGGATGCAGACA
GTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAGGAGGAGGGTGATGTGATGG
ACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGTAATTGCCAGAACTCTGCTA
ATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGTGCCAAGCCTGTGGAGGATT
TCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTTGATTATTCAGGCACGCAGG
TACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGCTTCAGAGCAGACACTCCTT
AGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGCAAAAGGGGTTTCGGGAGCA
GCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATGTCAGTGTCAGCGTGCAGCC
TGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCGAGACTGCAGTGTCCAGGCT
TGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGGCTCCCCCAGCGCCGCTGGT
AAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTTTGGCCAAAAGGAAAGCAAA

>In-frame_PUM1_ENST00000423018_chr1_31465237_-_KIAA1211_ENST00000541073_chr4_57189543_+_1762nt
GAAAGGTAAGGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCGTGTTGGTGGAA
TGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCTA
ATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACTC
ACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGTG
AGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACATC
AGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGGGCCCAAGGGATGCAGACA
GTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAGGAGGAGGGTGATGTGATGG
ACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGTAATTGCCAGAACTCTGCTA
ATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGTGCCAAGCCTGTGGAGGATT
TCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTTGATTATTCAGGCACGCAGG
TACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGCTTCAGAGCAGACACTCCTT
AGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGCAAAAGGGGTTTCGGGAGCA
GCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATGTCAGTGTCAGCGTGCAGCC
TGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCGAGACTGCAGTGTCCAGGCT
TGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGGCTCCCCCAGCGCCGCTGGT
AAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTTTGGCCAAAAGGAAAGCAAA
GGCTTGGAGCGACTGTCCACAGATTATTAAGTAAAGAGTGACTCTCACCCATCCCTACTGCCAGTTATTGGCTCCTCTCTTGCCCTTTTT
ATTTATTTATTTTTTATATGGGGTAAAGAAATCAAGCTAGGGAAAAGAAGCATGTTTTATAGGCTCCAAAATAATGTTTAGAAACTGAAC
TGGTGGTGTTCATTGTAAAGAGTGGATTTGCACAACCCTAGGTCCTGGTGCCTCGAGCTCCTCCTAGTTCTCAAGAGAAAATTCCGTCCA

>In-frame_PUM1_ENST00000423018_chr1_31465237_-_KIAA1211_ENST00000504228_chr4_57189543_+_2295nt
GAAAGGTAAGGGGGAGCGAGAGCGCCAGAGAGAGAAGATCGGGGGGCTGAAATCCATCTTCATCCTACCGCTCCGCCCGTGTTGGTGGAA
TGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAACATCACCCTCAAGAACCAGCTA
ATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCAGCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACTC
ACTCCAGCCCTGTCCCAGGATCTATAGGAGTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGTG
AGCAGCTTGGGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCATGCAGAACATC
AGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGAGCGATGGGAGAGGGCCCAAGGGATGCAGACA
GTGATGAAAACGACAAAGGTGAAAAGAAGAACAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAGGAGGAGGGTGATGTGATGG
ACAAGACCAATGGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGTAATTGCCAGAACTCTGCTA
ATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAGCACCAATGGTGCCAAGCCTGTGGAGGATT
TCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATGGAACATGTGGGCATGGAGCCTCTTCAGTTTGATTATTCAGGCACGCAGG
TACCTGTGGACTCAGCAGCAGCAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGAGAAGCCGATGCTTCAGAGCAGACACTCCTT
AGATGGCTCCAAACTTACAGAGAAAGTGGAAACTGCTCAGCCGCTGTGGATAACGTTAGCACTGCAAAAGCAAAAGGGGTTTCGGGAGCA
GCAGGCGACGCGGGAGGAGAGAAAGCAAGCCAGAGAGGCCAAACAGGCAGAAAAGCTCTCCAAAGAAAATGTCAGTGTCAGCGTGCAGCC
TGGAAGCAGCAGTGTCAGCAGAGCAGGTTCCCTGCACAAGTCCACTGCTCTGCCAGAAGAGAAGAGGCCCGAGACTGCAGTGTCCAGGCT
TGAGCGCAGAGAACAGCTGAAAAAGGCCAATACTCTTCCTACGTCTGTGACAGTGGAGATCTCCGACTCGGCTCCCCCAGCGCCGCTGGT
AAAAGAAGTCACCAAGAGGTTTTCCACCCCGGATGCTGCCCCCGTGTCAACAGAACCAGCCTGGCTGGCTTTGGCCAAAAGGAAAGCAAA
GGCTTGGAGCGACTGTCCACAGATTATTAAGTAAAGAGTGACTCTCACCCATCCCTACTGCCAGTTATTGGCTCCTCTCTTGCCCTTTTT
ATTTATTTATTTTTTATATGGGGTAAAGAAATCAAGCTAGGGAAAAGAAGCATGTTTTATAGGCTCCAAAATAATGTTTAGAAACTGAAC
TGGTGGTGTTCATTGTAAAGAGTGGATTTGCACAACCCTAGGTCCTGGTGCCTCGAGCTCCTCCTAGTTCTCAAGAGAAAATTCCGTCCA
CAGGACCACATGAAGCAAAATCTCTAAGCTAAGAACTCGTGAGAGCCTGCCATGCCCATTTCATGGCCTTGCACACACACCCACCCACAC
ACCATTCAGAACATGTACTTTTGCCAACCTTTGGTAATGGTTTTTTGATTCTATGCACTAATTTTCTTTGTCCAAAACATTTACTCTACC
ATATGTCTGGGAATGTTTATCCTTTCTACAGTAATGGTGAAAGGATCATATCTAGCTAAAAGCAAGAACACCCATTCTCCTGAATGCAGT
GAGTAATTGGGAATCACAAGGAACATTCTGGCACCCAACTGTGCCCATCTTAGTTTTCATGAGTTTTCCCCACTCTGAAGCTGTAACCCA
GAAGGCACATCCATTCACATTTTTACCGCACTGTGGATTCATAGTGTGGGGCCCTGTTATTCCAATACCCTCCTTAAGGACATGTGAAGC
ATTTGGCCCAGTTGGCTCCCAGGGAACATTTTAATTTAATGTAGTGAAGAAAGACAATTCTAGATCAGAGCTACAAGTTCACTTTCTGTC


Top

FusionGenePPI for PUM1_KIAA1211


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PUM1ELAVL1, SIRT7, CAND1, ATXN1, LAGE3, CLNS1A, PAICS, ANXA5, HSPB1, VPS26A, SEPHS1, DSTN, SMAD1, ITGA4, EIF5, PRR12, FBXO6, SAV1, YWHAB, AURKB, CDKN1A, CCDC8, BMI1, EGFR, RBFOX2, FBXW11, NTRK1, KIAA0753, XPO1, MATR3, SEC16A, FOXG1, FOXI2, FOXQ1, RC3H1, EYA2, ELAVL2, TRIM11, CELF5, LITAF, CLASRP, TRIM25, G3BP1KIAA1211UBC, CAPZA2, NTRK1, FLNA, MYO19, MYO18A, GLI1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PUM1_KIAA1211


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PUM1_KIAA1211


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource