FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2961

FusionGeneSummary for ASH1L_FAM78B

check button Fusion gene summary
Fusion gene informationFusion gene name: ASH1L_FAM78B
Fusion gene ID: 2961
HgeneTgene
Gene symbol

ASH1L

FAM78B

Gene ID

55870

149297

Gene nameASH1 like histone lysine methyltransferasefamily with sequence similarity 78 member B
SynonymsASH1|ASH1L1|KMT2H|MRD52-
Cytomap

1q22

1q24.1

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase ASH1LASH1-like proteinabsent small and homeotic disks protein 1 homologash1 (absent, small, or homeotic)-likelysine N-methyltransferase 2Hprobable histone-lysine N-methyltransferase ASH1Lprotein FAM78B
Modification date2018051920180519
UniProtAcc

Q9NR48

Q5VT40

Ensembl transtripts involved in fusion geneENST00000368346, ENST00000392403, 
ENST00000548830, 
ENST00000354422, 
ENST00000338353, 
Fusion gene scores* DoF score27 X 14 X 13=49144 X 2 X 4=32
# samples 304
** MAII scorelog2(30/4914*10)=-4.03386345186628
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ASH1L [Title/Abstract] AND FAM78B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneASH1L

GO:0097676

histone H3-K36 dimethylation

26002201


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-AR-A0TT-01AASH1Lchr1

155365250

-FAM78Bchr1

166040000

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000368346ENST00000354422ASH1Lchr1

155365250

-FAM78Bchr1

166040000

-
In-frameENST00000368346ENST00000338353ASH1Lchr1

155365250

-FAM78Bchr1

166040000

-
Frame-shitENST00000392403ENST00000354422ASH1Lchr1

155365250

-FAM78Bchr1

166040000

-
In-frameENST00000392403ENST00000338353ASH1Lchr1

155365250

-FAM78Bchr1

166040000

-
intron-3CDSENST00000548830ENST00000354422ASH1Lchr1

155365250

-FAM78Bchr1

166040000

-
intron-3CDSENST00000548830ENST00000338353ASH1Lchr1

155365250

-FAM78Bchr1

166040000

-

Top

FusionProtFeatures for ASH1L_FAM78B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ASH1L

Q9NR48

FAM78B

Q5VT40

Histone methyltransferase specifically methylating 'Lys-36' of histone H3 (H3K36me). {ECO:0000269|PubMed:21239497}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ASH1L_FAM78B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ASH1L_ENST00000368346_chr1_155365250_-_FAM78B_ENST00000338353_chr1_166040000_-_2208aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAGSQPTSDKPSQRPSESTNCSPTRKRSSSESTSSTVNGVPSRSPRLVASG
DDSVDSLLQRMVQNEDQEPMEKSIDAVIATASAPPSSSPGRSHSKDRTLGKPDSLLVPAVTSDSCNNSISLLSEKLTSSCSPHHIKRSVV
EAMQRQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPLQAVVSMQAFQAAQFVNPELNRDEEGAALHLSP
DTVTDVIEAVVQSVNLNPEHKKGLKRKGWLLEEQTRKKQKPLPEEEEQENNKSFNEAPVEIPSPSETPAKPSEPESTLQPVLSLIPREKK
PPRPPKKKTQKAGLTSDVYKTTDPKSRLIQLKKEKLETTPGEHETGLFPAPIHVGQAGNCLT_GKGE_KPSVTQMG_ATLGTGTPQKL_P
WLAPPTRSPGSPSA_MTTSTPV_HGQCL_VTAMCHCSQESRETKVSRPGWWP_TPPQRRRSFCRPSSGG_GWTLKWTLFSSWGSGPGWWA

>In-frame_ASH1L_ENST00000392403_chr1_155365250_-_FAM78B_ENST00000338353_chr1_166040000_-_2208aa
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEAGKDDGLTDAQQQFSVKETNFSEGNLKLKIG
LQAKRTKKPPKNLENTVCRPAIKTTIKHPRKALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADTINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLGTGTTAGLVSKDLIRKAGVGSVAGIIHKDL
IKKPTISTAVGLVTKDPGKKPVFNAAVGLVNKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKDAINLKAEALLPTQEPLKASCSTNINNQESQ
ELSESLKDSATSKTFEKNVVRQNKESILEKFSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSTETSKHEKQPPVTCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVGKNQFTSESTHLNVGHRSVGHSISIECKGID
KEVNDSKTTHIDIPRISSSLGKKPSLTSESSIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLPKLSKSTAPSLALLADSEKPSHKSFATHKLS
SSMCVSSDLLSDITKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMSDLEMEPDKKITKRNNGQLMKTIIRKINKMK
TLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTITIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPTLHLHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNS
PSHLSELTSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
STDKMKRQKRKRKKKTPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFTTHPSFPLDPLHYIRKPDLKKKR
GRPPKMREAMAEMPFMHSLSFPLSSTGFTPSTGMPYSPSPLTAAPIGLGYTGRTPPTLTPPPPSPSFTTPLPPPSTMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMATGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRTRFGKDAVGERTKH
KEKHRCHMSCPHLSPSKSLINREEQWVHREPSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAGSQPTSDKPSQRPSESTNCSPTRKRSSSESTSSTVNGVPSRSPRLVASG
DDSVDSLLQRMVQNEDQEPMEKSIDAVIATASAPPSSSPGRSHSKDRTLGKPDSLLVPAVTSDSCNNSISLLSEKLTSSCSPHHIKRSVV
EAMQRQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPLQAVVSMQAFQAAQFVNPELNRDEEGAALHLSP
DTVTDVIEAVVQSVNLNPEHKKGLKRKGWLLEEQTRKKQKPLPEEEEQENNKSFNEAPVEIPSPSETPAKPSEPESTLQPVLSLIPREKK
PPRPPKKKTQKAGLTSDVYKTTDPKSRLIQLKKEKLETTPGEHETGLFPAPIHVGQAGNCLT_GKGE_KPSVTQMG_ATLGTGTPQKL_P
WLAPPTRSPGSPSA_MTTSTPV_HGQCL_VTAMCHCSQESRETKVSRPGWWP_TPPQRRRSFCRPSSGG_GWTLKWTLFSSWGSGPGWWA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ASH1L_ENST00000368346_chr1_155365250_-_FAM78B_ENST00000338353_chr1_166040000_-_6626nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGGCTCCCAGCCAACCTCTGATAAACCCTCCCAGCGGCCATCAGAGAGCACAAATTGT
AGCCCTACCCGGAAAAGGTCTTCATCTGAGAGTACTTCTTCAACAGTAAACGGAGTTCCCTCTCGAAGTCCAAGATTAGTTGCTTCTGGG
GATGACTCTGTGGATAGTCTGCTGCAGCGGATGGTACAAAATGAGGACCAAGAGCCCATGGAGAAAAGTATTGATGCTGTGATTGCAACT
GCCTCTGCACCACCTTCTTCCAGTCCAGGCCGTAGCCACAGCAAGGACCGAACCCTGGGAAAACCAGACAGCCTTTTAGTGCCTGCAGTC
ACAAGTGACTCTTGCAATAATAGCATCTCACTCCTATCTGAAAAGTTGACAAGCAGCTGTTCCCCCCATCATATCAAGAGAAGTGTAGTG
GAAGCTATGCAACGCCAAGCTCGGAAAATGTGCAATTACGACAAAATCTTGGCCACAAAGAAAAACCTAGACCATGTCAATAAAATCTTA
AAAGCCAAAAAACTTCAAAGGCAGGCCAGGACAGGGAATAACTTTGTGAAACGTAGGCCAGGTCGACCTCGGAAATGTCCCCTTCAGGCT
GTCGTATCAATGCAAGCATTCCAGGCTGCTCAGTTTGTCAACCCAGAATTGAACAGAGACGAGGAAGGAGCAGCACTGCACCTCAGTCCT
GACACAGTTACAGATGTAATTGAGGCTGTTGTTCAGAGTGTAAATCTGAACCCAGAACATAAAAAGGGGTTGAAGAGAAAAGGTTGGCTA
TTGGAAGAACAGACCAGAAAAAAGCAGAAGCCATTACCAGAGGAAGAAGAGCAAGAGAATAATAAAAGCTTTAATGAAGCACCAGTTGAG
ATTCCCAGTCCTTCTGAAACCCCAGCTAAACCTTCTGAACCTGAAAGTACCTTGCAGCCTGTGCTTTCTCTCATCCCAAGGGAAAAGAAG
CCCCCACGTCCCCCAAAGAAGAAGTATCAGAAAGCAGGGCTGTATTCTGACGTTTACAAAACTACAGACCCAAAGAGTCGATTGATCCAA
TTAAAGAAAGAGAAGCTGGAGTATACTCCAGGAGAGCATGAATATGGATTATTTCCAGCGCCCATTCATGTTGGTCAAGCTGGGAACTGC
CTGACTTGAGGGAAGGGAGAGTAAAAGCCATCAGTGACTCAGATGGGGTGAGCTACCCTTGGTACGGGAACACCACAGAAACTGTGACCC
TGGTTGGCCCCACCAACAAGATCTCCAGGTTCTCCGTCAGCATGAATGACAACTTCTACCCCAGTGTGACATGGGCAGTGCCTGTGAGTG
ACAGCAATGTGCCACTGCTCACAAGAATCAAGAGAGACCAAAGTTTCACGACCTGGCTGGTGGCCATGAACACCACCACAAAGGAGAAGA
TCATTCTGCAGACCATCAAGTGGAGGATGAGGGTGGACATTGAAGTGGACCCTCTTCAGCTCTTGGGGCAGCGGGCCCGGCTGGTGGGCA
GGACTCAGCAGGAGCAGCCCCGGATCCTGAGCCGGATGGAACCCATCCCCCCTAATGCACTAGTGAAACCCAATGCCAATGATGCCCAGG

>In-frame_ASH1L_ENST00000392403_chr1_155365250_-_FAM78B_ENST00000338353_chr1_166040000_-_6626nt
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAGTACTGGCACA
TTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATTGAAAATTGGC
CTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAAGAAAGCAGAT
GATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAGAGCATTACTT
AATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACATAAGGACTTA
ATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAACTATCACTACA
GTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTGTGCAAAGAAG
ATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCAGGAAAGTCAG
GAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTCATCCAGTGAA
AAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTTAACCAGAAGT
CCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAAAGGGATTGAT
AAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGTATCTGCATCA
GACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATGTAGCTCACTA
TCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCACAAACTATCC
TCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAATTTTACAGCCA
GAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGACAACCATAGA
AGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAATAAAATGAAG
ACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATATAGGAAAGAGA
AGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTATTTGCTCTCAG
TCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTTGCCAAATTCT
CCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTTTGAGCATGTT
TCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTTTATTGCAGAG
CTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAAAAAGAAAAGA
GGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCACTCTTTATCCA
CCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCCCAGTGTTCCT
CCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCGATATAAGCAT
AAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATCCCTTGGAGGA
TTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAAGGAGTCACTG
CCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGGCTCCCAGCCAACCTCTGATAAACCCTCCCAGCGGCCATCAGAGAGCACAAATTGT
AGCCCTACCCGGAAAAGGTCTTCATCTGAGAGTACTTCTTCAACAGTAAACGGAGTTCCCTCTCGAAGTCCAAGATTAGTTGCTTCTGGG
GATGACTCTGTGGATAGTCTGCTGCAGCGGATGGTACAAAATGAGGACCAAGAGCCCATGGAGAAAAGTATTGATGCTGTGATTGCAACT
GCCTCTGCACCACCTTCTTCCAGTCCAGGCCGTAGCCACAGCAAGGACCGAACCCTGGGAAAACCAGACAGCCTTTTAGTGCCTGCAGTC
ACAAGTGACTCTTGCAATAATAGCATCTCACTCCTATCTGAAAAGTTGACAAGCAGCTGTTCCCCCCATCATATCAAGAGAAGTGTAGTG
GAAGCTATGCAACGCCAAGCTCGGAAAATGTGCAATTACGACAAAATCTTGGCCACAAAGAAAAACCTAGACCATGTCAATAAAATCTTA
AAAGCCAAAAAACTTCAAAGGCAGGCCAGGACAGGGAATAACTTTGTGAAACGTAGGCCAGGTCGACCTCGGAAATGTCCCCTTCAGGCT
GTCGTATCAATGCAAGCATTCCAGGCTGCTCAGTTTGTCAACCCAGAATTGAACAGAGACGAGGAAGGAGCAGCACTGCACCTCAGTCCT
GACACAGTTACAGATGTAATTGAGGCTGTTGTTCAGAGTGTAAATCTGAACCCAGAACATAAAAAGGGGTTGAAGAGAAAAGGTTGGCTA
TTGGAAGAACAGACCAGAAAAAAGCAGAAGCCATTACCAGAGGAAGAAGAGCAAGAGAATAATAAAAGCTTTAATGAAGCACCAGTTGAG
ATTCCCAGTCCTTCTGAAACCCCAGCTAAACCTTCTGAACCTGAAAGTACCTTGCAGCCTGTGCTTTCTCTCATCCCAAGGGAAAAGAAG
CCCCCACGTCCCCCAAAGAAGAAGTATCAGAAAGCAGGGCTGTATTCTGACGTTTACAAAACTACAGACCCAAAGAGTCGATTGATCCAA
TTAAAGAAAGAGAAGCTGGAGTATACTCCAGGAGAGCATGAATATGGATTATTTCCAGCGCCCATTCATGTTGGTCAAGCTGGGAACTGC
CTGACTTGAGGGAAGGGAGAGTAAAAGCCATCAGTGACTCAGATGGGGTGAGCTACCCTTGGTACGGGAACACCACAGAAACTGTGACCC
TGGTTGGCCCCACCAACAAGATCTCCAGGTTCTCCGTCAGCATGAATGACAACTTCTACCCCAGTGTGACATGGGCAGTGCCTGTGAGTG
ACAGCAATGTGCCACTGCTCACAAGAATCAAGAGAGACCAAAGTTTCACGACCTGGCTGGTGGCCATGAACACCACCACAAAGGAGAAGA
TCATTCTGCAGACCATCAAGTGGAGGATGAGGGTGGACATTGAAGTGGACCCTCTTCAGCTCTTGGGGCAGCGGGCCCGGCTGGTGGGCA
GGACTCAGCAGGAGCAGCCCCGGATCCTGAGCCGGATGGAACCCATCCCCCCTAATGCACTAGTGAAACCCAATGCCAATGATGCCCAGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ASH1L_ENST00000368346_chr1_155365250_-_FAM78B_ENST00000338353_chr1_166040000_-_7487nt
CGCGTACGGGCTGGCTGGCGCGCGGGGCGGCCGAAGGTGGTGGTTGGTGGGAGCAGCCAGCGACGAGCCCGTAGACACTCGTACGCGTGC
GGGCGGGCGTGCGCGCTACGCGGACGGAGTCGGGCGGAGCGGGGGACGGTGGGAAAGAACGCAAGGAGGAAGGAGTGGAAGGTTGAGGGG
GGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCCGCCGCCGCCGCCGCCGCTC
CCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCTCAGTTTGCCCCCTTTAGCC
TTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCCGTGGAC
CCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCTCGGCCTCGGCCTCCGACAC
GAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATAAGATTCCTTGGCAATAACA
TACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAAAGAGTCCTTCTGCCATCAG
TACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAA
CATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTTCAGAGGGAAATTTAAAATT
GAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAA
GCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAGACCCTTCAAAGTTGTACAA
GAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAA
GCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGGATCCTGATTTAAAGGACAG
AGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACC
GAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCTCTGTAGCTGGAATAATACA
TAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGT
AGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACTTAGGCAAAAAGCCAGGAAC
TATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAA
GAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTGGCCTAGTGGCCAAGGACTG
TGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGAT
CAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTAGTACAAACATCAATAATCA
GGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCAT
ATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCATTCAGCAAGACAGTTTCTC
ATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGC
TTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTACTGTATCTGTTAATCCTTT
AACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGA
ATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATAGTATAAGTATTGAATGTAA
AGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGAC
TTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTTTTTTAAAACTGGGTGCAGT
ATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACC
TCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGCTTTTTAAAAACGTTTCATG
TAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACG
CCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTCATAAGTCTTTTGCTACTCA
CAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCC
TCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGGAAGAACAAGAACCCCCAAT
TTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAAT
GAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCAAGCTAGAATCTGAAAGTGA
CAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTG
TAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAACAATTATCCGCAAAATAAA
TAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAA
ACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCAAGAAAGGAACCATTTATAT
AGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGC
TCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTGAGATTCTTCCATCACCTAT
TTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCA
TTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGTTATCTCCTCCTACTTTGTT
GCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCAT
TCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAAAAAAGAGGAGGCATTCTTT
TGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCA
TGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAAATAGACAGGATCCAGACTT
TATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCC
AACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACATTCGAAAACCTGACTTAAA
AAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGG
ATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACTATGGAAGGTATCCTCCCAC
TCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGC
CAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCCTTTCCATGAGTACCTACCC
CAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACA
ACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAAAGGATGCTGTTGGAGAGCG
ATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGT
CCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAGAAAGTTCTCCAAGCTTATC
CCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTC
AAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCACTAAATCGGCTTCACAGAAA
GGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGGCTCCCAGCCAACCTCTGATAAACCCTCCCAGCGGCCATCAGAGAG
CACAAATTGTAGCCCTACCCGGAAAAGGTCTTCATCTGAGAGTACTTCTTCAACAGTAAACGGAGTTCCCTCTCGAAGTCCAAGATTAGT
TGCTTCTGGGGATGACTCTGTGGATAGTCTGCTGCAGCGGATGGTACAAAATGAGGACCAAGAGCCCATGGAGAAAAGTATTGATGCTGT
GATTGCAACTGCCTCTGCACCACCTTCTTCCAGTCCAGGCCGTAGCCACAGCAAGGACCGAACCCTGGGAAAACCAGACAGCCTTTTAGT
GCCTGCAGTCACAAGTGACTCTTGCAATAATAGCATCTCACTCCTATCTGAAAAGTTGACAAGCAGCTGTTCCCCCCATCATATCAAGAG
AAGTGTAGTGGAAGCTATGCAACGCCAAGCTCGGAAAATGTGCAATTACGACAAAATCTTGGCCACAAAGAAAAACCTAGACCATGTCAA
TAAAATCTTAAAAGCCAAAAAACTTCAAAGGCAGGCCAGGACAGGGAATAACTTTGTGAAACGTAGGCCAGGTCGACCTCGGAAATGTCC
CCTTCAGGCTGTCGTATCAATGCAAGCATTCCAGGCTGCTCAGTTTGTCAACCCAGAATTGAACAGAGACGAGGAAGGAGCAGCACTGCA
CCTCAGTCCTGACACAGTTACAGATGTAATTGAGGCTGTTGTTCAGAGTGTAAATCTGAACCCAGAACATAAAAAGGGGTTGAAGAGAAA
AGGTTGGCTATTGGAAGAACAGACCAGAAAAAAGCAGAAGCCATTACCAGAGGAAGAAGAGCAAGAGAATAATAAAAGCTTTAATGAAGC
ACCAGTTGAGATTCCCAGTCCTTCTGAAACCCCAGCTAAACCTTCTGAACCTGAAAGTACCTTGCAGCCTGTGCTTTCTCTCATCCCAAG
GGAAAAGAAGCCCCCACGTCCCCCAAAGAAGAAGTATCAGAAAGCAGGGCTGTATTCTGACGTTTACAAAACTACAGACCCAAAGAGTCG
ATTGATCCAATTAAAGAAAGAGAAGCTGGAGTATACTCCAGGAGAGCATGAATATGGATTATTTCCAGCGCCCATTCATGTTGGTCAAGC
TGGGAACTGCCTGACTTGAGGGAAGGGAGAGTAAAAGCCATCAGTGACTCAGATGGGGTGAGCTACCCTTGGTACGGGAACACCACAGAA
ACTGTGACCCTGGTTGGCCCCACCAACAAGATCTCCAGGTTCTCCGTCAGCATGAATGACAACTTCTACCCCAGTGTGACATGGGCAGTG
CCTGTGAGTGACAGCAATGTGCCACTGCTCACAAGAATCAAGAGAGACCAAAGTTTCACGACCTGGCTGGTGGCCATGAACACCACCACA
AAGGAGAAGATCATTCTGCAGACCATCAAGTGGAGGATGAGGGTGGACATTGAAGTGGACCCTCTTCAGCTCTTGGGGCAGCGGGCCCGG
CTGGTGGGCAGGACTCAGCAGGAGCAGCCCCGGATCCTGAGCCGGATGGAACCCATCCCCCCTAATGCACTAGTGAAACCCAATGCCAAT
GATGCCCAGGTCCTCATGTGGAGGCCCAAGCGGGGGCCACCTCTGGTTGTGATCCCTCCTAAGTAGAAGCAGACTGGCCTGACTGTGTGT
GGATCACACGCCTCTGAGACATGCAGTGAGGGTGCCAGGGGTGGCAGGAGCCAAACAGAGTTTCTGAGCCAAAGCAGACCTCTCGGTTTG
CCAGCCTTTGCAGCCACTTTTGAAGAGTAGGGCTGCTCCTTGGGTGGTAGAACCATAATCCTTAGGAAAAATCCCTTCCTCTTAGGAATA

>In-frame_ASH1L_ENST00000392403_chr1_155365250_-_FAM78B_ENST00000338353_chr1_166040000_-_7326nt
GGAGTGGAAGGTTGAGGGGGGCGCTAGGCGCCCTTCGCTCCCTCCCTCTGGAGGAGCTGCCGCCGCCACCGCCGCCACTCTGCTGCTGCC
GCCGCCGCCGCCGCCGCTCCCGCCGCCATTTTGGGTTCGCTTTGCGGAGGGGAGACGATCCCAGTCTCGGTTGCGGGACCCGCCTCCCCT
CAGTTTGCCCCCTTTAGCCTTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCAGCTTACCCGCTGGCCGCCTCCTGACAAGCG
GGAGGGATCCGCCGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCCCACTTCCCTGCACTCTCATCGCTCTCGGCCT
CGGCCTCGGCCTCCGACACGAGAAAGATGCTGGTTTCGAGTTTTGGAGATCCTTGTTTTTTATGGAACACAGTTCTGTAAAATTTTCATA
AGATTCCTTGGCAATAACATACGCTTGTGATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGAA
AGAGTCCTTCTGCCATCAGTACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAAAAAAACACAAAGGAGGAAGAGGACCTTCGCA
AACGGAATCGAGAAAGAAACATCGAAGCTGGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTTT
CAGAGGGAAATTTAAAATTGAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCAAAGAACTTGGAGAACTATGTATGTCGACCTG
CCATAAAAACAACTATTAAGCACCCAAGGAAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGAG
ACCCTTCAAAGTTGTACAAGAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAAGAAGTCATCCGTCTTCATTCACAGGGAGAAA
ACAATCCTTTGTCTAAGAAGCTGTCTCCAGTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGGG
ATCCTGATTTAAAGGACAGAGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTGGCACAGCTGATTGCTACCTGTCCTCCTTCCA
AGTCTTCCAAGACAAAACCGAAGAAGTTAGGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGCT
CTGTAGCTGGAATAATACATAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTTGGATTGGTAACTAAAGATCCTGGGAAAAAGC
CAGTGTTTAATGCAGCAGTAGGATTGGTCAATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAACT
TAGGCAAAAAGCCAGGAACTATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAGAAGCTAGGAATTGGTATTGTTCCAGGTTTAG
TGCATAAAGAGTCTGGCAAGAAGTTAGGACTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTTG
GCCTAGTGGCCAAGGACTGTGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTTAATAAGGACATTGGAAAGAAACTAATGAGTT
GTCCTTTGGCAGGTCTGATCAGTAAAGATGCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGTA
GTACAAACATCAATAATCAGGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCCACCAGCAAAACTTTTGAAAAGAATGTTGTAC
GGCAGAATAAAGAAAGCATATTGGAAAAGTTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGCA
TTCAGCAAGACAGTTTCTCATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAAAAGCAGCCTCCTGTATATTGCACTTCTCCGG
ACTTTAAAATGGGAGGTGCTTCTGATGTATCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCTA
CTGTATCTGTTAATCCTTTAACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCTAATCCATTACTTTTAAGTTCTACTACAGAAC
TAATCGAAGAAATTTCTGAATCTGTTGGAAAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCATA
GTATAAGTATTGAATGTAAAGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCATATAGATATTCCAAGAATAAGCTCTTCCCTTG
GAAAAAAGCCAAGTTTGACTTCTGAATCCAGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCTT
TTTTAAAACTGGGTGCAGTATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTAAGTACTAGTTTGCAGTCCAAACCATTAAAAA
AAAGAAAAGGAAGAAAACCTCGGTGGACTAAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAGC
TTTTTAAAAACGTTTCATGTAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTTATGAAAAACATTGGACCCCCTTCATTTGTAG
ATCATGACTTCCTTAAACGCCGATTGCCAAAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCTC
ATAAGTCTTTTGCTACTCACAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTGTCTGATATTTATAAGCCCAAAAGAGGAAGGC
CTAAATCTAAGGAGATGCCTCAACTGGAAGGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAGG
AAGAACAAGAACCCCCAATTTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGTCTGTCTGTGTCTCCTTTTCCAAAAAAGAGAG
GCAGGCCTAAGAGGCAAATGAGGTCACCAGTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGCA
AGCTAGAATCTGAAAGTGACAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGATCAACTTCAGGATCCAGATGACCTAGATGACA
GTCATAGGCCAAGTGTCTGTAGTATGAGTGACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAAA
CAATTATCCGCAAAATAAATAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAGATTCTTTCAAGTTCTGTAGAATCAAGTAATA
AAGGGAAAGTGCAATCCAAACTCCATAATACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGCA
AGAAAGGAACCATTTATATAGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAATGGTATTCTTTCTGGTAGTCCTACTAGCCTTG
CTGTTCTTGAGCAAACAGCTCAACAGGCAGCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCTG
AGATTCTTCCATCACCTATTTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCTGTAAGTAGTGATGCAGGTTTTGTTGAACCCA
GTTCAGTGCCATATTTGCATTTACACTCCAGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGGT
TATCTCCTCCTACTTTGTTGCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTAAAAGAAGCTACTCCTTCCCCAATCAGTGAGT
CTCATAGTGATGAGACCATTCCCAGTGATAGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAAA
AAAAGAGGAGGCATTCTTTTGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTGCTAAGCAGTCTTAAAGAAAAACATAAACACA
AATGTAAGCGCAGGAATCATGATTACCTCAGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGAA
ATAGACAGGATCCAGACTTTATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAAATTCGGATCACTCATCGAAGTCATCATTTTA
TCCCCCGAGATCTTCTGCCAACTATCTTTCGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTACA
TTCGAAAACCTGACTTAAAAAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATGGCTGAAATGCCTTTTATGCACAGCCTTAGTT
TTCCTCTTTCTAGTACTGGATTCTATCCATCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTACT
ATGGAAGGTATCCTCCCACTCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCACTTCCACCTCCTTCCTATATGCATGCTGGTC
ATTTACTTCTCAATCCTGCCAAATACCATAAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTCC
TTTCCATGAGTACCTACCCCAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAGCACAAACACAGGCACCGTCACAAACACAGAG
AACACCGTTCTTCTGAACAACCCCAGGTTTCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGAA
AGGATGCTGTTGGAGAGCGATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGCCCTCATCTCTCTCCTTCAAAAAGCTTAATAA
ACAGAGAGGAACAGTGGGTCCACCGAGAGCCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCAG
AAAGTTCTCCAAGCTTATCCCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGTGATGAACATACAAACCTTTTCACAAGTGCAA
TAGGCAGCTGCAGAGTTTCAAACCCTAACTCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCAC
TAAATCGGCTTCACAGAAAGGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTGGCAGGCTCCCAGCCAACCTCTGATAAACCCT
CCCAGCGGCCATCAGAGAGCACAAATTGTAGCCCTACCCGGAAAAGGTCTTCATCTGAGAGTACTTCTTCAACAGTAAACGGAGTTCCCT
CTCGAAGTCCAAGATTAGTTGCTTCTGGGGATGACTCTGTGGATAGTCTGCTGCAGCGGATGGTACAAAATGAGGACCAAGAGCCCATGG
AGAAAAGTATTGATGCTGTGATTGCAACTGCCTCTGCACCACCTTCTTCCAGTCCAGGCCGTAGCCACAGCAAGGACCGAACCCTGGGAA
AACCAGACAGCCTTTTAGTGCCTGCAGTCACAAGTGACTCTTGCAATAATAGCATCTCACTCCTATCTGAAAAGTTGACAAGCAGCTGTT
CCCCCCATCATATCAAGAGAAGTGTAGTGGAAGCTATGCAACGCCAAGCTCGGAAAATGTGCAATTACGACAAAATCTTGGCCACAAAGA
AAAACCTAGACCATGTCAATAAAATCTTAAAAGCCAAAAAACTTCAAAGGCAGGCCAGGACAGGGAATAACTTTGTGAAACGTAGGCCAG
GTCGACCTCGGAAATGTCCCCTTCAGGCTGTCGTATCAATGCAAGCATTCCAGGCTGCTCAGTTTGTCAACCCAGAATTGAACAGAGACG
AGGAAGGAGCAGCACTGCACCTCAGTCCTGACACAGTTACAGATGTAATTGAGGCTGTTGTTCAGAGTGTAAATCTGAACCCAGAACATA
AAAAGGGGTTGAAGAGAAAAGGTTGGCTATTGGAAGAACAGACCAGAAAAAAGCAGAAGCCATTACCAGAGGAAGAAGAGCAAGAGAATA
ATAAAAGCTTTAATGAAGCACCAGTTGAGATTCCCAGTCCTTCTGAAACCCCAGCTAAACCTTCTGAACCTGAAAGTACCTTGCAGCCTG
TGCTTTCTCTCATCCCAAGGGAAAAGAAGCCCCCACGTCCCCCAAAGAAGAAGTATCAGAAAGCAGGGCTGTATTCTGACGTTTACAAAA
CTACAGACCCAAAGAGTCGATTGATCCAATTAAAGAAAGAGAAGCTGGAGTATACTCCAGGAGAGCATGAATATGGATTATTTCCAGCGC
CCATTCATGTTGGTCAAGCTGGGAACTGCCTGACTTGAGGGAAGGGAGAGTAAAAGCCATCAGTGACTCAGATGGGGTGAGCTACCCTTG
GTACGGGAACACCACAGAAACTGTGACCCTGGTTGGCCCCACCAACAAGATCTCCAGGTTCTCCGTCAGCATGAATGACAACTTCTACCC
CAGTGTGACATGGGCAGTGCCTGTGAGTGACAGCAATGTGCCACTGCTCACAAGAATCAAGAGAGACCAAAGTTTCACGACCTGGCTGGT
GGCCATGAACACCACCACAAAGGAGAAGATCATTCTGCAGACCATCAAGTGGAGGATGAGGGTGGACATTGAAGTGGACCCTCTTCAGCT
CTTGGGGCAGCGGGCCCGGCTGGTGGGCAGGACTCAGCAGGAGCAGCCCCGGATCCTGAGCCGGATGGAACCCATCCCCCCTAATGCACT
AGTGAAACCCAATGCCAATGATGCCCAGGTCCTCATGTGGAGGCCCAAGCGGGGGCCACCTCTGGTTGTGATCCCTCCTAAGTAGAAGCA
GACTGGCCTGACTGTGTGTGGATCACACGCCTCTGAGACATGCAGTGAGGGTGCCAGGGGTGGCAGGAGCCAAACAGAGTTTCTGAGCCA
AAGCAGACCTCTCGGTTTGCCAGCCTTTGCAGCCACTTTTGAAGAGTAGGGCTGCTCCTTGGGTGGTAGAACCATAATCCTTAGGAAAAA


Top

FusionGenePPI for ASH1L_FAM78B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ASH1LHIST1H3A, H3F3A, SMAD7, THAP7, MORF4L1, PARD6A, SIKE1, MORF4L2, NXF2, CDX1FAM78BRPS27A, MAD2L2, ANKRD13D, VPS13C, FRYL


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ASH1L_FAM78B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ASH1L_FAM78B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneASH1LC0023903Liver neoplasms1CTD_human