FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29536

FusionGeneSummary for PTPRK_EYS

check button Fusion gene summary
Fusion gene informationFusion gene name: PTPRK_EYS
Fusion gene ID: 29536
HgeneTgene
Gene symbol

PTPRK

EYS

Gene ID

5796

346007

Gene nameprotein tyrosine phosphatase, receptor type Keyes shut homolog (Drosophila)
SynonymsR-PTP-kappaC6orf178|C6orf179|C6orf180|EGFL10|EGFL11|RP25|SPAM|bA166P24.2|bA307F22.3|bA74E24.1|dJ1018A4.2|dJ22I17.2|dJ303F19.1
Cytomap

6q22.33

6q12

Type of geneprotein-codingprotein-coding
Descriptionreceptor-type tyrosine-protein phosphatase kappadJ480J14.2.1 (protein tyrosine phosphatase, receptor type, K (R-PTP-KAPPA, protein tyrosine phosphatase kappa , protein tyrosine phosphatase kappaprotein-tyrosine phosphatase kappaprotein-tyrosine phosphaprotein eyes shut homologEGF-like-domain, multiple 10EGF-like-domain, multiple 11epidermal growth factor-like protein 10epidermal growth factor-like protein 11protein spacemaker homolog
Modification date2018051920180519
UniProtAcc

Q15262

Q5T1H1

Ensembl transtripts involved in fusion geneENST00000368226, ENST00000368227, 
ENST00000532331, ENST00000368213, 
ENST00000368210, ENST00000368215, 
ENST00000368207, ENST00000524481, 
ENST00000525459, 
ENST00000503581, 
ENST00000370621, ENST00000370616, 
ENST00000393380, ENST00000342421, 
ENST00000370618, ENST00000486069, 
Fusion gene scores* DoF score26 X 12 X 13=405626 X 15 X 12=4680
# samples 3427
** MAII scorelog2(34/4056*10)=-3.57645100086564
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(27/4680*10)=-4.11547721741994
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PTPRK [Title/Abstract] AND EYS [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePTPRK

GO:0006470

protein dephosphorylation

16263724

HgenePTPRK

GO:0007165

signal transduction

16849327

HgenePTPRK

GO:0007179

transforming growth factor beta receptor signaling pathway

15899872

HgenePTPRK

GO:0008285

negative regulation of cell proliferation

15899872|18276111

HgenePTPRK

GO:0010839

negative regulation of keratinocyte proliferation

16263724

HgenePTPRK

GO:0030336

negative regulation of cell migration

18276111

HgenePTPRK

GO:0034394

protein localization to cell surface

18276111

HgenePTPRK

GO:0034614

cellular response to reactive oxygen species

16849327

HgenePTPRK

GO:0034644

cellular response to UV

16849327

HgenePTPRK

GO:0045786

negative regulation of cell cycle

15899872

HgenePTPRK

GO:0045892

negative regulation of transcription, DNA-templated

18276111


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCECTCGA-AJ-A3IA-01APTPRKchr6

128841404

-EYSchr6

65303202

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000368226ENST00000503581PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368226ENST00000370621PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368226ENST00000370616PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368226ENST00000393380PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368226ENST00000342421PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368226ENST00000370618PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368226ENST00000486069PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368227ENST00000503581PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368227ENST00000370621PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368227ENST00000370616PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368227ENST00000393380PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368227ENST00000342421PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368227ENST00000370618PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368227ENST00000486069PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000532331ENST00000503581PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000532331ENST00000370621PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000532331ENST00000370616PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000532331ENST00000393380PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000532331ENST00000342421PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000532331ENST00000370618PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000532331ENST00000486069PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368213ENST00000503581PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368213ENST00000370621PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368213ENST00000370616PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368213ENST00000393380PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368213ENST00000342421PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368213ENST00000370618PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368213ENST00000486069PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368210ENST00000503581PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368210ENST00000370621PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368210ENST00000370616PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368210ENST00000393380PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368210ENST00000342421PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368210ENST00000370618PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368210ENST00000486069PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368215ENST00000503581PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368215ENST00000370621PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368215ENST00000370616PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368215ENST00000393380PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368215ENST00000342421PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368215ENST00000370618PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368215ENST00000486069PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368207ENST00000503581PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368207ENST00000370621PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000368207ENST00000370616PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368207ENST00000393380PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368207ENST00000342421PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368207ENST00000370618PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000368207ENST00000486069PTPRKchr6

128841404

-EYSchr6

65303202

-
5UTR-3CDSENST00000524481ENST00000503581PTPRKchr6

128841404

-EYSchr6

65303202

-
5UTR-3CDSENST00000524481ENST00000370621PTPRKchr6

128841404

-EYSchr6

65303202

-
5UTR-3CDSENST00000524481ENST00000370616PTPRKchr6

128841404

-EYSchr6

65303202

-
5UTR-intronENST00000524481ENST00000393380PTPRKchr6

128841404

-EYSchr6

65303202

-
5UTR-intronENST00000524481ENST00000342421PTPRKchr6

128841404

-EYSchr6

65303202

-
5UTR-intronENST00000524481ENST00000370618PTPRKchr6

128841404

-EYSchr6

65303202

-
5UTR-intronENST00000524481ENST00000486069PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000525459ENST00000503581PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000525459ENST00000370621PTPRKchr6

128841404

-EYSchr6

65303202

-
In-frameENST00000525459ENST00000370616PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000525459ENST00000393380PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000525459ENST00000342421PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000525459ENST00000370618PTPRKchr6

128841404

-EYSchr6

65303202

-
5CDS-intronENST00000525459ENST00000486069PTPRKchr6

128841404

-EYSchr6

65303202

-

Top

FusionProtFeatures for PTPRK_EYS


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTPRK

Q15262

EYS

Q5T1H1

Regulation of processes involving cell contact andadhesion such as growth control, tumor invasion, and metastasis.Negative regulator of EGFR signaling pathway. Forms complexes withbeta-catenin and gamma-catenin/plakoglobin. Beta-catenin may be asubstrate for the catalytic activity of PTPRK/PTP-kappa.{ECO:0000269|PubMed:19836242}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-091004_1040-111595DomainEGF-like 16%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-091042_1077-111595DomainEGF-like 17
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-091079_1115-111595DomainEGF-like 18
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-091117_1159-111595DomainEGF-like 19
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-091161_1197-111595DomainEGF-like 20%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09170_212-111595DomainEGF-like 1
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-091883_2063-111595DomainLaminin G-like 1
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-092099_2140-111595DomainEGF-like 21
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09213_254-111595DomainEGF-like 2
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-092145_2339-111595DomainLaminin G-like 2
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-092335_2368-111595DomainEGF-like 22
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-092371_2408-111595DomainEGF-like 23
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-092419_2609-111595DomainLaminin G-like 3
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09256_292-111595DomainEGF-like 3
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-092610_2646-111595DomainEGF-like 24
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-092648_2689-111595DomainEGF-like 25
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-092717_2895-111595DomainLaminin G-like 4
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-092896_2932-111595DomainEGF-like 26
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-092933_2970-111595DomainEGF-like 27
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-092975_3165-111595DomainLaminin G-like 5
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09332_368-111595DomainEGF-like 4
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09370_406-111595DomainEGF-like 5
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09567_602-111595DomainEGF-like 6
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09643_679-111595DomainEGF-like 7
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09681_720-111595DomainEGF-like 8%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09733_769-111595DomainEGF-like 9%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09771_807-111595DomainEGF-like 10%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09809_847-111595DomainEGF-like 11
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09849_888-111595DomainEGF-like 12
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09890_926-111595DomainEGF-like 13
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09928_964-111595DomainEGF-like 14%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000342421-09966_1002-111595DomainEGF-like 15
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20411883_206312283166DomainLaminin G-like 1
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20412099_214012283166DomainEGF-like 21
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20412145_233912283166DomainLaminin G-like 2
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20412335_236812283166DomainEGF-like 22
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20412371_240812283166DomainEGF-like 23
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20412419_260912283166DomainLaminin G-like 3
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20412610_264612283166DomainEGF-like 24
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20412648_268912283166DomainEGF-like 25
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20412717_289512283166DomainLaminin G-like 4
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20412896_293212283166DomainEGF-like 26
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20412933_297012283166DomainEGF-like 27
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20412975_316512283166DomainLaminin G-like 5
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0111004_1040-176595DomainEGF-like 16%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0111042_1077-176595DomainEGF-like 17
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0111079_1115-176595DomainEGF-like 18
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0111117_1159-176595DomainEGF-like 19
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0111161_1197-176595DomainEGF-like 20%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011170_212-176595DomainEGF-like 1
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0111883_2063-176595DomainLaminin G-like 1
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0112099_2140-176595DomainEGF-like 21
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011213_254-176595DomainEGF-like 2
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0112145_2339-176595DomainLaminin G-like 2
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0112335_2368-176595DomainEGF-like 22
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0112371_2408-176595DomainEGF-like 23
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0112419_2609-176595DomainLaminin G-like 3
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011256_292-176595DomainEGF-like 3
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0112610_2646-176595DomainEGF-like 24
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0112648_2689-176595DomainEGF-like 25
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0112717_2895-176595DomainLaminin G-like 4
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0112896_2932-176595DomainEGF-like 26
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0112933_2970-176595DomainEGF-like 27
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-0112975_3165-176595DomainLaminin G-like 5
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011332_368-176595DomainEGF-like 4
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011370_406-176595DomainEGF-like 5
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011567_602-176595DomainEGF-like 6
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011643_679-176595DomainEGF-like 7
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011681_720-176595DomainEGF-like 8%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011733_769-176595DomainEGF-like 9%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011771_807-176595DomainEGF-like 10%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011809_847-176595DomainEGF-like 11
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011849_888-176595DomainEGF-like 12
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011890_926-176595DomainEGF-like 13
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011928_964-176595DomainEGF-like 14%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370618-011966_1002-176595DomainEGF-like 15
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23441883_206312283166DomainLaminin G-like 1
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23442099_214012283166DomainEGF-like 21
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23442145_233912283166DomainLaminin G-like 2
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23442335_236812283166DomainEGF-like 22
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23442371_240812283166DomainEGF-like 23
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23442419_260912283166DomainLaminin G-like 3
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23442610_264612283166DomainEGF-like 24
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23442648_268912283166DomainEGF-like 25
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23442717_289512283166DomainLaminin G-like 4
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23442896_293212283166DomainEGF-like 26
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23442933_297012283166DomainEGF-like 27
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23442975_316512283166DomainLaminin G-like 5
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0121004_1040-180620DomainEGF-like 16%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0121042_1077-180620DomainEGF-like 17
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0121079_1115-180620DomainEGF-like 18
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0121117_1159-180620DomainEGF-like 19
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0121161_1197-180620DomainEGF-like 20%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012170_212-180620DomainEGF-like 1
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0121883_2063-180620DomainLaminin G-like 1
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0122099_2140-180620DomainEGF-like 21
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012213_254-180620DomainEGF-like 2
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0122145_2339-180620DomainLaminin G-like 2
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0122335_2368-180620DomainEGF-like 22
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0122371_2408-180620DomainEGF-like 23
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0122419_2609-180620DomainLaminin G-like 3
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012256_292-180620DomainEGF-like 3
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0122610_2646-180620DomainEGF-like 24
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0122648_2689-180620DomainEGF-like 25
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0122717_2895-180620DomainLaminin G-like 4
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0122896_2932-180620DomainEGF-like 26
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0122933_2970-180620DomainEGF-like 27
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-0122975_3165-180620DomainLaminin G-like 5
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012332_368-180620DomainEGF-like 4
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012370_406-180620DomainEGF-like 5
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012567_602-180620DomainEGF-like 6
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012643_679-180620DomainEGF-like 7
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012681_720-180620DomainEGF-like 8%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012733_769-180620DomainEGF-like 9%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012771_807-180620DomainEGF-like 10%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012809_847-180620DomainEGF-like 11
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012849_888-180620DomainEGF-like 12
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012890_926-180620DomainEGF-like 13
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012928_964-180620DomainEGF-like 14%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000393380-012966_1002-180620DomainEGF-like 15
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23431883_206312283145DomainLaminin G-like 1
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23432099_214012283145DomainEGF-like 21
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23432145_233912283145DomainLaminin G-like 2
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23432335_236812283145DomainEGF-like 22
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23432371_240812283145DomainEGF-like 23
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23432419_260912283145DomainLaminin G-like 3
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23432610_264612283145DomainEGF-like 24
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23432648_268912283145DomainEGF-like 25
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23432717_289512283145DomainLaminin G-like 4
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23432896_293212283145DomainEGF-like 26
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23432933_297012283145DomainEGF-like 27
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23432975_316512283145DomainLaminin G-like 5

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTPRKchr6:128841404chr6:65303202ENST00000368213-1311173_1435331447DomainTyrosine-protein phosphatase 2
HgenePTPRKchr6:128841404chr6:65303202ENST00000368213-131196_281331447DomainNote=Ig-like C2-type
HgenePTPRKchr6:128841404chr6:65303202ENST00000368213-131294_389331447DomainFibronectin type-III 1
HgenePTPRKchr6:128841404chr6:65303202ENST00000368213-13131_194331447DomainMAM
HgenePTPRKchr6:128841404chr6:65303202ENST00000368213-131392_488331447DomainFibronectin type-III 2
HgenePTPRKchr6:128841404chr6:65303202ENST00000368213-131491_595331447DomainFibronectin type-III 3
HgenePTPRKchr6:128841404chr6:65303202ENST00000368213-131597_680331447DomainFibronectin type-III 4
HgenePTPRKchr6:128841404chr6:65303202ENST00000368213-131887_1141331447DomainTyrosine-protein phosphatase 1
HgenePTPRKchr6:128841404chr6:65303202ENST00000368215-1301173_1435331440DomainTyrosine-protein phosphatase 2
HgenePTPRKchr6:128841404chr6:65303202ENST00000368215-130196_281331440DomainNote=Ig-like C2-type
HgenePTPRKchr6:128841404chr6:65303202ENST00000368215-130294_389331440DomainFibronectin type-III 1
HgenePTPRKchr6:128841404chr6:65303202ENST00000368215-13031_194331440DomainMAM
HgenePTPRKchr6:128841404chr6:65303202ENST00000368215-130392_488331440DomainFibronectin type-III 2
HgenePTPRKchr6:128841404chr6:65303202ENST00000368215-130491_595331440DomainFibronectin type-III 3
HgenePTPRKchr6:128841404chr6:65303202ENST00000368215-130597_680331440DomainFibronectin type-III 4
HgenePTPRKchr6:128841404chr6:65303202ENST00000368215-130887_1141331440DomainTyrosine-protein phosphatase 1
HgenePTPRKchr6:128841404chr6:65303202ENST00000368226-1301173_1435331441DomainTyrosine-protein phosphatase 2
HgenePTPRKchr6:128841404chr6:65303202ENST00000368226-130196_281331441DomainNote=Ig-like C2-type
HgenePTPRKchr6:128841404chr6:65303202ENST00000368226-130294_389331441DomainFibronectin type-III 1
HgenePTPRKchr6:128841404chr6:65303202ENST00000368226-13031_194331441DomainMAM
HgenePTPRKchr6:128841404chr6:65303202ENST00000368226-130392_488331441DomainFibronectin type-III 2
HgenePTPRKchr6:128841404chr6:65303202ENST00000368226-130491_595331441DomainFibronectin type-III 3
HgenePTPRKchr6:128841404chr6:65303202ENST00000368226-130597_680331441DomainFibronectin type-III 4
HgenePTPRKchr6:128841404chr6:65303202ENST00000368226-130887_1141331441DomainTyrosine-protein phosphatase 1
HgenePTPRKchr6:128841404chr6:65303202ENST00000368213-1311082_1088331447RegionSubstrate binding
HgenePTPRKchr6:128841404chr6:65303202ENST00000368215-1301082_1088331440RegionSubstrate binding
HgenePTPRKchr6:128841404chr6:65303202ENST00000368226-1301082_1088331441RegionSubstrate binding
HgenePTPRKchr6:128841404chr6:65303202ENST00000368213-13127_752331447Topological domainExtracellular
HgenePTPRKchr6:128841404chr6:65303202ENST00000368213-131775_1439331447Topological domainCytoplasmic
HgenePTPRKchr6:128841404chr6:65303202ENST00000368215-13027_752331440Topological domainExtracellular
HgenePTPRKchr6:128841404chr6:65303202ENST00000368215-130775_1439331440Topological domainCytoplasmic
HgenePTPRKchr6:128841404chr6:65303202ENST00000368226-13027_752331441Topological domainExtracellular
HgenePTPRKchr6:128841404chr6:65303202ENST00000368226-130775_1439331441Topological domainCytoplasmic
HgenePTPRKchr6:128841404chr6:65303202ENST00000368213-131753_774331447TransmembraneHelical
HgenePTPRKchr6:128841404chr6:65303202ENST00000368215-130753_774331440TransmembraneHelical
HgenePTPRKchr6:128841404chr6:65303202ENST00000368226-130753_774331441TransmembraneHelical
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20411004_104012283166DomainEGF-like 16%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20411042_107712283166DomainEGF-like 17
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20411079_111512283166DomainEGF-like 18
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20411117_115912283166DomainEGF-like 19
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-20411161_119712283166DomainEGF-like 20%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041170_21212283166DomainEGF-like 1
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041213_25412283166DomainEGF-like 2
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041256_29212283166DomainEGF-like 3
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041332_36812283166DomainEGF-like 4
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041370_40612283166DomainEGF-like 5
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041567_60212283166DomainEGF-like 6
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041643_67912283166DomainEGF-like 7
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041681_72012283166DomainEGF-like 8%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041733_76912283166DomainEGF-like 9%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041771_80712283166DomainEGF-like 10%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041809_84712283166DomainEGF-like 11
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041849_88812283166DomainEGF-like 12
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041890_92612283166DomainEGF-like 13
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041928_96412283166DomainEGF-like 14%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370616-2041966_100212283166DomainEGF-like 15
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23441004_104012283166DomainEGF-like 16%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23441042_107712283166DomainEGF-like 17
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23441079_111512283166DomainEGF-like 18
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23441117_115912283166DomainEGF-like 19
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-23441161_119712283166DomainEGF-like 20%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344170_21212283166DomainEGF-like 1
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344213_25412283166DomainEGF-like 2
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344256_29212283166DomainEGF-like 3
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344332_36812283166DomainEGF-like 4
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344370_40612283166DomainEGF-like 5
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344567_60212283166DomainEGF-like 6
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344643_67912283166DomainEGF-like 7
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344681_72012283166DomainEGF-like 8%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344733_76912283166DomainEGF-like 9%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344771_80712283166DomainEGF-like 10%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344809_84712283166DomainEGF-like 11
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344849_88812283166DomainEGF-like 12
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344890_92612283166DomainEGF-like 13
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344928_96412283166DomainEGF-like 14%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000370621-2344966_100212283166DomainEGF-like 15
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23431004_104012283145DomainEGF-like 16%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23431042_107712283145DomainEGF-like 17
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23431079_111512283145DomainEGF-like 18
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23431117_115912283145DomainEGF-like 19
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-23431161_119712283145DomainEGF-like 20%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343170_21212283145DomainEGF-like 1
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343213_25412283145DomainEGF-like 2
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343256_29212283145DomainEGF-like 3
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343332_36812283145DomainEGF-like 4
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343370_40612283145DomainEGF-like 5
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343567_60212283145DomainEGF-like 6
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343643_67912283145DomainEGF-like 7
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343681_72012283145DomainEGF-like 8%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343733_76912283145DomainEGF-like 9%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343771_80712283145DomainEGF-like 10%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343809_84712283145DomainEGF-like 11
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343849_88812283145DomainEGF-like 12
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343890_92612283145DomainEGF-like 13
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343928_96412283145DomainEGF-like 14%3B calcium-binding
TgeneEYSchr6:128841404chr6:65303202ENST00000503581-2343966_100212283145DomainEGF-like 15


Top

FusionGeneSequence for PTPRK_EYS


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTPRK_ENST00000368226_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_1950aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSFIHKXSIFQKQXVILDVFCFLSCSKKDTYSIAVS
ASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCRRLPGSRWDKCNRKGLHXNEFS
GHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHMQKWRXMYSKWHNFFLQMFARL
GWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXNEKPPVHYYILKFQYHXNRRSN
CMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQSNSFRGYXSTXKLCGSKLXWHL

>In-frame_PTPRK_ENST00000368226_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000368226_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000368227_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_1950aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSFIHKXSIFQKQXVILDVFCFLSCSKKDTYSIAVS
ASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCRRLPGSRWDKCNRKGLHXNEFS
GHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHMQKWRXMYSKWHNFFLQMFARL
GWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXNEKPPVHYYILKFQYHXNRRSN
CMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQSNSFRGYXSTXKLCGSKLXWHL

>In-frame_PTPRK_ENST00000368227_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000368227_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000532331_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_1950aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSFIHKXSIFQKQXVILDVFCFLSCSKKDTYSIAVS
ASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCRRLPGSRWDKCNRKGLHXNEFS
GHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHMQKWRXMYSKWHNFFLQMFARL
GWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXNEKPPVHYYILKFQYHXNRRSN
CMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQSNSFRGYXSTXKLCGSKLXWHL

>In-frame_PTPRK_ENST00000532331_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000532331_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000368213_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_1950aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSFIHKXSIFQKQXVILDVFCFLSCSKKDTYSIAVS
ASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCRRLPGSRWDKCNRKGLHXNEFS
GHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHMQKWRXMYSKWHNFFLQMFARL
GWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXNEKPPVHYYILKFQYHXNRRSN
CMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQSNSFRGYXSTXKLCGSKLXWHL

>In-frame_PTPRK_ENST00000368213_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000368213_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000368210_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_1950aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSFIHKXSIFQKQXVILDVFCFLSCSKKDTYSIAVS
ASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCRRLPGSRWDKCNRKGLHXNEFS
GHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHMQKWRXMYSKWHNFFLQMFARL
GWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXNEKPPVHYYILKFQYHXNRRSN
CMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQSNSFRGYXSTXKLCGSKLXWHL

>In-frame_PTPRK_ENST00000368210_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000368210_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000368215_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_1950aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSFIHKXSIFQKQXVILDVFCFLSCSKKDTYSIAVS
ASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCRRLPGSRWDKCNRKGLHXNEFS
GHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHMQKWRXMYSKWHNFFLQMFARL
GWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXNEKPPVHYYILKFQYHXNRRSN
CMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQSNSFRGYXSTXKLCGSKLXWHL

>In-frame_PTPRK_ENST00000368215_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000368215_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000368207_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_1950aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSFIHKXSIFQKQXVILDVFCFLSCSKKDTYSIAVS
ASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCRRLPGSRWDKCNRKGLHXNEFS
GHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHMQKWRXMYSKWHNFFLQMFARL
GWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXNEKPPVHYYILKFQYHXNRRSN
CMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQSNSFRGYXSTXKLCGSKLXWHL

>In-frame_PTPRK_ENST00000368207_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000368207_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000525459_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_1950aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSFIHKXSIFQKQXVILDVFCFLSCSKKDTYSIAVS
ASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCRRLPGSRWDKCNRKGLHXNEFS
GHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHMQKWRXMYSKWHNFFLQMFARL
GWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXNEKPPVHYYILKFQYHXNRRSN
CMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQSNSFRGYXSTXKLCGSKLXWHL

>In-frame_PTPRK_ENST00000525459_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS

>In-frame_PTPRK_ENST00000525459_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_1971aa
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSADLLHWASLWXXNKENYLFNSHLSKNRSHFHTDIYNSPFXDFGQQLSIYKGYXNTSHN
GHLPSXSRSKTDRHCQARHSPNHWFGNIKNXHTLGKLLTPRTDCHXRAFSKTQSSFFRRCFLFSIPEFWYSXPSTNCPGQNIGITYAYSN
FSSHTRFLFSXXESKDPIYHVFLNVRFYFSYTIFIIXELSDCCFICYPNDFSNXKHSRGXYXAKQAVITLPWIPAYSCLHKCNSSCLXGG
SRGYXRIFSXFFNFKKRALEIAQPLDVSHFSCXGNYIXTGNHLKLISSAPVQYKSLQSQXISGYYXGFKQPETHKHQITGCXFFKRIKPN
MCNMFYDXNKILSXILRSSFAXQTVPLLXDILDELSDISQLVCTNGSSNYHFWAFIFFCYXNNTISGIHRSAIFISFXKECKKNNFILIL
GRIHYPIKXFGCXFMFGXDLFIHCPFTNYLFRLDEFXFDFKNDYXXTVSIRKHFKTIENKTIWHNYGTHXGTKSRELIGHGKKXRISYTV
QTSPKXXFSGFXVKLTNLSGCYFKDIFRNYTCKXLQKXSATIDRLSAXFFRSHHQCCILYSFSNSSTFNTDVFLHVCNXARLAIFYRLYD
LSXKRGQDFFRMVQMGTSAXCAISGISHCKPASSLHXISYFVFTGIHSGTSTADDFXFQLCSLLWRFLSRISECGFKSTKXHLPRISDLQ
LLWTSAVCQARLKFSRWIFYSIVYXKWYFKVPLLLSWXSKIXKHXYYCXSGQRAKVYTAYQARIGSMXRXADYFREEYTNMRIYQSCTRK
TPAKIRICLHWWISRPSWENPDACTSQEFYWLHRSYRNKXLEIFHSIQGSEKLSHXQLQIPGIYAVSNSLLCXCFXCDTRGXYHVDFCQP
LCCSTLCVPAGCMPQWRHMPCHLPLQWHSVIPMXLSTTFHWPLLXKRCRFILSIFQWEFLFRTALFEVCPGEGTXQNCYHLLDYKNKQFK
WNYSLQXWEXLWKAVSSFISCGRKAISXIWVWKFSKYFDCFCXLQHXHKCIHPYHNTLHNACWQPWSCLYDXNDCRWKTSSTEERHRDFP
CLSGIFXINVPWPYSCKCSNSXESRSCLWVQGLHSRPSSKQQRILHHRXSTTWKEYXELPRPLVCSSSVPQQWHLHQXXXKSVLXVSKAV
FRQAVPVCKLXKQPMWKWCHLCSKIRNRYCLPLPIWEVWTPLHXCYXYYSAKVQWHRCLWIHLIPGLFTDLRHQLPLXIPPEVSAGKQPL
STAKXLDIFYWTERPWVEWRXLPGCGPAQWQCGLXLXPGVWHSKHQERAPQSEPWSPHCSSGQVLPRGLAEGRXSXKXIHYRPRKTGWSQ
CLQSVLCRWLQXIHSRSLTKWSRFXKWFSRLYFHSSSSHXEGWPFQRTGKSXGPPKCWTQCWPVSCFSLQFNEMWQWWDMHREWNXCLLQ
LYHWVERIILHRDSFYLXSXTXPSTPLXQRSNLHFITSWIHLFLSSRNHWNLLXTSTYPHCDLGKAKTSRTESEEGGFIHKXSIFQKQXV
ILDVFCFLSCSKKDTYSIAVSASRCRWYPILCCTTLKSPIRXFFMHLFSKXFRSTSLQPWRQNYHSRNSPKSNYKRKYLAYNKSRKSWCR
RLPGSRWDKCNRKGLHXNEFSGHKYRLLYWRSIFFKSCKSHGNRKXTCRFSRLYPTSYHKXSRITINXIWSKRWLKCRXLXWDSLWVQHM
QKWRXMYSKWHNFFLQMFARLGWKYMXPVCVLFEXSLPPPIFMYTXPIIFLQLPVYFGLGGKVLXKQNFIFNCKIYGXFLHXIHXSKLXN
EKPPVHYYILKFQYHXNRRSNCMDGNSSKXRKXFSGNWSPXSDLENSSXLGRKNLCAYELXQWHILLXXMAPCSCNSKSDSYQGLHKXQS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTPRK_ENST00000368226_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_5851nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAG
TGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCA
GCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAG
TTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATAT
AATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCT
GGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCA
AGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGA
TGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTG
GGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTA
CAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACAT
TAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAAT
TGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGG
AGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCT
TATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTG
TTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGT
TGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATA

>In-frame_PTPRK_ENST00000368226_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000368226_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000368227_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_5851nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAG
TGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCA
GCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAG
TTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATAT
AATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCT
GGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCA
AGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGA
TGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTG
GGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTA
CAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACAT
TAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAAT
TGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGG
AGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCT
TATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTG
TTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGT
TGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATA

>In-frame_PTPRK_ENST00000368227_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000368227_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000532331_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_5851nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAG
TGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCA
GCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAG
TTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATAT
AATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCT
GGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCA
AGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGA
TGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTG
GGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTA
CAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACAT
TAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAAT
TGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGG
AGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCT
TATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTG
TTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGT
TGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATA

>In-frame_PTPRK_ENST00000532331_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000532331_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000368213_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_5851nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAG
TGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCA
GCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAG
TTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATAT
AATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCT
GGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCA
AGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGA
TGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTG
GGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTA
CAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACAT
TAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAAT
TGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGG
AGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCT
TATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTG
TTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGT
TGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATA

>In-frame_PTPRK_ENST00000368213_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000368213_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000368210_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_5851nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAG
TGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCA
GCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAG
TTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATAT
AATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCT
GGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCA
AGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGA
TGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTG
GGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTA
CAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACAT
TAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAAT
TGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGG
AGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCT
TATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTG
TTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGT
TGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATA

>In-frame_PTPRK_ENST00000368210_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000368210_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000368215_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_5851nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAG
TGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCA
GCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAG
TTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATAT
AATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCT
GGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCA
AGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGA
TGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTG
GGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTA
CAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACAT
TAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAAT
TGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGG
AGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCT
TATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTG
TTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGT
TGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATA

>In-frame_PTPRK_ENST00000368215_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000368215_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000368207_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_5851nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAG
TGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCA
GCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAG
TTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATAT
AATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCT
GGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCA
AGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGA
TGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTG
GGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTA
CAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACAT
TAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAAT
TGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGG
AGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCT
TATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTG
TTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGT
TGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATA

>In-frame_PTPRK_ENST00000368207_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000368207_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000525459_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_5851nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAG
TGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCA
GCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAG
TTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATAT
AATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCT
GGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCA
AGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGA
TGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTG
GGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTA
CAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACAT
TAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAAT
TGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGG
AGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCT
TATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTG
TTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGT
TGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATA

>In-frame_PTPRK_ENST00000525459_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000525459_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTPRK_ENST00000368226_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_6783nt
AGAAGCGCCCGGAGCCCGCGGGGCGACGTCACCCCCGGCTCCGCCCCCGTCCCTCCCCGAGCAAAGTAACTCTTGACTAACAGGAGCAGC
CTCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAGAAG
GAAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCC
CCGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCT
CTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAA
TAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGG
TCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTG
TCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCA
CTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCAC
AAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAA
GGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTAT
CTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGC
TTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAA
GAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACT
CATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAA
ACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAAT
TCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAA
TGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTAT
TTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTAT
GTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTG
ATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAG
AGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACT
TACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCT
CAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCA
TGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAAT
GGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGG
AATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGG
CTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAG
TAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTA
ATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAG
GGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAG
ACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCA
TTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTT
CTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACA
ATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTG
AAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATA
ACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGT
TTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACA
GCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTG
CAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTC
CTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCT
TCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCT
GCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCAT
GTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATG
CTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCT
TCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCC
ATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCA
TCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATC
ATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTC
CAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATT
TCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTG
GCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTT
CTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTC
CTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTG
CTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACT
TAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTC
TAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAG
ATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAA
ATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAAT
TAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAAT
GTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATC
TTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAA
ACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCA
CTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGG
CAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCT
GTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATA
TTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTA
CTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAG
AAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGT
TATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTT
TTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTC
CATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAAC
GTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATA
AGAAAAAAATCAAGTTATTAATCAAAGGAAAAATAAAAATTATACAAAGCAATGTAACCATATTGTATTACATGGCTTAGCTACAACTTA
TTTATATGATTCAACAATGTAAAACTTGAACATAGATTTAAACCAAAAATTATTGCATGAATGTAGAAAGAGAAGGTGAGAGGAGAGGAG

>In-frame_PTPRK_ENST00000368226_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_6690nt
AGAAGCGCCCGGAGCCCGCGGGGCGACGTCACCCCCGGCTCCGCCCCCGTCCCTCCCCGAGCAAAGTAACTCTTGACTAACAGGAGCAGC
CTCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAGAAG
GAAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCC
CCGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCT
CTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAA
TAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGG
TCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTG
TCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCA
CTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCAC
AAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAA
GGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTAT
CTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGC
TTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAA
GAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACT
CATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAA
ACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAAT
TCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAA
TGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTAT
TTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTAT
GTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTG
ATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAG
AGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACT
TACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCT
CAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCA
TGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAAT
GGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGG
AATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGG
CTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAG
TAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTA
ATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAG
GGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAG
ACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCA
TTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTT
CTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACA
ATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTG
AAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATA
ACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGT
TTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACA
GCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTG
CAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTC
CTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCT
TCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCT
GCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCAT
GTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATG
CTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCT
TCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCC
ATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCA
TCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATC
ATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTC
CAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATT
TCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTG
GCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTT
CTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTC
CTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGA
AGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACAC
ATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTAT
GCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAA
ACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCT
CCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAA
ATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCT
CAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTT
GCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATAC
CTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAAT
TTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCA
CTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGA
AAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTG
TAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTC
TAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTG
TTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATG
AACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACA
TTGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGA
AGGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAAT
GTGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATG
TGTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTATTAATCAAAG

>In-frame_PTPRK_ENST00000368226_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_6230nt
AGAAGCGCCCGGAGCCCGCGGGGCGACGTCACCCCCGGCTCCGCCCCCGTCCCTCCCCGAGCAAAGTAACTCTTGACTAACAGGAGCAGC
CTCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAGAAG
GAAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCC
CCGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCT
CTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAA
TAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGG
TCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTG
TCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCA
CTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCAC
AAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAA
GGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTAT
CTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGC
TTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAA
GAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACT
CATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAA
ACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAAT
TCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAA
TGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTAT
TTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTAT
GTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTG
ATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAG
AGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACT
TACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCT
CAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCA
TGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAAT
GGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGG
AATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGG
CTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAG
TAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTA
ATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAG
GGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAG
ACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCA
TTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTT
CTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACA
ATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTG
AAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATA
ACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGT
TTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACA
GCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTG
CAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTC
CTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCT
TCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCT
GCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCAT
GTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATG
CTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCT
TCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCC
ATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCA
TCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATC
ATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTC
CAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATT
TCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTG
GCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTT
CTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTC
CTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGA
AGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACAC
ATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTAT
GCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAA
ACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCT
CCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAA
ATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCT
CAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTT
GCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATAC
CTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAAT
TTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCA
CTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGA
AAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTG
TAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTC
TAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTG
TTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATG

>In-frame_PTPRK_ENST00000368227_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_6834nt
GTCTCTCCGGCAGGAGGCGGTGGCGGCGCCGCGCCCGAGCCCGCATTCCTCAGAAGCGCCCGGAGCCCGCGGGGCGACGTCACCCCCGGC
TCCGCCCCCGTCCCTCCCCGAGCAAAGTAACTCTTGACTAACAGGAGCAGCCTCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGG
CGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAGAAGGAAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTC
ACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCCCCGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAA
ACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCA
AGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAA
CAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAG
CCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACAT
TAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCG
CAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTA
TTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTA
TTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAG
GGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTA
GGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTC
CCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATC
CCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAA
GCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTT
ATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTT
CTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCT
CATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAA
CTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGA
AAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATA
CACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAG
AAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCAT
TTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATT
ATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCA
CTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATT
TCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGA
CCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTA
CTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACAC
TGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTAC
TCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGA
ATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATT
GCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTG
TCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCA
TAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGA
ATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACA
GTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTA
AATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCT
ACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGA
TTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTT
ATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGA
ACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAA
GGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAG
ATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATG
CCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACA
ACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGC
TCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACA
CTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTG
GTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTT
TTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTG
GACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTT
ACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTA
GCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTAT
CCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGC
AGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAG
TAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTT
GGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGA
GTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAG
GTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTG
ACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGC
CAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCAT
TTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATT
CTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAG
GTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTA
ACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATC
AGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATG
GCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTA
AAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGG
TTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGG
AATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTG
TTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCAC
TTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAAC
TTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTATTAATCAAAGGAAAAATAAAAA
TTATACAAAGCAATGTAACCATATTGTATTACATGGCTTAGCTACAACTTATTTATATGATTCAACAATGTAAAACTTGAACATAGATTT

>In-frame_PTPRK_ENST00000368227_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_6741nt
GTCTCTCCGGCAGGAGGCGGTGGCGGCGCCGCGCCCGAGCCCGCATTCCTCAGAAGCGCCCGGAGCCCGCGGGGCGACGTCACCCCCGGC
TCCGCCCCCGTCCCTCCCCGAGCAAAGTAACTCTTGACTAACAGGAGCAGCCTCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGG
CGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAGAAGGAAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTC
ACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCCCCGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAA
ACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCA
AGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAA
CAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAG
CCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACAT
TAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCG
CAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTA
TTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTA
TTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAG
GGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTA
GGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTC
CCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATC
CCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAA
GCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTT
ATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTT
CTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCT
CATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAA
CTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGA
AAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATA
CACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAG
AAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCAT
TTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATT
ATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCA
CTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATT
TCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGA
CCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTA
CTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACAC
TGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTAC
TCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGA
ATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATT
GCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTG
TCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCA
TAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGA
ATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACA
GTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTA
AATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCT
ACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGA
TTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTT
ATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGA
ACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAA
GGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAG
ATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATG
CCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACA
ACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGC
TCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACA
CTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTG
GTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTT
TTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTG
GACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTT
ACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTA
GCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTA
TCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCA
ATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTA
TCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACA
ACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTG
GTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCT
ATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTA
TCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACA
ACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACC
AGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGG
GTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATT
ATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTC
AAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTA
TGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATA
ACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAAT
ATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAA
AAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTA
GTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATTACCTGAA
ATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTAT
ATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCC
TAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGA

>In-frame_PTPRK_ENST00000368227_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_6281nt
GTCTCTCCGGCAGGAGGCGGTGGCGGCGCCGCGCCCGAGCCCGCATTCCTCAGAAGCGCCCGGAGCCCGCGGGGCGACGTCACCCCCGGC
TCCGCCCCCGTCCCTCCCCGAGCAAAGTAACTCTTGACTAACAGGAGCAGCCTCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGG
CGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAGAAGGAAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTC
ACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCCCCGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAA
ACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCA
AGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAA
CAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAG
CCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACAT
TAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCG
CAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTA
TTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTA
TTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAG
GGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTA
GGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTC
CCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATC
CCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAA
GCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTT
ATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTT
CTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCT
CATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAA
CTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGA
AAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATA
CACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAG
AAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCAT
TTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATT
ATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCA
CTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATT
TCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGA
CCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTA
CTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACAC
TGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTAC
TCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGA
ATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATT
GCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTG
TCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCA
TAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGA
ATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACA
GTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTA
AATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCT
ACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGA
TTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTT
ATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGA
ACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAA
GGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAG
ATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATG
CCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACA
ACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGC
TCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACA
CTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTG
GTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTT
TTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTG
GACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTT
ACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTA
GCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTA
TCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCA
ATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTA
TCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACA
ACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTG
GTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCT
ATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTA
TCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACA
ACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACC
AGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGG
GTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATT
ATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTC
AAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTA
TGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATA
ACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAAT
ATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAA

>In-frame_PTPRK_ENST00000532331_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_6585nt
GGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCCCCGGCAGCTCTTTGCAAA
GCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTG
GCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTT
TAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTA
TAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCC
CAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAA
AACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAA
CATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGT
CTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTT
CAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAA
GTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGAT
TGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGT
TCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTG
CTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGC
ATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCA
CTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTG
CAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTT
TATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAG
AAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGG
AAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATG
TTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAG
AAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAG
ATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTG
TGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTC
AACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATA
ACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTC
AATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGG
ACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATAT
GCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCC
AGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGA
AAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGG
TTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATG
CCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTAT
TCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCT
ACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTG
TGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCAT
TCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAG
TACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTC
ATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCAC
GACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAA
ATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCT
GTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGC
CAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACC
TGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATG
ACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCA
ATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTA
TCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATG
GAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATC
CTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCA
TAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAAC
ATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAA
TCTACTGTGAACAAGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAA
AAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTG
ATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAG
TAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAG
AAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGG
CAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAA
AAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAA
CTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTT
TATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAA
CTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATT
TCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATC
AGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACC
ATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACT
TTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAA
CCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATG
ATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTC
TTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAA
TGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTAT
TCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAA
AAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTAT
TAATCAAAGGAAAAATAAAAATTATACAAAGCAATGTAACCATATTGTATTACATGGCTTAGCTACAACTTATTTATATGATTCAACAAT
GTAAAACTTGAACATAGATTTAAACCAAAAATTATTGCATGAATGTAGAAAGAGAAGGTGAGAGGAGAGGAGAACAGGCTGGTAAGAGCT

>In-frame_PTPRK_ENST00000532331_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_6492nt
GGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCCCCGGCAGCTCTTTGCAAA
GCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTG
GCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTT
TAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTA
TAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCC
CAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAA
AACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAA
CATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGT
CTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTT
CAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAA
GTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGAT
TGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGT
TCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTG
CTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGC
ATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCA
CTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTG
CAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTT
TATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAG
AAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGG
AAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATG
TTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAG
AAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAG
ATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTG
TGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTC
AACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATA
ACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTC
AATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGG
ACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATAT
GCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCC
AGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGA
AAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGG
TTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATG
CCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTAT
TCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCT
ACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTG
TGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCAT
TCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAG
TACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTC
ATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCAC
GACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAA
ATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCT
GTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGC
CAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACC
TGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATG
ACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCA
ATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTA
TCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATG
GAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATC
CTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCA
TAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAAC
ATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAA
TCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAA
GTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTC
AGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATA
GTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATA
TAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTC
TGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTC
AAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTG
ATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATT
GGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTT
ACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACA
TTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAA
TTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGG
GAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTC
TTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTT
GTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATG
TTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACAT
AAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAA
CTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTC
CTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCT
TATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAA
ATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTATTAATCAAAGGAAAAATAAAAATTATAC

>In-frame_PTPRK_ENST00000532331_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_6032nt
GGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCCCCGGCAGCTCTTTGCAAA
GCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTG
GCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTT
TAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTA
TAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCC
CAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAA
AACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAA
CATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGT
CTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTT
CAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAA
GTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGAT
TGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGT
TCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTG
CTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGC
ATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCA
CTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTG
CAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTT
TATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAG
AAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGG
AAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATG
TTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAG
AAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAG
ATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTG
TGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTC
AACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATA
ACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTC
AATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGG
ACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATAT
GCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCC
AGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGA
AAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGG
TTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATG
CCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTAT
TCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCT
ACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTG
TGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCAT
TCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAG
TACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTC
ATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCAC
GACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAA
ATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCT
GTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGC
CAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACC
TGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATG
ACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCA
ATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTA
TCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATG
GAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATC
CTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCA
TAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAAC
ATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAA
TCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAA
GTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTC
AGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATA
GTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATA
TAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTC
TGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTC
AAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTG
ATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATT
GGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTT
ACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACA
TTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAA
TTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGG
GAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTC
TTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTT
GTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATG
TTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACAT

>In-frame_PTPRK_ENST00000368213_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_6692nt
TCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAGAAGG
AAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCCC
CGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTC
TTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAAT
AAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGT
CAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGT
CAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCAC
TAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACA
AATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAG
GACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATC
TGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCT
TATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAG
AAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTC
ATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAA
CATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATT
CTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAAT
GGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATT
TCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATG
TTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGA
TGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGA
GAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTT
ACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTC
AGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCAT
GTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATG
GGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGA
ATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGC
TTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGT
AGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAA
TACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGG
GAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGA
CCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCAT
TCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTC
TGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAA
TGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGA
AAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAA
CAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTT
TCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAG
CATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGC
AGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCC
TGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTT
CATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTG
CATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATG
TGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGC
TATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTT
CCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCA
TGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCAT
CAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCA
TAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCC
AGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTT
CAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGG
CAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTC
TACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCC
TCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGC
TTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTT
AAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCT
AGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGA
TGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAA
TCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATT
AACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATG
TACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCT
TTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAA
CAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCAC
TACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGC
AATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTG
TTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATAT
TGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTAC
TCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGA
AGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGTT
ATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTTT
TTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTCC
ATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAACG
TGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATAA
GAAAAAAATCAAGTTATTAATCAAAGGAAAAATAAAAATTATACAAAGCAATGTAACCATATTGTATTACATGGCTTAGCTACAACTTAT
TTATATGATTCAACAATGTAAAACTTGAACATAGATTTAAACCAAAAATTATTGCATGAATGTAGAAAGAGAAGGTGAGAGGAGAGGAGA

>In-frame_PTPRK_ENST00000368213_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_6599nt
TCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAGAAGG
AAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCCC
CGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTC
TTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAAT
AAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGT
CAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGT
CAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCAC
TAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACA
AATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAG
GACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATC
TGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCT
TATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAG
AAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTC
ATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAA
CATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATT
CTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAAT
GGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATT
TCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATG
TTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGA
TGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGA
GAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTT
ACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTC
AGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCAT
GTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATG
GGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGA
ATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGC
TTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGT
AGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAA
TACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGG
GAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGA
CCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCAT
TCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTC
TGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAA
TGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGA
AAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAA
CAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTT
TCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAG
CATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGC
AGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCC
TGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTT
CATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTG
CATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATG
TGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGC
TATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTT
CCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCA
TGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCAT
CAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCA
TAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCC
AGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTT
CAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGG
CAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTC
TACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCC
TCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAA
GGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACA
TATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATG
CATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAA
CGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTC
CACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAA
TGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTC
AAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTG
CAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACC
TGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATT
TATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCAC
TAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAA
AATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGT
AATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCT
AAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGT
TGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGA
ACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACAT
TGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGAA
GGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAATG
TGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATGT
GTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTATTAATCAAAGG

>In-frame_PTPRK_ENST00000368213_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_6139nt
TCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAGAAGG
AAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCCC
CGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTC
TTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAAT
AAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGT
CAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGT
CAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCAC
TAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACA
AATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAG
GACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATC
TGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCT
TATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAG
AAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTC
ATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAA
CATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATT
CTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAAT
GGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATT
TCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATG
TTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGA
TGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGA
GAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTT
ACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTC
AGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCAT
GTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATG
GGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGA
ATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGC
TTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGT
AGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAA
TACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGG
GAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGA
CCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCAT
TCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTC
TGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAA
TGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGA
AAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAA
CAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTT
TCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAG
CATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGC
AGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCC
TGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTT
CATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTG
CATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATG
TGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGC
TATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTT
CCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCA
TGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCAT
CAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCA
TAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCC
AGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTT
CAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGG
CAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTC
TACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCC
TCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAA
GGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACA
TATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATG
CATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAA
CGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTC
CACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAA
TGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTC
AAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTG
CAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACC
TGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATT
TATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCAC
TAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAA
AATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGT
AATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCT
AAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGT
TGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGA

>In-frame_PTPRK_ENST00000368210_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_6725nt
GAGCAAAGTAACTCTTGACTAACAGGAGCAGCCTCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTC
GCCCCTGAGGTAGTTTGGCGACCGCGAAGAAGGAAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCC
GCTCCTCCGTCGTGGATTTCGCGGCGATCCCCCCGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACT
GCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGAC
CTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACA
GACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCC
AGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTT
GGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCG
ATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCAC
ACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTT
ATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAA
CAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATAT
TGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGT
AATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTAT
TACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATG
TTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAA
CTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACC
ATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCAT
TACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGAT
GAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCAT
AACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCC
AAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGA
CTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAAC
TCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAA
AGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCC
CTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTA
TGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACT
TCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTA
CTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATT
GGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAA
ATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGA
AGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTAT
GCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGC
ACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGA
CTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCC
CTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCT
TTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTC
TCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAG
CCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGC
ATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCAT
TCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTG
TGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCT
GTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCC
ATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATT
CCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAA
TAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTA
TAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTT
CTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCA
GTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCAC
TCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTG
TCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGG
GTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCAT
TTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAGTGATCCATCTTT
CAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGC
AGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACT
TCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGG
AAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATAC
AGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCG
ACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTG
TGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATAC
ATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTG
TACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGA
TCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGG
AATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTC
TGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTA
CATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGG
CTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCA
GGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAG
AGATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAACTGTTTACTATAT
TACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTT
ATCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTA
CCTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTC
AGTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTATTAATCAAAGGAAAAATAAAAATTATACAAAGCAATGTAAC
CATATTGTATTACATGGCTTAGCTACAACTTATTTATATGATTCAACAATGTAAAACTTGAACATAGATTTAAACCAAAAATTATTGCAT

>In-frame_PTPRK_ENST00000368210_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_6632nt
GAGCAAAGTAACTCTTGACTAACAGGAGCAGCCTCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTC
GCCCCTGAGGTAGTTTGGCGACCGCGAAGAAGGAAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCC
GCTCCTCCGTCGTGGATTTCGCGGCGATCCCCCCGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACT
GCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGAC
CTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACA
GACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCC
AGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTT
GGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCG
ATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCAC
ACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTT
ATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAA
CAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATAT
TGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGT
AATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTAT
TACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATG
TTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAA
CTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACC
ATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCAT
TACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGAT
GAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCAT
AACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCC
AAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGA
CTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAAC
TCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAA
AGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCC
CTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTA
TGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACT
TCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTA
CTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATT
GGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAA
ATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGA
AGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTAT
GCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGC
ACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGA
CTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCC
CTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCT
TTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTC
TCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAG
CCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGC
ATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCAT
TCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTG
TGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCT
GTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCC
ATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATT
CCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAA
TAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTA
TAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTT
CTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCA
GTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCAC
TCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTG
TCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGG
GTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCAT
TTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGA
AAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTC
TTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACA
ACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTAT
CATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGA
TCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTC
TTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATT
ACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGG
TGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAA
TAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTG
TGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCA
GTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTT
TCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCAC
ATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGA
GGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATAT
CGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAA
ATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAAT
GCAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACAT
ATCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTT
AACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAA
TCAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTAC

>In-frame_PTPRK_ENST00000368210_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_6172nt
GAGCAAAGTAACTCTTGACTAACAGGAGCAGCCTCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTC
GCCCCTGAGGTAGTTTGGCGACCGCGAAGAAGGAAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCC
GCTCCTCCGTCGTGGATTTCGCGGCGATCCCCCCGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACT
GCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGAC
CTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACA
GACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCC
AGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTT
GGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCG
ATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCAC
ACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTT
ATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAA
CAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATAT
TGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGT
AATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTAT
TACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATG
TTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAA
CTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACC
ATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCAT
TACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGAT
GAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCAT
AACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCC
AAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGA
CTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAAC
TCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAA
AGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCC
CTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTA
TGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACT
TCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTA
CTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATT
GGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAA
ATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGA
AGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTAT
GCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGC
ACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGA
CTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCC
CTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCT
TTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTC
TCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAG
CCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGC
ATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCAT
TCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTG
TGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCT
GTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCC
ATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATT
CCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAA
TAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTA
TAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTT
CTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCA
GTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCAC
TCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTG
TCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGG
GTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCAT
TTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGA
AAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTC
TTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACA
ACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTAT
CATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGA
TCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTC
TTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATT
ACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGG
TGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAA
TAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTG
TGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCA
GTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTT
TCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCAC
ATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGA
GGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATAT
CGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAA

>In-frame_PTPRK_ENST00000368215_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_6467nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAG
TGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCA
GCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAG
TTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATAT
AATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCT
GGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCA
AGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGA
TGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTG
GGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTA
CAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACAT
TAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAAT
TGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGG
AGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCT
TATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTG
TTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGT
TGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATA
AGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAAC
TGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCC
TACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTT
ATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAA
TGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTATTAATCAAAGGAAAAATAAAAATTATACA
AAGCAATGTAACCATATTGTATTACATGGCTTAGCTACAACTTATTTATATGATTCAACAATGTAAAACTTGAACATAGATTTAAACCAA

>In-frame_PTPRK_ENST00000368215_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_6374nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT
TGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACA
CTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCT
AAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTT
GATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCT
TACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATT

>In-frame_PTPRK_ENST00000368215_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_5914nt
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAG
TTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCC
CATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAAT
GGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAAT
TAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGT
TTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAAC
TTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCC
TACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGA
TATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGC
TCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTT
TCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGA
ATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAAC
ATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGAC
ATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTAC
TGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTT
GGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTC
TTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAG
ACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTT
CAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTAC
ACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATAC
AGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGAC
CTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAG
CCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTG
TGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAG
CTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAA
GTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTAT
CAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAA
ACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTAC
TGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATC
CCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCC
CTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTC
ATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTA
TTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAA
TGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGG
GTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAAC
GCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCA
TGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTT
CAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCA
CGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTA
TTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGT
CTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGG
ATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTC
AGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGG
CAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCA
TCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAA
TGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGG
CTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAG
TGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAA
TTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGG
AGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCAT
TGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTT
ATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATT
TTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGG
CGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGA
AGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGG
AGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAA
TAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATG
CAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGT
GTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGT
GGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAAT
GAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGA
AGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTA
TAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCT
AATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAG
AAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACAT

>In-frame_PTPRK_ENST00000368207_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_6692nt
TCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAGAAGG
AAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCCC
CGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTC
TTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAAT
AAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGT
CAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGT
CAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCAC
TAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACA
AATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAG
GACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATC
TGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCT
TATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAG
AAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTC
ATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAA
CATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATT
CTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAAT
GGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATT
TCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATG
TTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGA
TGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGA
GAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTT
ACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTC
AGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCAT
GTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATG
GGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGA
ATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGC
TTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGT
AGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAA
TACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGG
GAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGA
CCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCAT
TCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTC
TGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAA
TGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGA
AAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAA
CAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTT
TCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAG
CATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGC
AGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCC
TGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTT
CATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTG
CATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATG
TGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGC
TATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTT
CCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCA
TGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCAT
CAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCA
TAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCC
AGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTT
CAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGG
CAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTC
TACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCC
TCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGC
TTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTT
AAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCT
AGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGA
TGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAA
TCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATT
AACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATG
TACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCT
TTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAA
CAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCAC
TACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGC
AATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTG
TTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATAT
TGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTAC
TCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGA
AGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGTT
ATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTTT
TTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTCC
ATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAACG
TGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATAA
GAAAAAAATCAAGTTATTAATCAAAGGAAAAATAAAAATTATACAAAGCAATGTAACCATATTGTATTACATGGCTTAGCTACAACTTAT
TTATATGATTCAACAATGTAAAACTTGAACATAGATTTAAACCAAAAATTATTGCATGAATGTAGAAAGAGAAGGTGAGAGGAGAGGAGA

>In-frame_PTPRK_ENST00000368207_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_6599nt
TCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAGAAGG
AAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCCC
CGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTC
TTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAAT
AAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGT
CAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGT
CAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCAC
TAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACA
AATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAG
GACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATC
TGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCT
TATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAG
AAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTC
ATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAA
CATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATT
CTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAAT
GGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATT
TCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATG
TTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGA
TGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGA
GAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTT
ACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTC
AGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCAT
GTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATG
GGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGA
ATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGC
TTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGT
AGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAA
TACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGG
GAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGA
CCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCAT
TCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTC
TGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAA
TGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGA
AAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAA
CAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTT
TCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAG
CATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGC
AGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCC
TGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTT
CATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTG
CATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATG
TGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGC
TATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTT
CCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCA
TGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCAT
CAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCA
TAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCC
AGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTT
CAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGG
CAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTC
TACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCC
TCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAA
GGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACA
TATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATG
CATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAA
CGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTC
CACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAA
TGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTC
AAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTG
CAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACC
TGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATT
TATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCAC
TAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAA
AATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGT
AATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCT
AAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGT
TGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGA
ACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACAT
TGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGAA
GGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAATG
TGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATGT
GTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTATTAATCAAAGG

>In-frame_PTPRK_ENST00000368207_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_6139nt
TCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAGAAGG
AAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATCCCCC
CGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTC
TTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAAT
AAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGT
CAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGT
CAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCAC
TAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACA
AATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAG
GACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATC
TGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCT
TATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAG
AAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTC
ATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAA
CATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATT
CTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAAT
GGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATT
TCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATG
TTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGA
TGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGA
GAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTT
ACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTC
AGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCAT
GTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATG
GGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGA
ATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGC
TTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGT
AGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAA
TACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGG
GAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGA
CCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCAT
TCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTC
TGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAA
TGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGA
AAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAA
CAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTT
TCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAG
CATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGC
AGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCC
TGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTT
CATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTG
CATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATG
TGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGC
TATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTT
CCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCA
TGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCAT
CAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCA
TAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCC
AGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTT
CAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGG
CAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTC
TACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCC
TCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAA
GGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACA
TATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATG
CATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAA
CGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTC
CACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAA
TGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTC
AAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTG
CAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACC
TGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATT
TATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCAC
TAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAA
AATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGT
AATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCT
AAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGT
TGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGA

>In-frame_PTPRK_ENST00000525459_chr6_128841404_-_EYS_ENST00000503581_chr6_65303202_-_6696nt
AGCCTCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAG
AAGGAAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATC
CCCCCGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGC
GCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATG
AAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTT
TGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCA
TTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTG
TCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAG
CACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAG
CAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTT
TATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCC
TGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTT
CAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAA
ACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCA
CAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTG
AATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCAC
TAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTT
TATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATT
TATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTA
CTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATC
AAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAA
ACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAG
GCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCT
CCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCA
AATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCAC
TGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATG
TGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATT
TAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCA
TTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTT
TAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTC
CAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTT
TCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATG
CTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCC
ACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCT
GTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAAC
ATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGC
AGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATT
ACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGA
CTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATA
TTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAAT
TCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCA
CCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACC
CATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTG
ATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCA
GCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAG
GCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAA
GCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATG
ATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACA
CTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCC
ATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAAT
GTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAG
TTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCT
GTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTT
TTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAAC
ACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCA
TTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATC
TAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTT
TAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTAC
AATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTG
AATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATA
ATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTG
AAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGT
TCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTC
TGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACAT
TCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGG
ATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCG
TTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAAT
TAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGC
AGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATAT
CTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAA
CTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATC
AACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAA
ATAAGAAAAAAATCAAGTTATTAATCAAAGGAAAAATAAAAATTATACAAAGCAATGTAACCATATTGTATTACATGGCTTAGCTACAAC
TTATTTATATGATTCAACAATGTAAAACTTGAACATAGATTTAAACCAAAAATTATTGCATGAATGTAGAAAGAGAAGGTGAGAGGAGAG

>In-frame_PTPRK_ENST00000525459_chr6_128841404_-_EYS_ENST00000370621_chr6_65303202_-_6603nt
AGCCTCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAG
AAGGAAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATC
CCCCCGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGC
GCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATG
AAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTT
TGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCA
TTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTG
TCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAG
CACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAG
CAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTT
TATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCC
TGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTT
CAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAA
ACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCA
CAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTG
AATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCAC
TAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTT
TATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATT
TATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTA
CTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATC
AAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAA
ACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAG
GCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCT
CCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCA
AATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCAC
TGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATG
TGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATT
TAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCA
TTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTT
TAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTC
CAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTT
TCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATG
CTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCC
ACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCT
GTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAAC
ATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGC
AGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATT
ACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGA
CTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATA
TTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAAT
TCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCA
CCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACC
CATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTG
ATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCA
GCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAG
GCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAA
GCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATG
ATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACA
CTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCC
ATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAAT
GTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAG
TTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCT
GTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGA
AGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGA
CACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTT
TATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTA
TAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGG
CCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAG
AAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTG
GCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTT
CTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTA
TACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAA
AATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTA
CCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCT
TGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAG
TTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGG
CTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATT
TTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAG
ATGAACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGAT
ACATTGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCAC
TGAAGGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAG
AATGTGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCA
ATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTATTAATCA

>In-frame_PTPRK_ENST00000525459_chr6_128841404_-_EYS_ENST00000370616_chr6_65303202_-_6143nt
AGCCTCCGCCGAGCATGGAGAGCTGCCGCCGCGGCCGGCCGGCGACGCTGGCGACGCTTTCGCCCCTGAGGTAGTTTGGCGACCGCGAAG
AAGGAAAAAGGGCGGGCGGGCGGCTGTCCTCTCACCGTCCTCACCCCGCGAGGCCCGGCCCGCTCCTCCGTCGTGGATTTCGCGGCGATC
CCCCCGGCAGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGGCATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGC
GCTCTTGCTCCTCTCTCCTTGGCCTCTCCTGGGATCGGCCCAAGGCCAGTTCTCCGCAGACCTGCTCCATTGGGCTTCTTTGTGGTGATG
AAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTT
TGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCA
TTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTG
TCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAG
CACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAG
CAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTT
TATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCC
TGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTT
CAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAA
ACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCA
CAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTG
AATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCAC
TAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTT
TATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATT
TATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTA
CTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATC
AAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAA
ACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAG
GCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCT
CCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCA
AATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCAC
TGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATG
TGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATT
TAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCA
TTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTT
TAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTC
CAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTT
TCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATG
CTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCC
ACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCT
GTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAAC
ATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGC
AGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATT
ACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGA
CTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATA
TTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAAT
TCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCA
CCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACC
CATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTG
ATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCA
GCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAG
GCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAA
GCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATG
ATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACA
CTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCC
ATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAAT
GTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAG
TTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCT
GTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGA
AGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGA
CACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTT
TATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTA
TAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGG
CCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAG
AAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTG
GCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTT
CTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTA
TACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAA
AATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTA
CCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCT
TGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAG
TTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGG
CTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATT
TTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAG


Top

FusionGenePPI for PTPRK_EYS


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTPRKPSMD11, TK1, CTNNB1, JUP, CSNK2B, FKBP8, GADD45G, GADD45A, LGALS3, LGALS8, LGALS9, LAMB2, ATRN, CACNA2D2, ECE1, CES3, TCTN2, LRP1B, INSR, PXDN, FRAS1, CACNA2D1, LAMA5, CD109, POGLUT1, ARSK, MEGF8, UBR3, ARSA, GALNS, ARSG, LAMB1, LRIG3, LRIG1, B3GALTL, SCARB1, ADAM9, NPC1, SUSD1, COL6A2, EOGT, PLXNA2, PLXNA3, PLXNA1, EGFR, MOXD1, CCDC102A, CHST10, COL6A1, DNAJB9, MAN2A1, CNTNAP3, PLXNB2, MANBA, ITGA8, MGRN1, ARSB, COL4A2, TMEM67, FBLN1, CLN5, SCARB2, FUT11, GLG1, CERCAM, ERO1LB, DCBLD2, CHST12, AMIGO1, PCSK5, LAMA3, SIAE, GNPTG, CTSF, PLAT, BCHE, ITGA4, GALNT18, MICA, LEPREL2, WNT5A, DGCR2, MAN2A2, BTD, SP3, AMIGO3, ANKRD46, HYAL2, TMEM132A, RIPK3, ATP2A2, SIPA1L3, ARHGAP32, TANC1, MINK1, PKP4, NCKAP5L, PEAK1, PIK3R1, SEC24B, RPL28, PTPRU, DEFA5, PCDHGB1, TUFM, MMP26, NID2, PCDHGB4, LYPD1, ZNF3, TMPRSS11B, BMP7EYSEGFR


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTPRK_EYS


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PTPRK_EYS


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePTPRKC0025202melanoma2CTD_human
HgenePTPRKC0033578Prostatic Neoplasms1CTD_human
TgeneEYSC1864446Retinitis Pigmentosa 252CTD_human;UNIPROT
TgeneEYSC0035334Retinitis Pigmentosa1CTD_human;ORPHANET