FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29483

FusionGeneSummary for PTPRA_SDAD1

check button Fusion gene summary
Fusion gene informationFusion gene name: PTPRA_SDAD1
Fusion gene ID: 29483
HgeneTgene
Gene symbol

PTPRA

SDAD1

Gene ID

5786

55153

Gene nameprotein tyrosine phosphatase, receptor type ASDA1 domain containing 1
SynonymsHEPTP|HLPR|HPTPA|HPTPalpha|LRP|PTPA|PTPRL2|R-PTP-alpha|RPTPA-
Cytomap

20p13

4q21.1

Type of geneprotein-codingprotein-coding
Descriptionreceptor-type tyrosine-protein phosphatase alphaLeukocyte common antigen-related peptide (protein tyrosine phosphate)PTPLCA-related phosphatasePTPase-alphaprotein tyrosine phosphatase, receptor type, alpha polypeptideprotein-tyrosine phosphatase alphprotein SDA1 homologSDA1 domain-containing protein 1nucleolar protein 130
Modification date2018052720180523
UniProtAcc

P18433

Q9NVU7

Ensembl transtripts involved in fusion geneENST00000380393, ENST00000216877, 
ENST00000358719, ENST00000399903, 
ENST00000425918, ENST00000318266, 
ENST00000356147, 
ENST00000356260, 
ENST00000395711, ENST00000513089, 
Fusion gene scores* DoF score13 X 10 X 8=10401 X 1 X 1=1
# samples 141
** MAII scorelog2(14/1040*10)=-2.89308479608349
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: PTPRA [Title/Abstract] AND SDAD1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-22-A5C4-01APTPRAchr20

3018775

+SDAD1chr4

76879094

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000380393ENST00000356260PTPRAchr20

3018775

+SDAD1chr4

76879094

-
In-frameENST00000380393ENST00000395711PTPRAchr20

3018775

+SDAD1chr4

76879094

-
5CDS-intronENST00000380393ENST00000513089PTPRAchr20

3018775

+SDAD1chr4

76879094

-
In-frameENST00000216877ENST00000356260PTPRAchr20

3018775

+SDAD1chr4

76879094

-
In-frameENST00000216877ENST00000395711PTPRAchr20

3018775

+SDAD1chr4

76879094

-
5CDS-intronENST00000216877ENST00000513089PTPRAchr20

3018775

+SDAD1chr4

76879094

-
In-frameENST00000358719ENST00000356260PTPRAchr20

3018775

+SDAD1chr4

76879094

-
In-frameENST00000358719ENST00000395711PTPRAchr20

3018775

+SDAD1chr4

76879094

-
5CDS-intronENST00000358719ENST00000513089PTPRAchr20

3018775

+SDAD1chr4

76879094

-
In-frameENST00000399903ENST00000356260PTPRAchr20

3018775

+SDAD1chr4

76879094

-
In-frameENST00000399903ENST00000395711PTPRAchr20

3018775

+SDAD1chr4

76879094

-
5CDS-intronENST00000399903ENST00000513089PTPRAchr20

3018775

+SDAD1chr4

76879094

-
Frame-shitENST00000425918ENST00000356260PTPRAchr20

3018775

+SDAD1chr4

76879094

-
Frame-shitENST00000425918ENST00000395711PTPRAchr20

3018775

+SDAD1chr4

76879094

-
5CDS-intronENST00000425918ENST00000513089PTPRAchr20

3018775

+SDAD1chr4

76879094

-
In-frameENST00000318266ENST00000356260PTPRAchr20

3018775

+SDAD1chr4

76879094

-
In-frameENST00000318266ENST00000395711PTPRAchr20

3018775

+SDAD1chr4

76879094

-
5CDS-intronENST00000318266ENST00000513089PTPRAchr20

3018775

+SDAD1chr4

76879094

-
In-frameENST00000356147ENST00000356260PTPRAchr20

3018775

+SDAD1chr4

76879094

-
In-frameENST00000356147ENST00000395711PTPRAchr20

3018775

+SDAD1chr4

76879094

-
5CDS-intronENST00000356147ENST00000513089PTPRAchr20

3018775

+SDAD1chr4

76879094

-

Top

FusionProtFeatures for PTPRA_SDAD1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTPRA

P18433

SDAD1

Q9NVU7

Required for 60S pre-ribosomal subunits export to thecytoplasm. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTPRAchr20:3018775chr4:76879094ENST00000216877+123241_501-134794DomainTyrosine-protein phosphatase 1
HgenePTPRAchr20:3018775chr4:76879094ENST00000216877+123533_791-134794DomainTyrosine-protein phosphatase 2
HgenePTPRAchr20:3018775chr4:76879094ENST00000318266+124241_501-99794DomainTyrosine-protein phosphatase 1
HgenePTPRAchr20:3018775chr4:76879094ENST00000318266+124533_791-99794DomainTyrosine-protein phosphatase 2
HgenePTPRAchr20:3018775chr4:76879094ENST00000356147+123241_501-73794DomainTyrosine-protein phosphatase 1
HgenePTPRAchr20:3018775chr4:76879094ENST00000356147+123533_791-73794DomainTyrosine-protein phosphatase 2
HgenePTPRAchr20:3018775chr4:76879094ENST00000380393+128241_501-229803DomainTyrosine-protein phosphatase 1
HgenePTPRAchr20:3018775chr4:76879094ENST00000380393+128533_791-229803DomainTyrosine-protein phosphatase 2
HgenePTPRAchr20:3018775chr4:76879094ENST00000399903+124241_501-131803DomainTyrosine-protein phosphatase 1
HgenePTPRAchr20:3018775chr4:76879094ENST00000399903+124533_791-131803DomainTyrosine-protein phosphatase 2
HgenePTPRAchr20:3018775chr4:76879094ENST00000216877+123442_448-134794RegionSubstrate binding
HgenePTPRAchr20:3018775chr4:76879094ENST00000318266+124442_448-99794RegionSubstrate binding
HgenePTPRAchr20:3018775chr4:76879094ENST00000356147+123442_448-73794RegionSubstrate binding
HgenePTPRAchr20:3018775chr4:76879094ENST00000380393+128442_448-229803RegionSubstrate binding
HgenePTPRAchr20:3018775chr4:76879094ENST00000399903+124442_448-131803RegionSubstrate binding
HgenePTPRAchr20:3018775chr4:76879094ENST00000216877+123175_802-134794Topological domainCytoplasmic
HgenePTPRAchr20:3018775chr4:76879094ENST00000216877+12320_151-134794Topological domainExtracellular
HgenePTPRAchr20:3018775chr4:76879094ENST00000318266+124175_802-99794Topological domainCytoplasmic
HgenePTPRAchr20:3018775chr4:76879094ENST00000318266+12420_151-99794Topological domainExtracellular
HgenePTPRAchr20:3018775chr4:76879094ENST00000356147+123175_802-73794Topological domainCytoplasmic
HgenePTPRAchr20:3018775chr4:76879094ENST00000356147+12320_151-73794Topological domainExtracellular
HgenePTPRAchr20:3018775chr4:76879094ENST00000380393+128175_802-229803Topological domainCytoplasmic
HgenePTPRAchr20:3018775chr4:76879094ENST00000380393+12820_151-229803Topological domainExtracellular
HgenePTPRAchr20:3018775chr4:76879094ENST00000399903+124175_802-131803Topological domainCytoplasmic
HgenePTPRAchr20:3018775chr4:76879094ENST00000399903+12420_151-131803Topological domainExtracellular
HgenePTPRAchr20:3018775chr4:76879094ENST00000216877+123152_174-134794TransmembraneHelical
HgenePTPRAchr20:3018775chr4:76879094ENST00000318266+124152_174-99794TransmembraneHelical
HgenePTPRAchr20:3018775chr4:76879094ENST00000356147+123152_174-73794TransmembraneHelical
HgenePTPRAchr20:3018775chr4:76879094ENST00000380393+128152_174-229803TransmembraneHelical
HgenePTPRAchr20:3018775chr4:76879094ENST00000399903+124152_174-131803TransmembraneHelical
TgeneSDAD1chr20:3018775chr4:76879094ENST00000356260-1622253_315494688Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for PTPRA_SDAD1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTPRA_ENST00000380393_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_1177aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSGNSDSKDRRDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKY
KQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNR
TVNILPTDHSRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCW
TTGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQTAGAIVVHCSAGVGRTG
TFVVIDAMLDMMHTERKVDVTGFVSRIRAQRCQMVQTDMQTVFIYQALLEHTLTGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKL
TSIKIQNDKMRTGNLPANMKKNRVLQIIPTEFNRVIIPVKRGEENTDTVNASFIDGYRQKDSTIASQGPLLHTIEDFWRMIWEWKSCSIV
MLTELEERGQEKCAQYWPSDGLVSTGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQ
QQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQTEFCYKVVQETIDAFSDTANFK_AATRVRG
PGGLPLIFCNILFC_TTPNCVTIL_LF_KLVHRLLLPIRWKFTM_MC_H__SFFQCFIGELNSVMFGLIS_NPQPRNWAGLCFG_YIFP_
RR_TQNPFQVARHQLRKKAQSSQSSRGKWLSPYHHAL_ISLPSLPGPLPHPHH_THGE__DQSGISGTTLGTIR__KL_LPEENGWESTS
LSEEEDADGEWIDVQHSSDEEQQEISKKLNSMPMEERKAKAAAISTSRVLTQEDFQKIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRG
ELLSLRDIERLHKKPKSDKETRLATAMAGKTDRKEFVRKKTKTNPFSSSTNKEKKKQKNFMMMRTSQNVRSKNKRSFREKQLALRDALLK

>In-frame_PTPRA_ENST00000380393_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_1177aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSGNSDSKDRRDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKY
KQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNR
TVNILPTDHSRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCW
TTGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQTAGAIVVHCSAGVGRTG
TFVVIDAMLDMMHTERKVDVTGFVSRIRAQRCQMVQTDMQTVFIYQALLEHTLTGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKL
TSIKIQNDKMRTGNLPANMKKNRVLQIIPTEFNRVIIPVKRGEENTDTVNASFIDGYRQKDSTIASQGPLLHTIEDFWRMIWEWKSCSIV
MLTELEERGQEKCAQYWPSDGLVSTGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQ
QQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQTEFCYKVVQETIDAFSDTANFK_AATRVRG
PGGLPLIFCNILFC_TTPNCVTIL_LF_KLVHRLLLPIRWKFTM_MC_H__SFFQCFIGELNSVMFGLIS_NPQPRNWAGLCFG_YIFP_
RR_TQNPFQVARHQLRKKAQSSQSSRGKWLSPYHHAL_ISLPSLPGPLPHPHH_THGE__DQSGISGTTLGTIR__KL_LPEENGWESTS
LSEEEDADGEWIDVQHSSDEEQQEISKKLNSMPMEERKAKAAAISTSRVLTQEDFQKIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRG
ELLSLRDIERLHKKPKSDKETRLATAMAGKTDRKEFVRKKTKTNPFSSSTNKEKKKQKNFMMMRTSQNVRSKNKRSFREKQLALRDALLK

>In-frame_PTPRA_ENST00000216877_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_1302aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNS
FRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRTVNILPTDH
SRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCWTTGNIRVSV
EDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQTAGAIVVHCSAGVGRTGTFVVIDAML
DMMHTERKVDVTGFVSRIRAQRCQMVQTDMQTVFIYQALLEHTLTGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDK
MRTGNLPANMKKNRVLQIIPTEFNRVIIPVKRGEENTDTVNASFIDGYRQKDSTIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERG
QEKCAQYWPSDGLVSTGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPIT
VHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQTEFCYKVVQETIDAFSDTANFK_AATRVRGPGGLPLIFC
NILFC_TTPNCVTIL_LF_KLVHRLLLPIRWKFTM_MC_H__SFFQCFIGELNSVMFGLIS_NPQPRNWAGLCFG_YIFP_RR_TQNPFQ
VARHQLRKKAQSSQSSRGKWLSPYHHAL_ISLPSLPGPLPHPHH_THGE__DQSGISGTTLGTIR__KL_LPEEMSLPLSGGGAAIQAGA
LLGCSWPSCCCSL_VI_ERPQSPSSSCPPNTALPVLR_SPGPSFHSQHIFGLVVLASLPP_EGGQVLTESP_GQGHRGD_SWLSFGLRPV
_PLQSVVLCYKTVWIVSPTLG_IFMSTTNGWESTSLSEEEDADGEWIDVQHSSDEEQQEISKKLNSMPMEERKAKAAAISTSRVLTQEDF
QKIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRGELLSLRDIERLHKKPKSDKETRLATAMAGKTDRKEFVRKKTKTNPFSSSTNKEKK

>In-frame_PTPRA_ENST00000216877_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_1302aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNS
FRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRTVNILPTDH
SRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCWTTGNIRVSV
EDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQTAGAIVVHCSAGVGRTGTFVVIDAML
DMMHTERKVDVTGFVSRIRAQRCQMVQTDMQTVFIYQALLEHTLTGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDK
MRTGNLPANMKKNRVLQIIPTEFNRVIIPVKRGEENTDTVNASFIDGYRQKDSTIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERG
QEKCAQYWPSDGLVSTGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPIT
VHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQTEFCYKVVQETIDAFSDTANFK_AATRVRGPGGLPLIFC
NILFC_TTPNCVTIL_LF_KLVHRLLLPIRWKFTM_MC_H__SFFQCFIGELNSVMFGLIS_NPQPRNWAGLCFG_YIFP_RR_TQNPFQ
VARHQLRKKAQSSQSSRGKWLSPYHHAL_ISLPSLPGPLPHPHH_THGE__DQSGISGTTLGTIR__KL_LPEEMSLPLSGGGAAIQAGA
LLGCSWPSCCCSL_VI_ERPQSPSSSCPPNTALPVLR_SPGPSFHSQHIFGLVVLASLPP_EGGQVLTESP_GQGHRGD_SWLSFGLRPV
_PLQSVVLCYKTVWIVSPTLG_IFMSTTNGWESTSLSEEEDADGEWIDVQHSSDEEQQEISKKLNSMPMEERKAKAAAISTSRVLTQEDF
QKIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRGELLSLRDIERLHKKPKSDKETRLATAMAGKTDRKEFVRKKTKTNPFSSSTNKEKK

>In-frame_PTPRA_ENST00000358719_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_1031aa
MVALSSLLVIVFIIIVLYMLRRFRKAELMSRNTEKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRM
ADDNKLFREEFNALPACPIQATCEAASKEENKEKNRTVNILPTDHSRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDF
WRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCWTTGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVP
FTPIGMLKFLKKVKACNPQTAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVTGFVSRIRAQRCQMVQTDMQTVFIYQALLEHTLT
GDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNLPANMKKNRVLQIIPTEFNRVIIPVKRGEENTDTVNASFI
DGYRQKDSTIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSTGDITVELKKEEECESYTVRDLLVTNTREN
KSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHM
VQTLEQTEFCYKVVQETIDAFSDTANFK_AATRVRGPGGLPLIFCNILFC_TTPNCVTIL_LF_KLVHRLLLPIRWKFTM_MC_H__SFF
QCFIGELNSVMFGLIS_NPQPRNWAGLCFG_YIFP_RR_TQNPFQVARHQLRKKAQSSQSSRGKWLSPYHHAL_ISLPSLPGPLPHPHH_
THGE__DQSGISGTTLGTIR__KL_LPDGWESTSLSEEEDADGEWIDVQHSSDEEQQEISKKLNSMPMEERKAKAAAISTSRVLTQEDFQ
KIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRGELLSLRDIERLHKKPKSDKETRLATAMAGKTDRKEFVRKKTKTNPFSSSTNKEKKK

>In-frame_PTPRA_ENST00000358719_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_1031aa
MVALSSLLVIVFIIIVLYMLRRFRKAELMSRNTEKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRM
ADDNKLFREEFNALPACPIQATCEAASKEENKEKNRTVNILPTDHSRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDF
WRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCWTTGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVP
FTPIGMLKFLKKVKACNPQTAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVTGFVSRIRAQRCQMVQTDMQTVFIYQALLEHTLT
GDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNLPANMKKNRVLQIIPTEFNRVIIPVKRGEENTDTVNASFI
DGYRQKDSTIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSTGDITVELKKEEECESYTVRDLLVTNTREN
KSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHM
VQTLEQTEFCYKVVQETIDAFSDTANFK_AATRVRGPGGLPLIFCNILFC_TTPNCVTIL_LF_KLVHRLLLPIRWKFTM_MC_H__SFF
QCFIGELNSVMFGLIS_NPQPRNWAGLCFG_YIFP_RR_TQNPFQVARHQLRKKAQSSQSSRGKWLSPYHHAL_ISLPSLPGPLPHPHH_
THGE__DQSGISGTTLGTIR__KL_LPDGWESTSLSEEEDADGEWIDVQHSSDEEQQEISKKLNSMPMEERKAKAAAISTSRVLTQEDFQ
KIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRGELLSLRDIERLHKKPKSDKETRLATAMAGKTDRKEFVRKKTKTNPFSSSTNKEKKK

>In-frame_PTPRA_ENST00000399903_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_1175aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSGNSDSKDRRDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKY
KQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNR
TVNILPTDHSRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCW
TTGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQTAGAIVVHCSAGVGRTG
TFVVIDAMLDMMHTERKVDVTGFVSRIRAQRCQMVQTDMQTVFIYQALLEHTLTGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKL
TSIKIQNDKMRTGNLPANMKKNRVLQIIPTEFNRVIIPVKRGEENTDTVNASFIDGYRQKDSTIASQGPLLHTIEDFWRMIWEWKSCSIV
MLTELEERGQEKCAQYWPSDGLVSTGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQ
QQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQTEFCYKVVQETIDAFSDTANFK_AATRVRG
PGGLPLIFCNILFC_TTPNCVTIL_LF_KLVHRLLLPIRWKFTM_MC_H__SFFQCFIGELNSVMFGLIS_NPQPRNWAGLCFG_YIFP_
RR_TQNPFQVARHQLRKKAQSSQSSRGKWLSPYHHAL_ISLPSLPGPLPHPHH_THGE__DQSGISGTTLGTIR__KL_LPDGWESTSLS
EEEDADGEWIDVQHSSDEEQQEISKKLNSMPMEERKAKAAAISTSRVLTQEDFQKIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRGEL
LSLRDIERLHKKPKSDKETRLATAMAGKTDRKEFVRKKTKTNPFSSSTNKEKKKQKNFMMMRTSQNVRSKNKRSFREKQLALRDALLKKR

>In-frame_PTPRA_ENST00000399903_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_1175aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSGNSDSKDRRDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKY
KQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNR
TVNILPTDHSRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCW
TTGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQTAGAIVVHCSAGVGRTG
TFVVIDAMLDMMHTERKVDVTGFVSRIRAQRCQMVQTDMQTVFIYQALLEHTLTGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKL
TSIKIQNDKMRTGNLPANMKKNRVLQIIPTEFNRVIIPVKRGEENTDTVNASFIDGYRQKDSTIASQGPLLHTIEDFWRMIWEWKSCSIV
MLTELEERGQEKCAQYWPSDGLVSTGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQ
QQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQTEFCYKVVQETIDAFSDTANFK_AATRVRG
PGGLPLIFCNILFC_TTPNCVTIL_LF_KLVHRLLLPIRWKFTM_MC_H__SFFQCFIGELNSVMFGLIS_NPQPRNWAGLCFG_YIFP_
RR_TQNPFQVARHQLRKKAQSSQSSRGKWLSPYHHAL_ISLPSLPGPLPHPHH_THGE__DQSGISGTTLGTIR__KL_LPDGWESTSLS
EEEDADGEWIDVQHSSDEEQQEISKKLNSMPMEERKAKAAAISTSRVLTQEDFQKIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRGEL
LSLRDIERLHKKPKSDKETRLATAMAGKTDRKEFVRKKTKTNPFSSSTNKEKKKQKNFMMMRTSQNVRSKNKRSFREKQLALRDALLKKR

>In-frame_PTPRA_ENST00000318266_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_1168aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNS
FRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRTVNILPTDH
SRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCWTTGNIRVSV
EDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQTAGAIVVHCSAGVGRTGTFVVIDAML
DMMHTERKVDVTGFVSRIRAQRCQMVQTDMQTVFIYQALLEHTLTGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDK
MRTGNLPANMKKNRVLQIIPTEFNRVIIPVKRGEENTDTVNASFIDGYRQKDSTIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERG
QEKCAQYWPSDGLVSTGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPIT
VHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQTEFCYKVVQETIDAFSDTANFK_AATRVRGPGGLPLIFC
NILFC_TTPNCVTIL_LF_KLVHRLLLPIRWKFTM_MC_H__SFFQCFIGELNSVMFGLIS_NPQPRNWAGLCFG_YIFP_RR_TQNPFQ
VARHQLRKKAQSSQSSRGKWLSPYHHAL_ISLPSLPGPLPHPHH_THGE__DQSGISGTTLGTIR__KL_LPEENGWESTSLSEEEDADG
EWIDVQHSSDEEQQEISKKLNSMPMEERKAKAAAISTSRVLTQEDFQKIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRGELLSLRDIE

>In-frame_PTPRA_ENST00000318266_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_1168aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNS
FRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRTVNILPTDH
SRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCWTTGNIRVSV
EDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQTAGAIVVHCSAGVGRTGTFVVIDAML
DMMHTERKVDVTGFVSRIRAQRCQMVQTDMQTVFIYQALLEHTLTGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDK
MRTGNLPANMKKNRVLQIIPTEFNRVIIPVKRGEENTDTVNASFIDGYRQKDSTIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERG
QEKCAQYWPSDGLVSTGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPIT
VHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQTEFCYKVVQETIDAFSDTANFK_AATRVRGPGGLPLIFC
NILFC_TTPNCVTIL_LF_KLVHRLLLPIRWKFTM_MC_H__SFFQCFIGELNSVMFGLIS_NPQPRNWAGLCFG_YIFP_RR_TQNPFQ
VARHQLRKKAQSSQSSRGKWLSPYHHAL_ISLPSLPGPLPHPHH_THGE__DQSGISGTTLGTIR__KL_LPEENGWESTSLSEEEDADG
EWIDVQHSSDEEQQEISKKLNSMPMEERKAKAAAISTSRVLTQEDFQKIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRGELLSLRDIE

>In-frame_PTPRA_ENST00000356147_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_1166aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNS
FRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRTVNILPTDH
SRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCWTTGNIRVSV
EDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQTAGAIVVHCSAGVGRTGTFVVIDAML
DMMHTERKVDVTGFVSRIRAQRCQMVQTDMQTVFIYQALLEHTLTGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDK
MRTGNLPANMKKNRVLQIIPTEFNRVIIPVKRGEENTDTVNASFIDGYRQKDSTIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERG
QEKCAQYWPSDGLVSTGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPIT
VHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQTEFCYKVVQETIDAFSDTANFK_AATRVRGPGGLPLIFC
NILFC_TTPNCVTIL_LF_KLVHRLLLPIRWKFTM_MC_H__SFFQCFIGELNSVMFGLIS_NPQPRNWAGLCFG_YIFP_RR_TQNPFQ
VARHQLRKKAQSSQSSRGKWLSPYHHAL_ISLPSLPGPLPHPHH_THGE__DQSGISGTTLGTIR__KL_LPDGWESTSLSEEEDADGEW
IDVQHSSDEEQQEISKKLNSMPMEERKAKAAAISTSRVLTQEDFQKIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRGELLSLRDIERL

>In-frame_PTPRA_ENST00000356147_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_1166aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNS
FRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRTVNILPTDH
SRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCWTTGNIRVSV
EDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQTAGAIVVHCSAGVGRTGTFVVIDAML
DMMHTERKVDVTGFVSRIRAQRCQMVQTDMQTVFIYQALLEHTLTGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDK
MRTGNLPANMKKNRVLQIIPTEFNRVIIPVKRGEENTDTVNASFIDGYRQKDSTIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERG
QEKCAQYWPSDGLVSTGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPIT
VHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQTEFCYKVVQETIDAFSDTANFK_AATRVRGPGGLPLIFC
NILFC_TTPNCVTIL_LF_KLVHRLLLPIRWKFTM_MC_H__SFFQCFIGELNSVMFGLIS_NPQPRNWAGLCFG_YIFP_RR_TQNPFQ
VARHQLRKKAQSSQSSRGKWLSPYHHAL_ISLPSLPGPLPHPHH_THGE__DQSGISGTTLGTIR__KL_LPDGWESTSLSEEEDADGEW
IDVQHSSDEEQQEISKKLNSMPMEERKAKAAAISTSRVLTQEDFQKIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRGELLSLRDIERL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTPRA_ENST00000380393_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_3531nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGGTAATTCTGACTCGAAGGACAGAAGAGATGAGACA
CCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATAC
AAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGA
TCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTC
TTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGA
TATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTC
ATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAA
CAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGG
ACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGAC
ATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATG
CTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGT
ACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAG
CGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAA
GTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTA
ACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATAT
GAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAG
GACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTG
ATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTG
GAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGG
CAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAG
CAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAG
CGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAG
TATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGA
CCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTG
GTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAA
TTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAA
AGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTG
TCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAG
GACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGAGGAAAATGGATGGGAAAGTACCAGT
CTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAAC
AGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATG
GCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGT
GAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAG
ACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTT
ATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGAGATGCACTTTTGAAA

>In-frame_PTPRA_ENST00000380393_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_3531nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGGTAATTCTGACTCGAAGGACAGAAGAGATGAGACA
CCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATAC
AAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGA
TCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTC
TTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGA
TATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTC
ATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAA
CAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGG
ACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGAC
ATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATG
CTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGT
ACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAG
CGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAA
GTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTA
ACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATAT
GAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAG
GACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTG
ATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTG
GAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGG
CAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAG
CAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAG
CGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAG
TATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGA
CCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTG
GTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAA
TTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAA
AGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTG
TCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAG
GACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGAGGAAAATGGATGGGAAAGTACCAGT
CTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAAC
AGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATG
GCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGT
GAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAG
ACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTT
ATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGAGATGCACTTTTGAAA

>In-frame_PTPRA_ENST00000216877_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_3906nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTG
TCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCT
TTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCA
CCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCT
GCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCAC
TCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAA
TTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTT
ACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTA
GAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTC
ATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCC
TGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTG
GACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATG
CAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAG
AAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAG
ATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTT
AAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCT
CTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGC
CAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAG
AGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAA
GTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACC
GTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGAT
GTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAG
GAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGT
AATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGG
TGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATA
TCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAG
GTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATA
TCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACA
CTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGAGGAAATGTCTCTCCCTTTGTCTGGGGGTGGGGCAGCCATACAGGCTGGGGCT
CTCCTCGGCTGTTCATGGCCCTCCTGTTGCTGTTCTCTCTGAGTTATCTGAGAGAGGCCACAGTCCCCCAGCTCCTCCTGTCCACCAAAC
ACAGCCCTTCCAGTTCTTAGGTGATCTCCAGGACCCTCCTTTCATTCCCAGCACATCTTTGGTTTAGTGGTCCTGGCCAGCCTCCCTCCC
TAGGAAGGTGGCCAGGTCCTCACTGAGTCTCCTTAAGGACAGGGGCACAGGGGAGACTAGAGCTGGCTCAGCTTTGGGCTGAGGCCAGTC
TGACCTCTCCAGTCTGTGGTGCTTTGCTACAAAACTGTCTGGATTGTGTCACCCTATCTAGGATAAATCTTTATGTCCACATATAATGGA
TGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATC
TCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTC
CAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGAT
GAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACT
GCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAA
AAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGA

>In-frame_PTPRA_ENST00000216877_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_3906nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTG
TCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCT
TTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCA
CCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCT
GCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCAC
TCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAA
TTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTT
ACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTA
GAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTC
ATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCC
TGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTG
GACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATG
CAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAG
AAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAG
ATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTT
AAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCT
CTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGC
CAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAG
AGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAA
GTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACC
GTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGAT
GTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAG
GAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGT
AATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGG
TGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATA
TCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAG
GTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATA
TCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACA
CTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGAGGAAATGTCTCTCCCTTTGTCTGGGGGTGGGGCAGCCATACAGGCTGGGGCT
CTCCTCGGCTGTTCATGGCCCTCCTGTTGCTGTTCTCTCTGAGTTATCTGAGAGAGGCCACAGTCCCCCAGCTCCTCCTGTCCACCAAAC
ACAGCCCTTCCAGTTCTTAGGTGATCTCCAGGACCCTCCTTTCATTCCCAGCACATCTTTGGTTTAGTGGTCCTGGCCAGCCTCCCTCCC
TAGGAAGGTGGCCAGGTCCTCACTGAGTCTCCTTAAGGACAGGGGCACAGGGGAGACTAGAGCTGGCTCAGCTTTGGGCTGAGGCCAGTC
TGACCTCTCCAGTCTGTGGTGCTTTGCTACAAAACTGTCTGGATTGTGTCACCCTATCTAGGATAAATCTTTATGTCCACATATAATGGA
TGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATC
TCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTC
CAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGAT
GAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACT
GCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAA
AAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGA

>In-frame_PTPRA_ENST00000358719_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_3093nt
ATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGCGATTTAGAAAGGCTGAATTGATGAGC
AGGAATACAGAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGT
GTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATG
GCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAA
AACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGAT
TACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTC
TGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGG
CCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGC
ATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCT
TTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCA
GGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTG
AGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTAT
GGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAG
GAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTT
TTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCTTTATT
GATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGG
AAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCC
TATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAAT
AAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCC
GCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCC
CTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATG
GTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCG
GCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATATCTTA
TAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTC
CAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGT
TAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGC
TCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGA
TATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGATGGATGG
GAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCC
AAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAG
AAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAA
GAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCA
ATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAA
CAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGAGAT

>In-frame_PTPRA_ENST00000358719_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_3093nt
ATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGCGATTTAGAAAGGCTGAATTGATGAGC
AGGAATACAGAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGT
GTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATG
GCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAA
AACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGAT
TACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTC
TGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGG
CCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGC
ATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCT
TTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCA
GGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTG
AGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTAT
GGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAG
GAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTT
TTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCTTTATT
GATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGG
AAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCC
TATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAAT
AAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCC
GCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCC
CTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATG
GTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCG
GCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATATCTTA
TAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTC
CAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGT
TAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGC
TCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGA
TATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGATGGATGG
GAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCC
AAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAG
AAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAA
GAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCA
ATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAA
CAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGAGAT

>In-frame_PTPRA_ENST00000399903_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_3525nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGGTAATTCTGACTCGAAGGACAGAAGAGATGAGACA
CCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATAC
AAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGA
TCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTC
TTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGA
TATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTC
ATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAA
CAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGG
ACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGAC
ATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATG
CTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGT
ACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAG
CGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAA
GTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTA
ACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATAT
GAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAG
GACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTG
ATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTG
GAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGG
CAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAG
CAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAG
CGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAG
TATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGA
CCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTG
GTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAA
TTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAA
AGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTG
TCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAG
GACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGATGGATGGGAAAGTACCAGTCTCAGT
GAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATG
CCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAA
ATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTA
CTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGAC
CGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATG
ATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGAGATGCACTTTTGAAAAAGAGA

>In-frame_PTPRA_ENST00000399903_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_3525nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGGTAATTCTGACTCGAAGGACAGAAGAGATGAGACA
CCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATAC
AAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGA
TCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTC
TTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGA
TATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTC
ATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAA
CAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGG
ACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGAC
ATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATG
CTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGT
ACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAG
CGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAA
GTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTA
ACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATAT
GAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAG
GACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTG
ATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTG
GAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGG
CAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAG
CAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAG
CGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAG
TATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGA
CCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTG
GTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAA
TTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAA
AGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTG
TCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAG
GACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGATGGATGGGAAAGTACCAGTCTCAGT
GAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATG
CCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAA
ATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTA
CTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGAC
CGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATG
ATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGAGATGCACTTTTGAAAAAGAGA

>In-frame_PTPRA_ENST00000318266_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_3504nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTG
TCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCT
TTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCA
CCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCT
GCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCAC
TCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAA
TTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTT
ACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTA
GAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTC
ATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCC
TGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTG
GACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATG
CAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAG
AAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAG
ATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTT
AAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCT
CTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGC
CAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAG
AGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAA
GTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACC
GTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGAT
GTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAG
GAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGT
AATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGG
TGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATA
TCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAG
GTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATA
TCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACA
CTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGAGGAAAATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGT
GAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCC
AAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCT
GCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAA
CGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAG
AAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTC

>In-frame_PTPRA_ENST00000318266_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_3504nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTG
TCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCT
TTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCA
CCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCT
GCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCAC
TCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAA
TTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTT
ACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTA
GAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTC
ATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCC
TGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTG
GACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATG
CAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAG
AAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAG
ATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTT
AAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCT
CTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGC
CAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAG
AGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAA
GTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACC
GTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGAT
GTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAG
GAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGT
AATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGG
TGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATA
TCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAG
GTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATA
TCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACA
CTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGAGGAAAATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGT
GAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCC
AAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCT
GCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAA
CGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAG
AAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTC

>In-frame_PTPRA_ENST00000356147_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_3498nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTG
TCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCT
TTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCA
CCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCT
GCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCAC
TCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAA
TTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTT
ACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTA
GAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTC
ATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCC
TGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTG
GACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATG
CAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAG
AAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAG
ATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTT
AAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCT
CTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGC
CAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAG
AGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAA
GTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACC
GTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGAT
GTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAG
GAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGT
AATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGG
TGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATA
TCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAG
GTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATA
TCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACA
CTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGG
ATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCT
GCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCC
GGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTT
CATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACC
AAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCA

>In-frame_PTPRA_ENST00000356147_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_3498nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTG
TCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCT
TTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCA
CCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCT
GCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCAC
TCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAA
TTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTT
ACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTA
GAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTC
ATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCC
TGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTG
GACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATG
CAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAG
AAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAG
ATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTT
AAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCT
CTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGC
CAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAG
AGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAA
GTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACC
GTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGAT
GTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAG
GAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGT
AATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGG
TGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATA
TCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAG
GTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATA
TCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACA
CTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGG
ATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCT
GCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCC
GGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTT
CATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACC
AAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTPRA_ENST00000380393_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_5049nt
AAAACAAAGTGAAATGTAATCATACGATGTACTTTTTTTAATGCCGTTGAAACAGAGTTAATTTCCTTTAGCACACAAGTCTTAGAGACA
AAAGAAAAAAAGTGTTCACGGTGTTGCTGCACCTGAAGAACGAGCTGAACCGAGGAGATTTTTTCATGACCCTTCGGAATCAGCCCATGG
CCCTCAGTTTGTACCGACAGTTCTGTAAGCATCAGGAGCTAGAGACGCTGAAGGACCTTTACAATCAGGATGACAATCACCAGGAATTGG
GCAGCTTCCACATCCGAGCCAGCTATGCTGCAGAAGAGCGTATTGAGGGGCGAGTAGCAGCTCTGCAGACAGCCGCCGATGCCTTCTACA
AGGCCAAGAATGAGTTTGCAGCCAAGGCTACAGAGGATCAAATGCGGCTCCTACGGCTGCAGCGGCGCCTAGAAGACGAGCTGGGGGGCC
AGTTCCTAGACCTGTCTCTACATGACACAGTTACCACCCTCATTCTTGGCGGTCACAACAAGCGTGCAGAGCAGCTGGCACGTGACTTCC
GCATCCCTGACAAGAGGTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAA
CTAAGGACACATGTTCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGT
GGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCA
GTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGA
CCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCA
CCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCA
GAAACTTTCCCTCCTTCAGGTAATTCTGACTCGAAGGACAGAAGAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTG
CTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTA
TCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCC
GTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCT
ATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTC
CACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCT
GCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTG
AAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTG
ACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTCAG
TTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCT
CAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGATG
CATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATGTC
TTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTTAC
AACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGACT
GGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGC
GAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCAC
ACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAG
TGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACC
GTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATC
CCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACTGC
AGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAG
ACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATT
GATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTCTG
TTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAATTT
TATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAAAT
CCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTCGG
CACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCCCC
TCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGACT
ATCAGGTAATAAAAGCTTTGACTCCCTGAGGAAAATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATT
GATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCA
GCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGG
AAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCAT
AAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAA
ACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAA
AATAAGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGAGATGCACTTTTGAAAAAGAGAAAAAGAATGAAGTAACTTCCTGGCAAGTTT
TCCATTCCTAGAAGAATGCTAAGTTTGTGTCCTTGCTCTGAAAATTGGTAAATCAAGCATGTTTGTTTACATTAAAAAGTCCAGACACAC
TGTATTGTGAAAACTGCTGAACATGTGGCAGCAATTTTGTGTTTTTATTTTGGAGACGGCTAATGGTAGGAATGTTAATGTAAATAGTGG
TGGTAATGTAAAATCATTTCATTTATCATTCATGCAAAAAAAAGTATGTATTGAGTGCCTATTCATTGTCACTGTAGATGCAAAACGAAT
GAGCTGTAACCCCTTCACTCAAGGCATTGACAGCTTAGCTGTGAGGGTGGACACACATATGTGTATTTACAGTGCAGTGTAAATAGTTCT
GTAGTAGAGGTTAACTCCATATTTCTGTGAGGTCACTGAGGCCTTATGGACTAACTCTGTGAGGATAGGAGTTATATATTCTTATAAGAC
AAAACAAAACAGGACAATGTTACAAGAGTAAGAGGTTCTTACTTGTACATAGGCTTTCCTGCTGAAAACAGGCCCCTGCTGTACAGATTT
TGGGTACATAATTTAGCTCTTTTAGTCAATCCAAGAGATTTAAGTGACCCCCCCCCCCCCGTGTTTTTTTTGTTTTTGTTTTTGTTTTGA
ATGCCATGTAAAGGCTTTTTGGTTAAGACCTCACTTTTAAAACTGCCTTAAGTATAAATAGTACCTTTGGAATATATTTAGTTCATCATT
TGAGCTGCCTTCATACTGGTTTCCTCAGCCTTCCTTCAGCCTGTAATATTTTCAGCCCACTGTTTACCTTGTCTCAATAAAAGGTTTCTA

>In-frame_PTPRA_ENST00000380393_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_4679nt
AAAACAAAGTGAAATGTAATCATACGATGTACTTTTTTTAATGCCGTTGAAACAGAGTTAATTTCCTTTAGCACACAAGTCTTAGAGACA
AAAGAAAAAAAGTGTTCACGGTGTTGCTGCACCTGAAGAACGAGCTGAACCGAGGAGATTTTTTCATGACCCTTCGGAATCAGCCCATGG
CCCTCAGTTTGTACCGACAGTTCTGTAAGCATCAGGAGCTAGAGACGCTGAAGGACCTTTACAATCAGGATGACAATCACCAGGAATTGG
GCAGCTTCCACATCCGAGCCAGCTATGCTGCAGAAGAGCGTATTGAGGGGCGAGTAGCAGCTCTGCAGACAGCCGCCGATGCCTTCTACA
AGGCCAAGAATGAGTTTGCAGCCAAGGCTACAGAGGATCAAATGCGGCTCCTACGGCTGCAGCGGCGCCTAGAAGACGAGCTGGGGGGCC
AGTTCCTAGACCTGTCTCTACATGACACAGTTACCACCCTCATTCTTGGCGGTCACAACAAGCGTGCAGAGCAGCTGGCACGTGACTTCC
GCATCCCTGACAAGAGGTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAA
CTAAGGACACATGTTCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGT
GGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCA
GTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGA
CCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCA
CCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCA
GAAACTTTCCCTCCTTCAGGTAATTCTGACTCGAAGGACAGAAGAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTG
CTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTA
TCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCC
GTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCT
ATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTC
CACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCT
GCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTG
AAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTG
ACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTCAG
TTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCT
CAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGATG
CATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATGTC
TTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTTAC
AACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGACT
GGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGC
GAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCAC
ACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAG
TGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACC
GTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATC
CCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACTGC
AGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAG
ACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATT
GATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTCTG
TTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAATTT
TATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAAAT
CCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTCGG
CACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCCCC
TCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGACT
ATCAGGTAATAAAAGCTTTGACTCCCTGAGGAAAATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATT
GATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCA
GCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGG
AAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCAT
AAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAA
ACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAA
AATAAGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGAGATGCACTTTTGAAAAAGAGAAAAAGAATGAAGTAACTTCCTGGCAAGTTT
TCCATTCCTAGAAGAATGCTAAGTTTGTGTCCTTGCTCTGAAAATTGGTAAATCAAGCATGTTTGTTTACATTAAAAAGTCCAGACACAC
TGTATTGTGAAAACTGCTGAACATGTGGCAGCAATTTTGTGTTTTTATTTTGGAGACGGCTAATGGTAGGAATGTTAATGTAAATAGTGG
TGGTAATGTAAAATCATTTCATTTATCATTCATGCAAAAAAAAGTATGTATTGAGTGCCTATTCATTGTCACTGTAGATGCAAAACGAAT
GAGCTGTAACCCCTTCACTCAAGGCATTGACAGCTTAGCTGTGAGGGTGGACACACATATGTGTATTTACAGTGCAGTGTAAATAGTTCT

>In-frame_PTPRA_ENST00000216877_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_4970nt
AAAACAAAGTGAAATGTAATCATACGATGTACTTTTTTTAATGCCGTTGAAACAGAGTTAATTTCCTTTAGCACACAAGTCTTAGAGACA
AAAGAAAAAAAGGTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAA
GGACACATGTTCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTC
TGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTA
AAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCA
CCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAA
ATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAA
CTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGT
ACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCC
AGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGA
GAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGG
AGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATT
CTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATG
ATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGT
ACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGT
TCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGG
TGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCA
GTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCT
TTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATC
TCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGAT
TAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACC
GTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCT
TTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGG
AGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGG
TGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGG
AGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCA
TCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCT
GTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCAC
ACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGT
AAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATA
TCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCT
TTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCT
TTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTC
AGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACC
ACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGAGG
AAATGTCTCTCCCTTTGTCTGGGGGTGGGGCAGCCATACAGGCTGGGGCTCTCCTCGGCTGTTCATGGCCCTCCTGTTGCTGTTCTCTCT
GAGTTATCTGAGAGAGGCCACAGTCCCCCAGCTCCTCCTGTCCACCAAACACAGCCCTTCCAGTTCTTAGGTGATCTCCAGGACCCTCCT
TTCATTCCCAGCACATCTTTGGTTTAGTGGTCCTGGCCAGCCTCCCTCCCTAGGAAGGTGGCCAGGTCCTCACTGAGTCTCCTTAAGGAC
AGGGGCACAGGGGAGACTAGAGCTGGCTCAGCTTTGGGCTGAGGCCAGTCTGACCTCTCCAGTCTGTGGTGCTTTGCTACAAAACTGTCT
GGATTGTGTCACCCTATCTAGGATAAATCTTTATGTCCACATATAATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATG
GTGAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGG
CCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATG
CTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTG
AACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGA
AGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATG
TCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGAGATGCACTTTTGAAAAAGAGAAAAAGAATGAAGTAACTTC
CTGGCAAGTTTTCCATTCCTAGAAGAATGCTAAGTTTGTGTCCTTGCTCTGAAAATTGGTAAATCAAGCATGTTTGTTTACATTAAAAAG
TCCAGACACACTGTATTGTGAAAACTGCTGAACATGTGGCAGCAATTTTGTGTTTTTATTTTGGAGACGGCTAATGGTAGGAATGTTAAT
GTAAATAGTGGTGGTAATGTAAAATCATTTCATTTATCATTCATGCAAAAAAAAGTATGTATTGAGTGCCTATTCATTGTCACTGTAGAT
GCAAAACGAATGAGCTGTAACCCCTTCACTCAAGGCATTGACAGCTTAGCTGTGAGGGTGGACACACATATGTGTATTTACAGTGCAGTG
TAAATAGTTCTGTAGTAGAGGTTAACTCCATATTTCTGTGAGGTCACTGAGGCCTTATGGACTAACTCTGTGAGGATAGGAGTTATATAT
TCTTATAAGACAAAACAAAACAGGACAATGTTACAAGAGTAAGAGGTTCTTACTTGTACATAGGCTTTCCTGCTGAAAACAGGCCCCTGC
TGTACAGATTTTGGGTACATAATTTAGCTCTTTTAGTCAATCCAAGAGATTTAAGTGACCCCCCCCCCCCCGTGTTTTTTTTGTTTTTGT
TTTTGTTTTGAATGCCATGTAAAGGCTTTTTGGTTAAGACCTCACTTTTAAAACTGCCTTAAGTATAAATAGTACCTTTGGAATATATTT
AGTTCATCATTTGAGCTGCCTTCATACTGGTTTCCTCAGCCTTCCTTCAGCCTGTAATATTTTCAGCCCACTGTTTACCTTGTCTCAATA

>In-frame_PTPRA_ENST00000216877_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_4600nt
AAAACAAAGTGAAATGTAATCATACGATGTACTTTTTTTAATGCCGTTGAAACAGAGTTAATTTCCTTTAGCACACAAGTCTTAGAGACA
AAAGAAAAAAAGGTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAA
GGACACATGTTCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTC
TGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTA
AAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCA
CCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAA
ATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAA
CTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGT
ACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCC
AGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGA
GAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGG
AGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATT
CTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATG
ATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGT
ACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGT
TCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGG
TGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCA
GTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCT
TTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATC
TCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGAT
TAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACC
GTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCT
TTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGG
AGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGG
TGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGG
AGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCA
TCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCT
GTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCAC
ACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGT
AAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATA
TCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCT
TTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCT
TTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTC
AGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACC
ACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGAGG
AAATGTCTCTCCCTTTGTCTGGGGGTGGGGCAGCCATACAGGCTGGGGCTCTCCTCGGCTGTTCATGGCCCTCCTGTTGCTGTTCTCTCT
GAGTTATCTGAGAGAGGCCACAGTCCCCCAGCTCCTCCTGTCCACCAAACACAGCCCTTCCAGTTCTTAGGTGATCTCCAGGACCCTCCT
TTCATTCCCAGCACATCTTTGGTTTAGTGGTCCTGGCCAGCCTCCCTCCCTAGGAAGGTGGCCAGGTCCTCACTGAGTCTCCTTAAGGAC
AGGGGCACAGGGGAGACTAGAGCTGGCTCAGCTTTGGGCTGAGGCCAGTCTGACCTCTCCAGTCTGTGGTGCTTTGCTACAAAACTGTCT
GGATTGTGTCACCCTATCTAGGATAAATCTTTATGTCCACATATAATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATG
GTGAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGG
CCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATG
CTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTG
AACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGA
AGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATG
TCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGAGATGCACTTTTGAAAAAGAGAAAAAGAATGAAGTAACTTC
CTGGCAAGTTTTCCATTCCTAGAAGAATGCTAAGTTTGTGTCCTTGCTCTGAAAATTGGTAAATCAAGCATGTTTGTTTACATTAAAAAG
TCCAGACACACTGTATTGTGAAAACTGCTGAACATGTGGCAGCAATTTTGTGTTTTTATTTTGGAGACGGCTAATGGTAGGAATGTTAAT
GTAAATAGTGGTGGTAATGTAAAATCATTTCATTTATCATTCATGCAAAAAAAAGTATGTATTGAGTGCCTATTCATTGTCACTGTAGAT
GCAAAACGAATGAGCTGTAACCCCTTCACTCAAGGCATTGACAGCTTAGCTGTGAGGGTGGACACACATATGTGTATTTACAGTGCAGTG
TAAATAGTTCTGTAGTAGAGGTTAACTCCATATTTCTGTGAGGTCACTGAGGCCTTATGGACTAACTCTGTGAGGATAGGAGTTATATAT

>In-frame_PTPRA_ENST00000358719_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_4595nt
AAAACAAAGTGAAATGTAATCATACGATGTACTTTTTTTAATGCCGTTGAAACAGAGTTAATTTCCTTTAGCACACAAGTCTTAGAGACA
AAAGAAAAAAAGGTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAA
GGACACATGTTCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTC
TGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTA
AAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCA
CCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAA
ATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAA
CTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGT
ACATGTTAAGGCGATTTAGAAAGGCTGAATTGATGAGCAGGAATACAGAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCT
TATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGC
CCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTC
CTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAG
TCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTG
CTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACC
TGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATG
TGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTC
AGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACC
CTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGA
TGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATG
TCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTT
ACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGA
CTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGG
GCGAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCC
ACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGA
AGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACA
CCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCA
TCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACT
GCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCC
AGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATA
TTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTC
TGTTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAAT
TTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAA
ATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTC
GGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCC
CCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGA
CTATCAGGTAATAAAAGCTTTGACTCCCTGATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATG
TGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCA
TCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAAT
CCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAA
AGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAA
ATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATA
AGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGAGATGCACTTTTGAAAAAGAGAAAAAGAATGAAGTAACTTCCTGGCAAGTTTTCCA
TTCCTAGAAGAATGCTAAGTTTGTGTCCTTGCTCTGAAAATTGGTAAATCAAGCATGTTTGTTTACATTAAAAAGTCCAGACACACTGTA
TTGTGAAAACTGCTGAACATGTGGCAGCAATTTTGTGTTTTTATTTTGGAGACGGCTAATGGTAGGAATGTTAATGTAAATAGTGGTGGT
AATGTAAAATCATTTCATTTATCATTCATGCAAAAAAAAGTATGTATTGAGTGCCTATTCATTGTCACTGTAGATGCAAAACGAATGAGC
TGTAACCCCTTCACTCAAGGCATTGACAGCTTAGCTGTGAGGGTGGACACACATATGTGTATTTACAGTGCAGTGTAAATAGTTCTGTAG
TAGAGGTTAACTCCATATTTCTGTGAGGTCACTGAGGCCTTATGGACTAACTCTGTGAGGATAGGAGTTATATATTCTTATAAGACAAAA
CAAAACAGGACAATGTTACAAGAGTAAGAGGTTCTTACTTGTACATAGGCTTTCCTGCTGAAAACAGGCCCCTGCTGTACAGATTTTGGG
TACATAATTTAGCTCTTTTAGTCAATCCAAGAGATTTAAGTGACCCCCCCCCCCCCGTGTTTTTTTTGTTTTTGTTTTTGTTTTGAATGC
CATGTAAAGGCTTTTTGGTTAAGACCTCACTTTTAAAACTGCCTTAAGTATAAATAGTACCTTTGGAATATATTTAGTTCATCATTTGAG
CTGCCTTCATACTGGTTTCCTCAGCCTTCCTTCAGCCTGTAATATTTTCAGCCCACTGTTTACCTTGTCTCAATAAAAGGTTTCTAATGC

>In-frame_PTPRA_ENST00000358719_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_4225nt
AAAACAAAGTGAAATGTAATCATACGATGTACTTTTTTTAATGCCGTTGAAACAGAGTTAATTTCCTTTAGCACACAAGTCTTAGAGACA
AAAGAAAAAAAGGTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAA
GGACACATGTTCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTC
TGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTA
AAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCA
CCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAA
ATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAA
CTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGT
ACATGTTAAGGCGATTTAGAAAGGCTGAATTGATGAGCAGGAATACAGAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCT
TATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGC
CCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTC
CTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAG
TCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTG
CTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACC
TGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATG
TGACTGTCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTC
AGTTCCACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACC
CTCAGTATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGA
TGCATACAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATG
TCTTCATATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTT
ACAACAAAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGA
CTGGAAACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGG
GCGAAGAGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCC
ACACAATTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGA
AGTGTGCCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACA
CCGTCCGAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCA
TCCCCAGTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACT
GCAGCGCCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCC
AGACTGTCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATA
TTGATGCATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTC
TGTTTTGTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAAT
TTTATATGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAA
ATCCTCAGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTC
GGCACCAACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCC
CCTCTCTCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGA
CTATCAGGTAATAAAAGCTTTGACTCCCTGATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATG
TGCAACACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCA
TCAGCACTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAAT
CCCAGAAGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAA
AGCCAAAGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAA
ATCCATTTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATA
AGCGTTCCTTCCGAGAAAAACAGTTGGCACTACGAGATGCACTTTTGAAAAAGAGAAAAAGAATGAAGTAACTTCCTGGCAAGTTTTCCA
TTCCTAGAAGAATGCTAAGTTTGTGTCCTTGCTCTGAAAATTGGTAAATCAAGCATGTTTGTTTACATTAAAAAGTCCAGACACACTGTA
TTGTGAAAACTGCTGAACATGTGGCAGCAATTTTGTGTTTTTATTTTGGAGACGGCTAATGGTAGGAATGTTAATGTAAATAGTGGTGGT
AATGTAAAATCATTTCATTTATCATTCATGCAAAAAAAAGTATGTATTGAGTGCCTATTCATTGTCACTGTAGATGCAAAACGAATGAGC
TGTAACCCCTTCACTCAAGGCATTGACAGCTTAGCTGTGAGGGTGGACACACATATGTGTATTTACAGTGCAGTGTAAATAGTTCTGTAG

>In-frame_PTPRA_ENST00000399903_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_4589nt
AAAACAAAGTGAAATGTAATCATACGATGTACTTTTTTTAATGCCGTTGAAACAGAGTTAATTTCCTTTAGCACACAAGTCTTAGAGACA
AAAGAAAAAAAGGTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAA
GGACACATGTTCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTC
TGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTA
AAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCA
CCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAA
ATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAA
CTTTCCCTCCTTCAGGTAATTCTGACTCGAAGGACAGAAGAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAG
TGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCA
ACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGG
ACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCC
AGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACC
TGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCAC
AAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGG
AGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTG
TCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCC
ACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGT
ATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATA
CAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCA
TATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACA
AAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAA
ACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAG
AGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAA
TTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTG
CCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCC
GAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCA
GTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCG
CCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTG
TCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATG
CATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTT
GTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATA
TGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTC
AGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACC
AACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTC
TCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCA
GGTAATAAAAGCTTTGACTCCCTGATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAAC
ACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCA
CTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGA
AGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAA
AGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCAT
TTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTT
CCTTCCGAGAAAAACAGTTGGCACTACGAGATGCACTTTTGAAAAAGAGAAAAAGAATGAAGTAACTTCCTGGCAAGTTTTCCATTCCTA
GAAGAATGCTAAGTTTGTGTCCTTGCTCTGAAAATTGGTAAATCAAGCATGTTTGTTTACATTAAAAAGTCCAGACACACTGTATTGTGA
AAACTGCTGAACATGTGGCAGCAATTTTGTGTTTTTATTTTGGAGACGGCTAATGGTAGGAATGTTAATGTAAATAGTGGTGGTAATGTA
AAATCATTTCATTTATCATTCATGCAAAAAAAAGTATGTATTGAGTGCCTATTCATTGTCACTGTAGATGCAAAACGAATGAGCTGTAAC
CCCTTCACTCAAGGCATTGACAGCTTAGCTGTGAGGGTGGACACACATATGTGTATTTACAGTGCAGTGTAAATAGTTCTGTAGTAGAGG
TTAACTCCATATTTCTGTGAGGTCACTGAGGCCTTATGGACTAACTCTGTGAGGATAGGAGTTATATATTCTTATAAGACAAAACAAAAC
AGGACAATGTTACAAGAGTAAGAGGTTCTTACTTGTACATAGGCTTTCCTGCTGAAAACAGGCCCCTGCTGTACAGATTTTGGGTACATA
ATTTAGCTCTTTTAGTCAATCCAAGAGATTTAAGTGACCCCCCCCCCCCCGTGTTTTTTTTGTTTTTGTTTTTGTTTTGAATGCCATGTA
AAGGCTTTTTGGTTAAGACCTCACTTTTAAAACTGCCTTAAGTATAAATAGTACCTTTGGAATATATTTAGTTCATCATTTGAGCTGCCT

>In-frame_PTPRA_ENST00000399903_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_4219nt
AAAACAAAGTGAAATGTAATCATACGATGTACTTTTTTTAATGCCGTTGAAACAGAGTTAATTTCCTTTAGCACACAAGTCTTAGAGACA
AAAGAAAAAAAGGTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAA
GGACACATGTTCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTC
TGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTA
AAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCA
CCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAA
ATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAA
CTTTCCCTCCTTCAGGTAATTCTGACTCGAAGGACAGAAGAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAG
TGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCA
ACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGG
ACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCC
AGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACC
TGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCAC
AAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGG
AGAGAAAGGAGTGCAAGTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTG
TCCTGGTGGACTACACAGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCC
ACTTTACCAGCTGGCCAGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGT
ATGCAGGGGCCATCGTGGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATA
CAGAACGGAAGGTGGACGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCA
TATACCAAGCCCTTCTGGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACA
AAATCCCAGGGACCAGCAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAA
ACCTTCCAGCCAACATGAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAG
AGAATACAGACTATGTGAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAA
TTGAGGACTTCTGGCGAATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTG
CCCAGTACTGGCCATCTGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCC
GAGACCTCCTGGTCACCAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCA
GTGACGGAAAGGGCATGATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCG
CCGGGGCAGGAAGGACGGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTG
TCAAGAGCCTGCGGCTACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATG
CATTCTCAGATTATGCCAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTT
GTTAATATACCCCAAATTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATA
TGTAAATGTGTTAGCACTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTC
AGCCGAGAAATTGGGCTGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACC
AACTAAGAAAAAAAGCACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTC
TCCCTGGTCCCCTCCCCCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCA
GGTAATAAAAGCTTTGACTCCCTGATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAAC
ACTCTTCCGATGAAGAACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCA
CTAGCCGAGTTTTAACTCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGA
AGAGGAAATACATTGAAATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAA
AGTCTGACAAAGAGACAAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCAT
TTTCCAGTTCGACAAATAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTT
CCTTCCGAGAAAAACAGTTGGCACTACGAGATGCACTTTTGAAAAAGAGAAAAAGAATGAAGTAACTTCCTGGCAAGTTTTCCATTCCTA
GAAGAATGCTAAGTTTGTGTCCTTGCTCTGAAAATTGGTAAATCAAGCATGTTTGTTTACATTAAAAAGTCCAGACACACTGTATTGTGA
AAACTGCTGAACATGTGGCAGCAATTTTGTGTTTTTATTTTGGAGACGGCTAATGGTAGGAATGTTAATGTAAATAGTGGTGGTAATGTA
AAATCATTTCATTTATCATTCATGCAAAAAAAAGTATGTATTGAGTGCCTATTCATTGTCACTGTAGATGCAAAACGAATGAGCTGTAAC
CCCTTCACTCAAGGCATTGACAGCTTAGCTGTGAGGGTGGACACACATATGTGTATTTACAGTGCAGTGTAAATAGTTCTGTAGTAGAGG

>In-frame_PTPRA_ENST00000318266_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_4658nt
AAAACAAAGTGAAATGTAATCATACGATGTACTTTTTTTAATGCCGTTGAAACAGAGTTAATTTCCTTTAGCACACAAGTCTTAGAGACA
AAAGAAAAAAAGGTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAA
GGACACATGTTCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAGACTTCTTCAGAAGCTTGCCAGTTTTTCAAGCTGATTTCTCTCACT
GGCAACTCTTCAGAGTGCTGTTCCTACTCCACCCTCCCCTGGTGATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTC
TGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTA
AAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCA
CCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAA
ATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAA
CTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGT
ACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCC
AGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGA
GAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGG
AGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATT
CTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATG
ATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGT
ACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGT
TCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGG
TGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCA
GTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCT
TTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATC
TCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGAT
TAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACC
GTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCT
TTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGG
AGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGG
TGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGG
AGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCA
TCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCT
GTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCAC
ACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGT
AAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATA
TCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCT
TTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCT
TTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTC
AGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACC
ACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGAGG
AAAATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGC
AAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGG
AAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAG
ACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGAC
TAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAG
AGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACAGTTGG
CACTACGAGATGCACTTTTGAAAAAGAGAAAAAGAATGAAGTAACTTCCTGGCAAGTTTTCCATTCCTAGAAGAATGCTAAGTTTGTGTC
CTTGCTCTGAAAATTGGTAAATCAAGCATGTTTGTTTACATTAAAAAGTCCAGACACACTGTATTGTGAAAACTGCTGAACATGTGGCAG
CAATTTTGTGTTTTTATTTTGGAGACGGCTAATGGTAGGAATGTTAATGTAAATAGTGGTGGTAATGTAAAATCATTTCATTTATCATTC
ATGCAAAAAAAAGTATGTATTGAGTGCCTATTCATTGTCACTGTAGATGCAAAACGAATGAGCTGTAACCCCTTCACTCAAGGCATTGAC
AGCTTAGCTGTGAGGGTGGACACACATATGTGTATTTACAGTGCAGTGTAAATAGTTCTGTAGTAGAGGTTAACTCCATATTTCTGTGAG
GTCACTGAGGCCTTATGGACTAACTCTGTGAGGATAGGAGTTATATATTCTTATAAGACAAAACAAAACAGGACAATGTTACAAGAGTAA
GAGGTTCTTACTTGTACATAGGCTTTCCTGCTGAAAACAGGCCCCTGCTGTACAGATTTTGGGTACATAATTTAGCTCTTTTAGTCAATC
CAAGAGATTTAAGTGACCCCCCCCCCCCCGTGTTTTTTTTGTTTTTGTTTTTGTTTTGAATGCCATGTAAAGGCTTTTTGGTTAAGACCT
CACTTTTAAAACTGCCTTAAGTATAAATAGTACCTTTGGAATATATTTAGTTCATCATTTGAGCTGCCTTCATACTGGTTTCCTCAGCCT

>In-frame_PTPRA_ENST00000318266_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_4288nt
AAAACAAAGTGAAATGTAATCATACGATGTACTTTTTTTAATGCCGTTGAAACAGAGTTAATTTCCTTTAGCACACAAGTCTTAGAGACA
AAAGAAAAAAAGGTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAA
GGACACATGTTCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAGACTTCTTCAGAAGCTTGCCAGTTTTTCAAGCTGATTTCTCTCACT
GGCAACTCTTCAGAGTGCTGTTCCTACTCCACCCTCCCCTGGTGATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTC
TGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTA
AAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCA
CCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAA
ATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAA
CTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGT
ACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCC
AGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGA
GAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGG
AGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATT
CTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATG
ATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGTGCAAGTGCGCCCAGT
ACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTGTCCTGGTGGACTACACAGTACGGAAGT
TCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCCACTTTACCAGCTGGCCAGACTTTGGGG
TGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGTATGCAGGGGCCATCGTGGTCCACTGCA
GTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATACAGAACGGAAGGTGGACGTGTATGGCT
TTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCATATACCAAGCCCTTCTGGAGCATTATC
TCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACAAAATCCCAGGGACCAGCAACAATGGAT
TAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAAACCTTCCAGCCAACATGAAGAAGAACC
GTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAGAGAATACAGACTATGTGAACGCATCCT
TTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAATTGAGGACTTCTGGCGAATGATCTGGG
AGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTGCCCAGTACTGGCCATCTGATGGACTGG
TGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCCGAGACCTCCTGGTCACCAACACCAGGG
AGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCAGTGACGGAAAGGGCATGATCAGCATCA
TCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCGCCGGGGCAGGAAGGACGGGGACCTTCT
GTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTGTCAAGAGCCTGCGGCTACAGAGGCCAC
ACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATGCATTCTCAGATTATGCCAACTTCAAGT
AAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTTGTTAATATACCCCAAATTGTGTATATA
TCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATATGTAAATGTGTTAGCACTGATAGTCCT
TTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTCAGCCGAGAAATTGGGCTGGATTGTGCT
TTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACCAACTAAGAAAAAAAGCACAAAGTTCTC
AGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTCTCCCTGGTCCCCTCCCCCATCCCCACC
ACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCAGGTAATAAAAGCTTTGACTCCCTGAGG
AAAATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAACACTCTTCCGATGAAGAACAGC
AAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAACTCAGG
AAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGAAATAG
ACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGACAAGAC
TAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAATAAAG
AGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACAGTTGG
CACTACGAGATGCACTTTTGAAAAAGAGAAAAAGAATGAAGTAACTTCCTGGCAAGTTTTCCATTCCTAGAAGAATGCTAAGTTTGTGTC
CTTGCTCTGAAAATTGGTAAATCAAGCATGTTTGTTTACATTAAAAAGTCCAGACACACTGTATTGTGAAAACTGCTGAACATGTGGCAG
CAATTTTGTGTTTTTATTTTGGAGACGGCTAATGGTAGGAATGTTAATGTAAATAGTGGTGGTAATGTAAAATCATTTCATTTATCATTC
ATGCAAAAAAAAGTATGTATTGAGTGCCTATTCATTGTCACTGTAGATGCAAAACGAATGAGCTGTAACCCCTTCACTCAAGGCATTGAC
AGCTTAGCTGTGAGGGTGGACACACATATGTGTATTTACAGTGCAGTGTAAATAGTTCTGTAGTAGAGGTTAACTCCATATTTCTGTGAG

>In-frame_PTPRA_ENST00000356147_chr20_3018775_+_SDAD1_ENST00000356260_chr4_76879094_-_4573nt
AAAACAAAGTGAAATGTAATCATACGATGTACTTTTTTTAATGCCGTTGAAACAGAGTTAATTTCCTTTAGCACACAAGTCTTAGAGACA
AAAGAAAAAAAGGACACATGTTCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAGACTTCTTCAGAAGCTTGCCAGTTTTTCAAGCTGA
TTTCTCTCACTGGCAACTCTTCAGAGTGCTGTTCCTACTCCACCCTCCCCTGGTGATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCT
CGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGC
AGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAAC
TCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTAC
AATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAAC
CACTCCAGAAACTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTAT
CATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGA
TGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGA
AATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGC
TGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGG
GGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGA
AACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGTGCAA
GTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTGTCCTGGTGGACTACAC
AGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCCACTTTACCAGCTGGCC
AGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGTATGCAGGGGCCATCGT
GGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATACAGAACGGAAGGTGGA
CGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCATATACCAAGCCCTTCT
GGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACAAAATCCCAGGGACCAG
CAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAAACCTTCCAGCCAACAT
GAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAGAGAATACAGACTATGT
GAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAATTGAGGACTTCTGGCG
AATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTGCCCAGTACTGGCCATC
TGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCCGAGACCTCCTGGTCAC
CAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCAGTGACGGAAAGGGCAT
GATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCGCCGGGGCAGGAAGGAC
GGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTGTCAAGAGCCTGCGGCT
ACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATGCATTCTCAGATTATGC
CAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTTGTTAATATACCCCAAA
TTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATATGTAAATGTGTTAGCA
CTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTCAGCCGAGAAATTGGGC
TGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACCAACTAAGAAAAAAAGC
ACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTCTCCCTGGTCCCCTCCC
CCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCAGGTAATAAAAGCTTTG
ACTCCCTGATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAACACTCTTCCGATGAAGA
ACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAAC
TCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGA
AATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGAC
AAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAA
TAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACA
GTTGGCACTACGAGATGCACTTTTGAAAAAGAGAAAAAGAATGAAGTAACTTCCTGGCAAGTTTTCCATTCCTAGAAGAATGCTAAGTTT
GTGTCCTTGCTCTGAAAATTGGTAAATCAAGCATGTTTGTTTACATTAAAAAGTCCAGACACACTGTATTGTGAAAACTGCTGAACATGT
GGCAGCAATTTTGTGTTTTTATTTTGGAGACGGCTAATGGTAGGAATGTTAATGTAAATAGTGGTGGTAATGTAAAATCATTTCATTTAT
CATTCATGCAAAAAAAAGTATGTATTGAGTGCCTATTCATTGTCACTGTAGATGCAAAACGAATGAGCTGTAACCCCTTCACTCAAGGCA
TTGACAGCTTAGCTGTGAGGGTGGACACACATATGTGTATTTACAGTGCAGTGTAAATAGTTCTGTAGTAGAGGTTAACTCCATATTTCT
GTGAGGTCACTGAGGCCTTATGGACTAACTCTGTGAGGATAGGAGTTATATATTCTTATAAGACAAAACAAAACAGGACAATGTTACAAG
AGTAAGAGGTTCTTACTTGTACATAGGCTTTCCTGCTGAAAACAGGCCCCTGCTGTACAGATTTTGGGTACATAATTTAGCTCTTTTAGT
CAATCCAAGAGATTTAAGTGACCCCCCCCCCCCCGTGTTTTTTTTGTTTTTGTTTTTGTTTTGAATGCCATGTAAAGGCTTTTTGGTTAA
GACCTCACTTTTAAAACTGCCTTAAGTATAAATAGTACCTTTGGAATATATTTAGTTCATCATTTGAGCTGCCTTCATACTGGTTTCCTC

>In-frame_PTPRA_ENST00000356147_chr20_3018775_+_SDAD1_ENST00000395711_chr4_76879094_-_4203nt
AAAACAAAGTGAAATGTAATCATACGATGTACTTTTTTTAATGCCGTTGAAACAGAGTTAATTTCCTTTAGCACACAAGTCTTAGAGACA
AAAGAAAAAAAGGACACATGTTCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAGACTTCTTCAGAAGCTTGCCAGTTTTTCAAGCTGA
TTTCTCTCACTGGCAACTCTTCAGAGTGCTGTTCCTACTCCACCCTCCCCTGGTGATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCT
CGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGC
AGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAAC
TCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTAC
AATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAAC
CACTCCAGAAACTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTAT
CATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGA
TGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGA
AATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGC
TGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGG
GGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGA
AACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGTGCAA
GTGCGCCCAGTACTGGCCAGACCAAGGCTGCTGGACCTATGGGAATATTCGGGTGTCTGTAGAGGATGTGACTGTCCTGGTGGACTACAC
AGTACGGAAGTTCTGCATCCAGCAGGTGGGCGACATGACCAACAGAAAGCCACAGCGCCTCATCACTCAGTTCCACTTTACCAGCTGGCC
AGACTTTGGGGTGCCTTTTACCCCGATCGGCATGCTCAAGTTCCTCAAGAAGGTGAAGGCCTGTAACCCTCAGTATGCAGGGGCCATCGT
GGTCCACTGCAGTGCAGGTGTAGGGCGTACAGGTACCTTTGTCGTCATTGATGCCATGCTGGACATGATGCATACAGAACGGAAGGTGGA
CGTGTATGGCTTTGTGAGCCGGATCCGGGCACAGCGCTGCCAGATGGTGCAAACCGATATGCAGTATGTCTTCATATACCAAGCCCTTCT
GGAGCATTATCTCTATGGAGATACAGAACTGGAAGTGACCTCTCTAGAAACCCACCTGCAGAAAATTTACAACAAAATCCCAGGGACCAG
CAACAATGGATTAGAGGAGGAGTTTAAGAAGTTAACATCAATCAAAATCCAGAATGACAAGATGCGGACTGGAAACCTTCCAGCCAACAT
GAAGAAGAACCGTGTTTTACAGATCATTCCATATGAATTCAACAGAGTGATCATTCCAGTTAAGCGGGGCGAAGAGAATACAGACTATGT
GAACGCATCCTTTATTGATGGCTACCGGCAGAAGGACTCCTATATCGCCAGCCAGGGCCCTCTTCTCCACACAATTGAGGACTTCTGGCG
AATGATCTGGGAGTGGAAATCCTGCTCTATCGTGATGCTAACAGAACTGGAGGAGAGAGGCCAGGAGAAGTGTGCCCAGTACTGGCCATC
TGATGGACTGGTGTCCTATGGAGATATTACAGTGGAACTGAAGAAGGAGGAGGAATGTGAGAGCTACACCGTCCGAGACCTCCTGGTCAC
CAACACCAGGGAGAATAAGAGCCGGCAGATCCGGCAGTTCCACTTCCATGGCTGGCCTGAAGTGGGCATCCCCAGTGACGGAAAGGGCAT
GATCAGCATCATCGCCGCCGTGCAGAAGCAGCAGCAGCAGTCAGGGAACCACCCCATCACCGTGCACTGCAGCGCCGGGGCAGGAAGGAC
GGGGACCTTCTGTGCCCTGAGCACCGTCCTGGAGCGTGTGAAAGCAGAGGGGATTTTGGATGTCTTCCAGACTGTCAAGAGCCTGCGGCT
ACAGAGGCCACACATGGTCCAGACACTGGAACAGTATGAGTTCTGCTACAAGGTGGTGCAGGAGTATATTGATGCATTCTCAGATTATGC
CAACTTCAAGTAAGCGGCAACAAGGGTCCGTGGACCAGGAGGATTGCCTTTAATATTTTGTAATATTCTGTTTTGTTAATATACCCCAAA
TTGTGTATATATCTTATAACTGTTTTAGAAATTGGTACATAGGCTTCTATTACCTATTAGGTGGAAATTTTATATGTAAATGTGTTAGCA
CTGATAGTCCTTTTTCCAATGTTTTATTGGGGAATTAAATAGTGTGATGTTTGGATTGATATCGTGAAATCCTCAGCCGAGAAATTGGGC
TGGATTGTGCTTTGGTTAATACATCTTTCCCTAAAGAAGATAAACACAAAATCCATTCCAGGTAGCTCGGCACCAACTAAGAAAAAAAGC
ACAAAGTTCTCAGAGCTCTCGAGGAAAGTGGTTGTCCCCGTACCACCATGCACTGTAAATATCCCTCCCCTCTCTCCCTGGTCCCCTCCC
CCATCCCCACCACTGATATCATGGGGAGTAATAGGACCAGAGCGGTATCTCTGGCACCACACTAGGGACTATCAGGTAATAAAAGCTTTG
ACTCCCTGATGGATGGGAAAGTACCAGTCTCAGTGAGGAGGAGGATGCTGATGGTGAATGGATTGATGTGCAACACTCTTCCGATGAAGA
ACAGCAAGAAATCTCCAAGAAGCTGAACAGCATGCCCATGGAGGAGCGGAAGGCCAAAGCTGCAGCCATCAGCACTAGCCGAGTTTTAAC
TCAGGAAGACTTCCAGAAAATCCGCATGGCCCAAATGAGAAAAGAACTTGATGCTGCCCCCGGGAAATCCCAGAAGAGGAAATACATTGA
AATAGACAGTGATGAAGAGCCCAGGGGTGAATTACTTTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCAAAGTCTGACAAAGAGAC
AAGACTAGCAACTGCAATGGCTGGAAAGACAGACCGAAAAGAATTTGTGAGGAAGAAAACCAAAACAAATCCATTTTCCAGTTCGACAAA
TAAAGAGAAGAAAAAACAGAAGAACTTTATGATGATGCGGTATAGCCAGAATGTCCGGTCAAAAAATAAGCGTTCCTTCCGAGAAAAACA
GTTGGCACTACGAGATGCACTTTTGAAAAAGAGAAAAAGAATGAAGTAACTTCCTGGCAAGTTTTCCATTCCTAGAAGAATGCTAAGTTT
GTGTCCTTGCTCTGAAAATTGGTAAATCAAGCATGTTTGTTTACATTAAAAAGTCCAGACACACTGTATTGTGAAAACTGCTGAACATGT
GGCAGCAATTTTGTGTTTTTATTTTGGAGACGGCTAATGGTAGGAATGTTAATGTAAATAGTGGTGGTAATGTAAAATCATTTCATTTAT
CATTCATGCAAAAAAAAGTATGTATTGAGTGCCTATTCATTGTCACTGTAGATGCAAAACGAATGAGCTGTAACCCCTTCACTCAAGGCA
TTGACAGCTTAGCTGTGAGGGTGGACACACATATGTGTATTTACAGTGCAGTGTAAATAGTTCTGTAGTAGAGGTTAACTCCATATTTCT


Top

FusionGenePPI for PTPRA_SDAD1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTPRAGRB2, KCNA2, SRC, FYN, UVRAG, GABARAPL2, CALM1, LGALS8, FCN1, HSPB1, YWHAZ, SMEK1, EGFR, ERBB2, ARL2, ATXN2, KCNMA1, NCBP1, PSAT1, PTPRE, VPS25, TMEM51, CCDC88A, EPB41L1, PSD3, BASP1, GPRIN3, EXOC3, BAIAP2, RAPH1, NF2, GAB1, ASNSD1, DENND4A, TPCN2, SP4, CYB561, GALNT12, LGALS1, PTPRA, TXNDC5, XPO5, TNPO3, SAAL1, XPO4, B4GAT1, XPO6, PDIA6, NCDN, CSE1L, TNPO1, XPOT, CANX, MBP, PTPRGSDAD1TGIF1, ELAVL1, LAMP1, TARDBP, CSNK2A2, ADARB1, TARBP2, NPM1, ZBTB38, TXNDC15, NAP1L1, FBL, GTPBP4, MRTO4, NMD3, NOC2L, NSA2, RBM28, NTRK1, SCARNA22, CEP19, CDC14B, RBM34, MAGEB10, RPS14, CDX1, RPL18A, FGF8, ZNF512, PLEKHO1, MECP2, TMEM194A, FOXA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTPRA_SDAD1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PTPRA_SDAD1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePTPRAC0036341Schizophrenia2PSYGENET
HgenePTPRAC0151744Myocardial Ischemia1CTD_human